F423609
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 365 | 156 | 365 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300005578|Ga0068854_101368794|Ga0068854_1013687942 |
| Length | 97 |
| Sequence | MRKSLWLGPMLLGACAVVPPQSNVHGTVPGRVCNATGTDGFIGQPGTSESGAAILKATKSAILRWAPPGAMMTMDYSASRVTVHLDDAGRITKISCG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 125 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 126 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 127 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 128 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 129 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 130 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 131 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 132 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 133 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 134 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 135 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 136 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 137 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 138 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 139 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 140 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 141 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 142 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 143 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 144 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 145 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 146 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 151 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 152 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 153 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.45 |
| Metatranscriptomes | 0.55 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.55 |
| Nodule | 0 |
| Rhizoplane | 0.82 |
| Rhizosphere | 98.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10011600 | 3300001979 | Bacteria | 3350 |
| 2 | JGI24737J22298_10001480 | 3300001990 | Bacteria | 8367 |
| 3 | JGI24737J22298_10005858 | 3300001990 | Bacteria | 4230 |
| 4 | JGI24735J21928_10049996 | 3300002067 | Unclassified | 1207 |
| 5 | JGI24738J21930_10048745 | 3300002075 | Bacteria | 862 |
| 6 | Ga0065715_10681301 | 3300005293 | Bacteria | 663 |
| 7 | Ga0065715_10959560 | 3300005293 | Bacteria | 557 |
| 8 | Ga0070658_10062265 | 3300005327 | Bacteria | 3040 |
| 9 | Ga0070658_10074449 | 3300005327 | Bacteria | 2785 |
| 10 | Ga0070658_10118723 | 3300005327 | Bacteria | 2196 |
| 11 | Ga0070658_10208176 | 3300005327 | Bacteria | 1652 |
| 12 | Ga0070658_10295873 | 3300005327 | Bacteria | 1380 |
| 13 | Ga0070658_10508086 | 3300005327 | Bacteria | 1041 |
| 14 | Ga0070658_11495521 | 3300005327 | Bacteria | 585 |
| 15 | Ga0070676_10549540 | 3300005328 | Bacteria | 826 |
| 16 | Ga0070676_11076022 | 3300005328 | Bacteria | 607 |
| 17 | Ga0070683_100011024 | 3300005329 | Bacteria | 7791 |
| 18 | Ga0070683_100018611 | 3300005329 | Bacteria | 6156 |
| 19 | Ga0070690_101158890 | 3300005330 | Bacteria | 615 |
| 20 | Ga0070670_100045551 | 3300005331 | Bacteria | 3771 |
| 21 | Ga0070670_100129434 | 3300005331 | Bacteria | 2179 |
| 22 | Ga0070666_10017491 | 3300005335 | Bacteria | 4596 |
| 23 | Ga0070680_100072921 | 3300005336 | Bacteria | 2822 |
| 24 | Ga0068868_100287853 | 3300005338 | Bacteria | 1392 |
| 25 | Ga0068868_100313468 | 3300005338 | Bacteria | 1335 |
| 26 | Ga0070660_100060237 | 3300005339 | Bacteria | 2945 |
| 27 | Ga0070660_100114145 | 3300005339 | Bacteria | 2151 |
| 28 | Ga0070660_100136989 | 3300005339 | Bacteria | 1962 |
| 29 | Ga0070660_100322534 | 3300005339 | Bacteria | 1269 |
| 30 | Ga0070660_100538382 | 3300005339 | Bacteria | 973 |
| 31 | Ga0070660_100638350 | 3300005339 | Bacteria | 891 |
| 32 | Ga0070660_100703916 | 3300005339 | Bacteria | 847 |
| 33 | Ga0070660_101109957 | 3300005339 | Bacteria | 669 |
| 34 | Ga0070661_100071214 | 3300005344 | Bacteria | 2558 |
| 35 | Ga0070661_100339669 | 3300005344 | Bacteria | 1176 |
| 36 | Ga0070692_10012343 | 3300005345 | Bacteria | 3951 |
| 37 | Ga0070692_10035902 | 3300005345 | Bacteria | 2513 |
| 38 | Ga0070668_100235380 | 3300005347 | Bacteria | 1515 |
| 39 | Ga0070668_100294436 | 3300005347 | Bacteria | 1359 |
| 40 | Ga0070668_100585537 | 3300005347 | Bacteria | 974 |
| 41 | Ga0070669_100070901 | 3300005353 | Bacteria | 2577 |
| 42 | Ga0070669_101340051 | 3300005353 | Unclassified | 620 |
| 43 | Ga0070671_100041832 | 3300005355 | Bacteria | 3808 |
| 44 | Ga0070671_100268886 | 3300005355 | Bacteria | 1449 |
| 45 | Ga0070674_101088411 | 3300005356 | Bacteria | 705 |
| 46 | Ga0070673_100191725 | 3300005364 | Bacteria | 1756 |
| 47 | Ga0070659_100003001 | 3300005366 | Bacteria | 12010 |
| 48 | Ga0070659_100003460 | 3300005366 | Bacteria | 11241 |
| 49 | Ga0070659_100111790 | 3300005366 | Bacteria | 2206 |
| 50 | Ga0070659_100186081 | 3300005366 | Bacteria | 1706 |
| 51 | Ga0070659_100359587 | 3300005366 | Unclassified | 1223 |
| 52 | Ga0070659_100941026 | 3300005366 | Bacteria | 756 |
| 53 | Ga0070667_100006814 | 3300005367 | Bacteria | 9490 |
| 54 | Ga0070667_100013612 | 3300005367 | Bacteria | 6721 |
| 55 | Ga0070667_101650826 | 3300005367 | Bacteria | 603 |
| 56 | Ga0070714_100567322 | 3300005435 | Bacteria | 1088 |
| 57 | Ga0070694_100042375 | 3300005444 | Bacteria | 3040 |
| 58 | Ga0070663_100019157 | 3300005455 | Bacteria | 4504 |
| 59 | Ga0070663_100030479 | 3300005455 | Bacteria | 3697 |
| 60 | Ga0070663_100043702 | 3300005455 | Bacteria | 3154 |
| 61 | Ga0070663_100382489 | 3300005455 | Bacteria | 1147 |
| 62 | Ga0070663_101039160 | 3300005455 | Plasmid | 714 |
| 63 | Ga0070662_100005430 | 3300005457 | Bacteria | 8142 |
| 64 | Ga0070662_100008516 | 3300005457 | Bacteria | 6692 |
| 65 | Ga0070662_100088041 | 3300005457 | Bacteria | 2326 |
| 66 | Ga0070662_100196557 | 3300005457 | Bacteria | 1598 |
| 67 | Ga0070681_10146459 | 3300005458 | Bacteria | 2290 |
| 68 | Ga0070679_100249904 | 3300005530 | Bacteria | 1730 |
| 69 | Ga0070679_100652825 | 3300005530 | Bacteria | 995 |
| 70 | Ga0070679_100782886 | 3300005530 | Bacteria | 897 |
| 71 | Ga0070679_101383028 | 3300005530 | Bacteria | 650 |
| 72 | Ga0070684_100059231 | 3300005535 | Bacteria | 3347 |
| 73 | Ga0068853_100095417 | 3300005539 | Bacteria | 2622 |
| 74 | Ga0068853_100299509 | 3300005539 | Bacteria | 1486 |
| 75 | Ga0068853_101066218 | 3300005539 | Bacteria | 779 |
| 76 | Ga0068853_101915186 | 3300005539 | Unclassified | 575 |
| 77 | Ga0068853_102360735 | 3300005539 | Bacteria | 515 |
| 78 | Ga0070672_100101833 | 3300005543 | Bacteria | 2330 |
| 79 | Ga0070672_100110081 | 3300005543 | Bacteria | 2244 |
| 80 | Ga0070665_100000705 | 3300005548 | Bacteria | 44568 |
| 81 | Ga0070665_100018851 | 3300005548 | Bacteria | 6918 |
| 82 | Ga0070665_100983358 | 3300005548 | Bacteria | 856 |
| 83 | Ga0070704_100193685 | 3300005549 | Bacteria | 1636 |
| 84 | Ga0068855_100022702 | 3300005563 | Bacteria | 7519 |
| 85 | Ga0068855_100183599 | 3300005563 | Bacteria | 2364 |
| 86 | Ga0068855_100465143 | 3300005563 | Bacteria | 1378 |
| 87 | Ga0068855_101278791 | 3300005563 | Bacteria | 760 |
| 88 | Ga0068855_101720218 | 3300005563 | Unclassified | 639 |
| 89 | Ga0070664_100422771 | 3300005564 | Bacteria | 1221 |
| 90 | Ga0068857_100003749 | 3300005577 | Bacteria | 12770 |
| 91 | Ga0068857_100046950 | 3300005577 | Bacteria | 3833 |
| 92 | Ga0068857_100254433 | 3300005577 | Bacteria | 1611 |
| 93 | Ga0068857_100341523 | 3300005577 | Bacteria | 1385 |
| 94 | Ga0068854_100074798 | 3300005578 | Bacteria | 2486 |
| 95 | Ga0068854_100149153 | 3300005578 | Bacteria | 1802 |
| 96 | Ga0068854_100154653 | 3300005578 | Bacteria | 1771 |
| 97 | Ga0068854_100412182 | 3300005578 | Bacteria | 1120 |
| 98 | Ga0068854_101368794 | 3300005578 | Bacteria | 639 |
| 99 | Ga0068856_100119331 | 3300005614 | Bacteria | 2638 |
| 100 | Ga0068852_100032092 | 3300005616 | Bacteria | 4344 |
| 101 | Ga0068852_100154155 | 3300005616 | Bacteria | 2139 |
| 102 | Ga0068859_100000068 | 3300005617 | Bacteria | 96701 |
| 103 | Ga0068864_100000074 | 3300005618 | Bacteria | 109458 |
| 104 | Ga0068866_10690587 | 3300005718 | Bacteria | 699 |
| 105 | Ga0068861_101886569 | 3300005719 | Bacteria | 594 |
| 106 | Ga0068851_10243213 | 3300005834 | Bacteria | 1018 |
| 107 | Ga0068863_100002129 | 3300005841 | Bacteria | 19652 |
| 108 | Ga0068863_100010043 | 3300005841 | Bacteria | 9214 |
| 109 | Ga0068858_100000911 | 3300005842 | Bacteria | 30658 |
| 110 | Ga0068858_100776847 | 3300005842 | Bacteria | 934 |
| 111 | Ga0068860_100002718 | 3300005843 | Bacteria | 18401 |
| 112 | Ga0068860_100307369 | 3300005843 | Bacteria | 1554 |
| 113 | Ga0068860_100437645 | 3300005843 | Bacteria | 1298 |
| 114 | Ga0068860_100715692 | 3300005843 | Bacteria | 1011 |
| 115 | Ga0068862_100112723 | 3300005844 | Bacteria | 2389 |
| 116 | Ga0068862_100117193 | 3300005844 | Bacteria | 2343 |
| 117 | Ga0068862_100213934 | 3300005844 | Bacteria | 1742 |
| 118 | Ga0068862_100400484 | 3300005844 | Bacteria | 1284 |
| 119 | Ga0068862_101348745 | 3300005844 | Bacteria | 715 |
| 120 | Ga0068871_101877927 | 3300006358 | Bacteria | 569 |
| 121 | Ga0075434_101301491 | 3300006871 | Bacteria | 738 |
| 122 | Ga0097620_100000068 | 3300006931 | Bacteria | 96701 |
| 123 | Ga0105251_10114909 | 3300009011 | Bacteria | 1225 |
| 124 | Ga0105250_10046154 | 3300009092 | Bacteria | 1747 |
| 125 | Ga0105240_10155192 | 3300009093 | Bacteria | 2723 |
| 126 | Ga0105245_12566803 | 3300009098 | Unclassified | 563 |
| 127 | Ga0105247_10094052 | 3300009101 | Bacteria | 1906 |
| 128 | Ga0105243_10334866 | 3300009148 | Bacteria | 1384 |
| 129 | Ga0105248_10000071 | 3300009177 | Bacteria | 118281 |
| 130 | Ga0105238_10511040 | 3300009551 | Bacteria | 1203 |
| 131 | Ga0105249_10010369 | 3300009553 | Bacteria | 8189 |
| 132 | Ga0105249_10085827 | 3300009553 | Bacteria | 2934 |
| 133 | Ga0105249_10161118 | 3300009553 | Bacteria | 2168 |
| 134 | Ga0105239_10069920 | 3300010375 | Bacteria | 3855 |
| 135 | Ga0105246_10067835 | 3300011119 | Bacteria | 2500 |
| 136 | Ga0105246_10501765 | 3300011119 | Bacteria | 1031 |
| 137 | Ga0105246_11742363 | 3300011119 | Unclassified | 593 |
| 138 | Ga0157373_10057743 | 3300013100 | Bacteria | 2752 |
| 139 | Ga0157371_10051359 | 3300013102 | Bacteria | 2930 |
| 140 | Ga0157371_10068125 | 3300013102 | Bacteria | 2519 |
| 141 | Ga0157371_10101447 | 3300013102 | Bacteria | 2041 |
| 142 | Ga0157371_10101904 | 3300013102 | Bacteria | 2037 |
| 143 | Ga0157370_10118179 | 3300013104 | Bacteria | 2476 |
| 144 | Ga0157370_10167427 | 3300013104 | Bacteria | 2043 |
| 145 | Ga0157369_10017142 | 3300013105 | Bacteria | 8138 |
| 146 | Ga0157369_10345928 | 3300013105 | Bacteria | 1544 |
| 147 | Ga0157374_10166778 | 3300013296 | Bacteria | 2147 |
| 148 | Ga0157374_10810609 | 3300013296 | Bacteria | 952 |
| 149 | Ga0157374_12117745 | 3300013296 | Unclassified | 589 |
| 150 | Ga0157374_12302064 | 3300013296 | Bacteria | 566 |
| 151 | Ga0157378_11233621 | 3300013297 | Bacteria | 788 |
| 152 | Ga0163162_10041651 | 3300013306 | Bacteria | 4596 |
| 153 | Ga0163162_10145849 | 3300013306 | Bacteria | 2483 |
| 154 | Ga0157372_10102137 | 3300013307 | Bacteria | 3275 |
| 155 | Ga0157372_10469276 | 3300013307 | Bacteria | 1467 |
| 156 | Ga0157372_10544651 | 3300013307 | Bacteria | 1353 |
| 157 | Ga0157372_12357406 | 3300013307 | Bacteria | 611 |
| 158 | Ga0157375_11156136 | 3300013308 | Bacteria | 907 |
| 159 | Ga0163163_10000424 | 3300014325 | Bacteria | 39058 |
| 160 | Ga0163163_10103350 | 3300014325 | Bacteria | 2874 |
| 161 | Ga0157380_13218817 | 3300014326 | Bacteria | 521 |
| 162 | Ga0157377_10062220 | 3300014745 | Bacteria | 2135 |
| 163 | Ga0157379_10047445 | 3300014968 | Bacteria | 3832 |
| 164 | Ga0206354_11666149 | 3300020081 | Bacteria | 1468 |
| 165 | Ga0206353_10466056 | 3300020082 | Bacteria | 3576 |
| 166 | Ga0207656_10034194 | 3300025321 | Bacteria | 2121 |
| 167 | Ga0207713_1081815 | 3300025735 | Bacteria | 1159 |
| 168 | Ga0207642_10544635 | 3300025899 | Bacteria | 716 |
| 169 | Ga0207688_10043915 | 3300025901 | Bacteria | 2490 |
| 170 | Ga0207647_10004486 | 3300025904 | Bacteria | 10341 |
| 171 | Ga0207647_10011342 | 3300025904 | Bacteria | 6254 |
| 172 | Ga0207647_10018345 | 3300025904 | Bacteria | 4736 |
| 173 | Ga0207647_10134491 | 3300025904 | Bacteria | 1451 |
| 174 | Ga0207647_10489309 | 3300025904 | Unclassified | 687 |
| 175 | Ga0207645_10390705 | 3300025907 | Bacteria | 935 |
| 176 | Ga0207645_10572367 | 3300025907 | Bacteria | 767 |
| 177 | Ga0207645_10958851 | 3300025907 | Bacteria | 580 |
| 178 | Ga0207705_10019447 | 3300025909 | Bacteria | 4857 |
| 179 | Ga0207705_10020451 | 3300025909 | Bacteria | 4729 |
| 180 | Ga0207705_10041500 | 3300025909 | Bacteria | 3301 |
| 181 | Ga0207705_10151954 | 3300025909 | Bacteria | 1735 |
| 182 | Ga0207705_10152803 | 3300025909 | Bacteria | 1730 |
| 183 | Ga0207705_10367799 | 3300025909 | Bacteria | 1109 |
| 184 | Ga0207705_10381865 | 3300025909 | Bacteria | 1088 |
| 185 | Ga0207705_10764114 | 3300025909 | Bacteria | 751 |
| 186 | Ga0207707_10088280 | 3300025912 | Bacteria | 2709 |
| 187 | Ga0207695_10070645 | 3300025913 | Bacteria | 3568 |
| 188 | Ga0207693_10831714 | 3300025915 | Unclassified | 711 |
| 189 | Ga0207660_10041667 | 3300025917 | Bacteria | 3219 |
| 190 | Ga0207657_10001484 | 3300025919 | Bacteria | 25105 |
| 191 | Ga0207657_10009192 | 3300025919 | Bacteria | 9966 |
| 192 | Ga0207657_10009585 | 3300025919 | Bacteria | 9721 |
| 193 | Ga0207657_10062452 | 3300025919 | Bacteria | 3189 |
| 194 | Ga0207657_10145795 | 3300025919 | Bacteria | 1931 |
| 195 | Ga0207657_10198237 | 3300025919 | Bacteria | 1616 |
| 196 | Ga0207652_10031608 | 3300025921 | Bacteria | 4447 |
| 197 | Ga0207652_10841868 | 3300025921 | Bacteria | 813 |
| 198 | Ga0207652_10981111 | 3300025921 | Bacteria | 743 |
| 199 | Ga0207681_10022270 | 3300025923 | Bacteria | 4040 |
| 200 | Ga0207681_10171337 | 3300025923 | Bacteria | 1645 |
| 201 | Ga0207681_10591908 | 3300025923 | Bacteria | 916 |
| 202 | Ga0207681_11048049 | 3300025923 | Bacteria | 685 |
| 203 | Ga0207650_10094516 | 3300025925 | Unclassified | 2290 |
| 204 | Ga0207650_10276030 | 3300025925 | Bacteria | 1367 |
| 205 | Ga0207644_10024533 | 3300025931 | Bacteria | 4141 |
| 206 | Ga0207644_10053487 | 3300025931 | Bacteria | 2905 |
| 207 | Ga0207644_10767601 | 3300025931 | Bacteria | 806 |
| 208 | Ga0207690_10006245 | 3300025932 | Bacteria | 7054 |
| 209 | Ga0207690_10031042 | 3300025932 | Bacteria | 3415 |
| 210 | Ga0207690_10113978 | 3300025932 | Bacteria | 1952 |
| 211 | Ga0207690_10131908 | 3300025932 | Bacteria | 1830 |
| 212 | Ga0207690_10734073 | 3300025932 | Bacteria | 813 |
| 213 | Ga0207690_10861746 | 3300025932 | Bacteria | 750 |
| 214 | Ga0207706_10003775 | 3300025933 | Bacteria | 14456 |
| 215 | Ga0207706_10129674 | 3300025933 | Bacteria | 2218 |
| 216 | Ga0207706_10289452 | 3300025933 | Bacteria | 1428 |
| 217 | Ga0207706_10422541 | 3300025933 | Bacteria | 1155 |
| 218 | Ga0207709_11417226 | 3300025935 | Bacteria | 575 |
| 219 | Ga0207669_10188879 | 3300025937 | Bacteria | 1484 |
| 220 | Ga0207669_11869193 | 3300025937 | Bacteria | 513 |
| 221 | Ga0207691_10040048 | 3300025940 | Bacteria | 4332 |
| 222 | Ga0207691_10084858 | 3300025940 | Bacteria | 2842 |
| 223 | Ga0207711_10000046 | 3300025941 | Bacteria | 153238 |
| 224 | Ga0207689_10206138 | 3300025942 | Bacteria | 1624 |
| 225 | Ga0207661_10140345 | 3300025944 | Bacteria | 2079 |
| 226 | Ga0207679_10736295 | 3300025945 | Bacteria | 896 |
| 227 | Ga0207667_10075694 | 3300025949 | Bacteria | 3494 |
| 228 | Ga0207667_10207147 | 3300025949 | Bacteria | 2010 |
| 229 | Ga0207667_10691235 | 3300025949 | Unclassified | 1023 |
| 230 | Ga0207651_10008771 | 3300025960 | Bacteria | 5486 |
| 231 | Ga0207651_10015770 | 3300025960 | Bacteria | 4403 |
| 232 | Ga0207712_10002018 | 3300025961 | Bacteria | 13320 |
| 233 | Ga0207712_10002162 | 3300025961 | Bacteria | 12845 |
| 234 | Ga0207712_10232335 | 3300025961 | Bacteria | 1481 |
| 235 | Ga0207668_10975917 | 3300025972 | Bacteria | 756 |
| 236 | Ga0207668_11841974 | 3300025972 | Bacteria | 546 |
| 237 | Ga0207640_10037833 | 3300025981 | Bacteria | 3039 |
| 238 | Ga0207640_10143266 | 3300025981 | Bacteria | 1745 |
| 239 | Ga0207640_10356755 | 3300025981 | Bacteria | 1177 |
| 240 | Ga0207640_10513284 | 3300025981 | Bacteria | 1000 |
| 241 | Ga0207658_10002809 | 3300025986 | Bacteria | 12519 |
| 242 | Ga0207677_10019883 | 3300026023 | Bacteria | 4065 |
| 243 | Ga0207677_10079165 | 3300026023 | Bacteria | 2349 |
| 244 | Ga0207677_11286963 | 3300026023 | Bacteria | 671 |
| 245 | Ga0207703_10005976 | 3300026035 | Bacteria | 9753 |
| 246 | Ga0207639_11830249 | 3300026041 | Bacteria | 568 |
| 247 | Ga0207639_12196103 | 3300026041 | Bacteria | 513 |
| 248 | Ga0207678_10000938 | 3300026067 | Bacteria | 26581 |
| 249 | Ga0207678_10038028 | 3300026067 | Bacteria | 4184 |
| 250 | Ga0207678_10041857 | 3300026067 | Bacteria | 3970 |
| 251 | Ga0207702_10027882 | 3300026078 | Bacteria | 4692 |
| 252 | Ga0207702_10661039 | 3300026078 | Bacteria | 1028 |
| 253 | Ga0207641_10000188 | 3300026088 | Bacteria | 86532 |
| 254 | Ga0207641_10022827 | 3300026088 | Bacteria | 5152 |
| 255 | Ga0207676_10000438 | 3300026095 | Bacteria | 35161 |
| 256 | Ga0207674_10000607 | 3300026116 | Bacteria | 46991 |
| 257 | Ga0207674_10003633 | 3300026116 | Bacteria | 18804 |
| 258 | Ga0207674_10056377 | 3300026116 | Bacteria | 3991 |
| 259 | Ga0207675_101082574 | 3300026118 | Bacteria | 821 |
| 260 | Ga0207675_101159113 | 3300026118 | Bacteria | 793 |
| 261 | Ga0207683_10301570 | 3300026121 | Bacteria | 1466 |
| 262 | Ga0207698_10208930 | 3300026142 | Bacteria | 1755 |
| 263 | Ga0207698_10254737 | 3300026142 | Bacteria | 1608 |
| 264 | Ga0207698_11969910 | 3300026142 | Unclassified | 599 |
| 265 | Ga0207698_12074535 | 3300026142 | Bacteria | 582 |
| 266 | Ga0268266_10000133 | 3300028379 | Bacteria | 143210 |
| 267 | Ga0268266_10236991 | 3300028379 | Bacteria | 1682 |
| 268 | Ga0268266_11210732 | 3300028379 | Bacteria | 730 |
| 269 | Ga0268265_10038048 | 3300028380 | Bacteria | 3536 |
| 270 | Ga0268265_10068675 | 3300028380 | Bacteria | 2749 |
| 271 | Ga0268265_10090274 | 3300028380 | Bacteria | 2447 |
| 272 | Ga0268265_10313961 | 3300028380 | Bacteria | 1416 |
| 273 | Ga0268265_10389086 | 3300028380 | Bacteria | 1285 |
| 274 | Ga0268264_10003474 | 3300028381 | Bacteria | 13589 |
| 275 | Ga0268264_10008704 | 3300028381 | Bacteria | 8430 |
| 276 | Ga0268264_10263287 | 3300028381 | Bacteria | 1607 |
| 277 | Ga0268264_10853077 | 3300028381 | Bacteria | 912 |
| 278 | Ga0268264_10979718 | 3300028381 | Bacteria | 851 |
| 279 | Ga0307513_10355935 | 3300031456 | Bacteria | 1210 |
| 280 | Ga0307406_11013290 | 3300031901 | Bacteria | 713 |
| 281 | Ga0373951_0128579 | 3300035091 | Bacteria | 695 |
| 282 | Ga0373939_0174547 | 3300035114 | Bacteria | 798 |
| 283 | Ga0373931_0629488 | 3300035691 | Bacteria | 703 |
| 284 | Ga0395899_0066274 | 3300037312 | Bacteria | 2652 |
| 285 | Ga0395899_0092848 | 3300037312 | Bacteria | 2185 |
| 286 | Ga0395899_0164213 | 3300037312 | Bacteria | 1567 |
| 287 | Ga0395899_0217655 | 3300037312 | Bacteria | 1324 |
| 288 | Ga0395900_0001365 | 3300037418 | Bacteria | 29397 |
| 289 | Ga0395900_0025498 | 3300037418 | Bacteria | 6053 |
| 290 | Ga0395900_0039946 | 3300037418 | Bacteria | 4836 |
| 291 | Ga0395900_0042842 | 3300037418 | Bacteria | 4663 |
| 292 | Ga0395900_0109536 | 3300037418 | Bacteria | 2837 |
| 293 | Ga0395900_0218694 | 3300037418 | Bacteria | 1921 |
| 294 | Ga0395900_0310698 | 3300037418 | Bacteria | 1559 |
| 295 | Ga0395900_0442018 | 3300037418 | Bacteria | 1258 |
| 296 | Ga0395900_0478960 | 3300037418 | Bacteria | 1197 |
| 297 | Ga0395900_0694472 | 3300037418 | Bacteria | 951 |
| 298 | Ga0395900_1018035 | 3300037418 | Bacteria | 748 |
| 299 | Ga0395898_0004373 | 3300037466 | Bacteria | 15457 |
| 300 | Ga0395898_0017607 | 3300037466 | Bacteria | 7293 |
| 301 | Ga0395898_0043518 | 3300037466 | Bacteria | 4424 |
| 302 | Ga0395898_0053393 | 3300037466 | Bacteria | 3947 |
| 303 | Ga0395898_0344894 | 3300037466 | Bacteria | 1420 |
| 304 | Ga0395898_0379931 | 3300037466 | Bacteria | 1347 |
| 305 | Ga0395898_1330552 | 3300037466 | Bacteria | 647 |
| 306 | Ga0395898_1386153 | 3300037466 | Bacteria | 631 |
| 307 | Ga0395905_0001405 | 3300037471 | Bacteria | 29143 |
| 308 | Ga0395905_0002442 | 3300037471 | Bacteria | 20597 |
| 309 | Ga0395905_0002664 | 3300037471 | Bacteria | 19591 |
| 310 | Ga0395905_0006674 | 3300037471 | Bacteria | 11564 |
| 311 | Ga0395905_0009990 | 3300037471 | Bacteria | 9251 |
| 312 | Ga0395905_0010084 | 3300037471 | Bacteria | 9208 |
| 313 | Ga0395905_0023120 | 3300037471 | Bacteria | 5877 |
| 314 | Ga0395905_0142166 | 3300037471 | Bacteria | 2257 |
| 315 | Ga0395905_0168698 | 3300037471 | Bacteria | 2056 |
| 316 | Ga0395905_0191262 | 3300037471 | Bacteria | 1920 |
| 317 | Ga0395905_0407089 | 3300037471 | Bacteria | 1255 |
| 318 | Ga0395905_1111569 | 3300037471 | Bacteria | 694 |
| 319 | Ga0395905_1181766 | 3300037471 | Bacteria | 668 |
| 320 | Ga0395905_1775330 | 3300037471 | Unclassified | 522 |
| 321 | Ga0395905_1775775 | 3300037471 | Plasmid | 522 |
| 322 | Ga0395901_0005264 | 3300038443 | Bacteria | 13064 |
| 323 | Ga0395901_0012250 | 3300038443 | Bacteria | 8703 |
| 324 | Ga0395901_0029181 | 3300038443 | Bacteria | 5677 |
| 325 | Ga0395901_0033245 | 3300038443 | Bacteria | 5323 |
| 326 | Ga0395901_0034269 | 3300038443 | Bacteria | 5243 |
| 327 | Ga0395901_0060837 | 3300038443 | Bacteria | 3930 |
| 328 | Ga0395901_0096908 | 3300038443 | Bacteria | 3091 |
| 329 | Ga0395901_0098480 | 3300038443 | Bacteria | 3066 |
| 330 | Ga0395901_0277514 | 3300038443 | Bacteria | 1742 |
| 331 | Ga0395901_0690107 | 3300038443 | Bacteria | 1020 |
| 332 | Ga0395901_0775275 | 3300038443 | Bacteria | 950 |
| 333 | Ga0395901_2123459 | 3300038443 | Bacteria | 507 |
| 334 | Ga0439455_0141462 | 3300042012 | Bacteria | 682 |
| 335 | Ga0439458_0001899 | 3300042157 | Bacteria | 5172 |
| 336 | Ga0439458_0004254 | 3300042157 | Bacteria | 3304 |
| 337 | Ga0466969_0255490 | 3300044656 | Bacteria | 794 |
| 338 | Ga0466972_0043729 | 3300044658 | Bacteria | 2174 |
| 339 | Ga0466972_0161949 | 3300044658 | Bacteria | 1051 |
| 340 | Ga0466972_0331501 | 3300044658 | Bacteria | 711 |
| 341 | Ga0466963_0095662 | 3300044694 | Bacteria | 2028 |
| 342 | Ga0466971_0020898 | 3300044719 | Bacteria | 2910 |
| 343 | Ga0466970_0023763 | 3300044765 | Bacteria | 3204 |
| 344 | Ga0466970_0151713 | 3300044765 | Bacteria | 1279 |
| 345 | Ga0466970_0199380 | 3300044765 | Bacteria | 1113 |
| 346 | Ga0466957_0048366 | 3300044842 | Bacteria | 2585 |
| 347 | Ga0466957_0124029 | 3300044842 | Bacteria | 1649 |
| 348 | Ga0466957_0262137 | 3300044842 | Bacteria | 1152 |
| 349 | Ga0466960_0138599 | 3300044901 | Bacteria | 1290 |
| 350 | Ga0466959_0063579 | 3300045049 | Bacteria | 2679 |
| 351 | Ga0466958_0108496 | 3300045836 | Bacteria | 1732 |
| 352 | Ga0466958_0823109 | 3300045836 | Bacteria | 605 |
| 353 | Ga0466967_0561518 | 3300045976 | Bacteria | 1124 |
| 354 | Ga0466967_1321999 | 3300045976 | Bacteria | 718 |
| 355 | Ga0495668_0014796 | 3300046616 | Bacteria | 4567 |
| 356 | Ga0495625_0532237 | 3300046660 | Bacteria | 714 |
| 357 | Ga0495669_0190761 | 3300046684 | Bacteria | 978 |
| 358 | Ga0496101_0137792 | 3300048904 | Bacteria | 1858 |
| 359 | Ga0496112_0699598 | 3300048915 | Bacteria | 941 |
| 360 | Ga0496115_0048046 | 3300048918 | Bacteria | 3413 |
| 361 | nmdc:mga0k408_108826_c1 | 3300050493 | Bacteria | 1637 |
| 362 | nmdc:mga0n895_953045_c1 | 3300050512 | Bacteria | 841 |
| 363 | nmdc:mga0rr50_191958_c1 | 3300050513 | Bacteria | 1674 |
| 364 | nmdc:mga0a205_62268_c1 | 3300050515 | Bacteria | 3605 |
| 365 | Ga0500658_0000315 | 3300053134 | Bacteria | 21646 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0561518 | Ga0466967_0561518_671_949 | 89 |
| 2 | 3300005844 | Ga0068862_100213934 | Ga0068862_1002139342 | 91 |
| 3 | 3300028380 | Ga0268265_10068675 | Ga0268265_100686753 | 91 |
| 4 | 3300037471 | Ga0395905_0191262 | Ga0395905_0191262_707_1018 | 91 |
| 5 | 3300044656 | Ga0466969_0255490 | Ga0466969_0255490_505_780 | 91 |
| 6 | 3300044658 | Ga0466972_0043729 | Ga0466972_0043729_1629_1904 | 91 |
| 7 | 3300044694 | Ga0466963_0095662 | Ga0466963_0095662_228_503 | 91 |
| 8 | 3300044719 | Ga0466971_0020898 | Ga0466971_0020898_1947_2222 | 91 |
| 9 | 3300044765 | Ga0466970_0023763 | Ga0466970_0023763_921_1241 | 91 |
| 10 | 3300044765 | Ga0466970_0199380 | Ga0466970_0199380_399_674 | 91 |
| 11 | 3300044842 | Ga0466957_0048366 | Ga0466957_0048366_1919_2194 | 91 |
| 12 | 3300045049 | Ga0466959_0063579 | Ga0466959_0063579_771_1046 | 91 |
| 13 | 3300045836 | Ga0466958_0823109 | Ga0466958_0823109_119_394 | 91 |
| 14 | 3300044658 | Ga0466972_0161949 | Ga0466972_0161949_32_310 | 92 |
| 15 | 3300044765 | Ga0466970_0151713 | Ga0466970_0151713_176_454 | 92 |
| 16 | 3300001990 | JGI24737J22298_10001480 | JGI24737J22298_100014803 | 94 |
| 17 | 3300001990 | JGI24737J22298_10005858 | JGI24737J22298_100058584 | 94 |
| 18 | 3300002067 | JGI24735J21928_10049996 | JGI24735J21928_100499962 | 94 |
| 19 | 3300002075 | JGI24738J21930_10048745 | JGI24738J21930_100487452 | 94 |
| 20 | 3300005293 | Ga0065715_10681301 | Ga0065715_106813011 | 94 |
| 21 | 3300005293 | Ga0065715_10959560 | Ga0065715_109595601 | 94 |
| 22 | 3300005327 | Ga0070658_10062265 | Ga0070658_100622653 | 94 |
| 23 | 3300005327 | Ga0070658_10074449 | Ga0070658_100744492 | 94 |
| 24 | 3300005327 | Ga0070658_10118723 | Ga0070658_101187233 | 94 |
| 25 | 3300005327 | Ga0070658_10208176 | Ga0070658_102081763 | 94 |
| 26 | 3300005327 | Ga0070658_10295873 | Ga0070658_102958732 | 94 |
| 27 | 3300005328 | Ga0070676_10549540 | Ga0070676_105495402 | 94 |
| 28 | 3300005328 | Ga0070676_11076022 | Ga0070676_110760222 | 94 |
| 29 | 3300005329 | Ga0070683_100011024 | Ga0070683_1000110249 | 94 |
| 30 | 3300005330 | Ga0070690_101158890 | Ga0070690_1011588901 | 94 |
| 31 | 3300005331 | Ga0070670_100045551 | Ga0070670_1000455512 | 94 |
| 32 | 3300005331 | Ga0070670_100129434 | Ga0070670_1001294342 | 94 |
| 33 | 3300005338 | Ga0068868_100287853 | Ga0068868_1002878533 | 94 |
| 34 | 3300005338 | Ga0068868_100313468 | Ga0068868_1003134682 | 94 |
| 35 | 3300005339 | Ga0070660_100060237 | Ga0070660_1000602371 | 94 |
| 36 | 3300005339 | Ga0070660_100136989 | Ga0070660_1001369892 | 94 |
| 37 | 3300005339 | Ga0070660_100322534 | Ga0070660_1003225342 | 94 |
| 38 | 3300005339 | Ga0070660_100538382 | Ga0070660_1005383822 | 94 |
| 39 | 3300005339 | Ga0070660_100638350 | Ga0070660_1006383502 | 94 |
| 40 | 3300005339 | Ga0070660_100703916 | Ga0070660_1007039162 | 94 |
| 41 | 3300005339 | Ga0070660_101109957 | Ga0070660_1011099572 | 94 |
| 42 | 3300005344 | Ga0070661_100071214 | Ga0070661_1000712143 | 94 |
| 43 | 3300005345 | Ga0070692_10035902 | Ga0070692_100359024 | 94 |
| 44 | 3300005347 | Ga0070668_100235380 | Ga0070668_1002353803 | 94 |
| 45 | 3300005347 | Ga0070668_100294436 | Ga0070668_1002944363 | 94 |
| 46 | 3300005347 | Ga0070668_100585537 | Ga0070668_1005855372 | 94 |
| 47 | 3300005353 | Ga0070669_100070901 | Ga0070669_1000709013 | 94 |
| 48 | 3300005355 | Ga0070671_100041832 | Ga0070671_1000418325 | 94 |
| 49 | 3300005356 | Ga0070674_101088411 | Ga0070674_1010884112 | 94 |
| 50 | 3300005364 | Ga0070673_100191725 | Ga0070673_1001917251 | 94 |
| 51 | 3300005366 | Ga0070659_100003001 | Ga0070659_1000030012 | 94 |
| 52 | 3300005366 | Ga0070659_100003460 | Ga0070659_1000034607 | 94 |
| 53 | 3300005366 | Ga0070659_100111790 | Ga0070659_1001117903 | 94 |
| 54 | 3300005366 | Ga0070659_100186081 | Ga0070659_1001860812 | 94 |
| 55 | 3300005366 | Ga0070659_100359587 | Ga0070659_1003595872 | 94 |
| 56 | 3300005366 | Ga0070659_100941026 | Ga0070659_1009410262 | 94 |
| 57 | 3300005367 | Ga0070667_100006814 | Ga0070667_1000068143 | 94 |
| 58 | 3300005367 | Ga0070667_100013612 | Ga0070667_1000136129 | 94 |
| 59 | 3300005367 | Ga0070667_101650826 | Ga0070667_1016508262 | 94 |
| 60 | 3300005435 | Ga0070714_100567322 | Ga0070714_1005673222 | 94 |
| 61 | 3300005444 | Ga0070694_100042375 | Ga0070694_1000423752 | 94 |
| 62 | 3300005455 | Ga0070663_100030479 | Ga0070663_1000304794 | 94 |
| 63 | 3300005455 | Ga0070663_100043702 | Ga0070663_1000437022 | 94 |
| 64 | 3300005455 | Ga0070663_100382489 | Ga0070663_1003824892 | 94 |
| 65 | 3300005455 | Ga0070663_101039160 | Ga0070663_1010391601 | 94 |
| 66 | 3300005457 | Ga0070662_100005430 | Ga0070662_10000543011 | 94 |
| 67 | 3300005457 | Ga0070662_100008516 | Ga0070662_1000085164 | 94 |
| 68 | 3300005457 | Ga0070662_100088041 | Ga0070662_1000880413 | 94 |
| 69 | 3300005457 | Ga0070662_100196557 | Ga0070662_1001965572 | 94 |
| 70 | 3300005530 | Ga0070679_100249904 | Ga0070679_1002499041 | 94 |
| 71 | 3300005530 | Ga0070679_100652825 | Ga0070679_1006528251 | 94 |
| 72 | 3300005530 | Ga0070679_100782886 | Ga0070679_1007828862 | 94 |
| 73 | 3300005530 | Ga0070679_101383028 | Ga0070679_1013830281 | 94 |
| 74 | 3300005539 | Ga0068853_100095417 | Ga0068853_1000954172 | 94 |
| 75 | 3300005539 | Ga0068853_100299509 | Ga0068853_1002995092 | 94 |
| 76 | 3300005539 | Ga0068853_101066218 | Ga0068853_1010662182 | 94 |
| 77 | 3300005539 | Ga0068853_101915186 | Ga0068853_1019151861 | 94 |
| 78 | 3300005539 | Ga0068853_102360735 | Ga0068853_1023607351 | 94 |
| 79 | 3300005543 | Ga0070672_100101833 | Ga0070672_1001018333 | 94 |
| 80 | 3300005543 | Ga0070672_100110081 | Ga0070672_1001100812 | 94 |
| 81 | 3300005548 | Ga0070665_100000705 | Ga0070665_10000070543 | 94 |
| 82 | 3300005548 | Ga0070665_100018851 | Ga0070665_1000188515 | 94 |
| 83 | 3300005548 | Ga0070665_100983358 | Ga0070665_1009833582 | 94 |
| 84 | 3300005549 | Ga0070704_100193685 | Ga0070704_1001936851 | 94 |
| 85 | 3300005563 | Ga0068855_100183599 | Ga0068855_1001835993 | 94 |
| 86 | 3300005563 | Ga0068855_100465143 | Ga0068855_1004651432 | 94 |
| 87 | 3300005563 | Ga0068855_101278791 | Ga0068855_1012787912 | 94 |
| 88 | 3300005563 | Ga0068855_101720218 | Ga0068855_1017202182 | 94 |
| 89 | 3300005577 | Ga0068857_100003749 | Ga0068857_10000374911 | 94 |
| 90 | 3300005577 | Ga0068857_100046950 | Ga0068857_1000469503 | 94 |
| 91 | 3300005577 | Ga0068857_100254433 | Ga0068857_1002544333 | 94 |
| 92 | 3300005577 | Ga0068857_100341523 | Ga0068857_1003415232 | 94 |
| 93 | 3300005578 | Ga0068854_100074798 | Ga0068854_1000747983 | 94 |
| 94 | 3300005578 | Ga0068854_100149153 | Ga0068854_1001491532 | 94 |
| 95 | 3300005578 | Ga0068854_100154653 | Ga0068854_1001546532 | 94 |
| 96 | 3300005578 | Ga0068854_101368794 | Ga0068854_1013687942 | 94 |
| 97 | 3300005616 | Ga0068852_100032092 | Ga0068852_1000320923 | 94 |
| 98 | 3300005616 | Ga0068852_100154155 | Ga0068852_1001541553 | 94 |
| 99 | 3300005617 | Ga0068859_100000068 | Ga0068859_10000006892 | 94 |
| 100 | 3300005618 | Ga0068864_100000074 | Ga0068864_10000007490 | 94 |
| 101 | 3300005718 | Ga0068866_10690587 | Ga0068866_106905872 | 94 |
| 102 | 3300005719 | Ga0068861_101886569 | Ga0068861_1018865692 | 94 |
| 103 | 3300005834 | Ga0068851_10243213 | Ga0068851_102432132 | 94 |
| 104 | 3300005841 | Ga0068863_100002129 | Ga0068863_1000021293 | 94 |
| 105 | 3300005841 | Ga0068863_100010043 | Ga0068863_10001004310 | 94 |
| 106 | 3300005842 | Ga0068858_100000911 | Ga0068858_10000091128 | 94 |
| 107 | 3300005843 | Ga0068860_100002718 | Ga0068860_1000027189 | 94 |
| 108 | 3300005843 | Ga0068860_100307369 | Ga0068860_1003073692 | 94 |
| 109 | 3300005843 | Ga0068860_100437645 | Ga0068860_1004376452 | 94 |
| 110 | 3300005843 | Ga0068860_100715692 | Ga0068860_1007156922 | 94 |
| 111 | 3300005844 | Ga0068862_100112723 | Ga0068862_1001127232 | 94 |
| 112 | 3300005844 | Ga0068862_100117193 | Ga0068862_1001171934 | 94 |
| 113 | 3300005844 | Ga0068862_100400484 | Ga0068862_1004004843 | 94 |
| 114 | 3300005844 | Ga0068862_101348745 | Ga0068862_1013487452 | 94 |
| 115 | 3300006358 | Ga0068871_101877927 | Ga0068871_1018779272 | 94 |
| 116 | 3300006871 | Ga0075434_101301491 | Ga0075434_1013014912 | 94 |
| 117 | 3300006931 | Ga0097620_100000068 | Ga0097620_10000006892 | 94 |
| 118 | 3300009011 | Ga0105251_10114909 | Ga0105251_101149092 | 94 |
| 119 | 3300009092 | Ga0105250_10046154 | Ga0105250_100461542 | 94 |
| 120 | 3300009093 | Ga0105240_10155192 | Ga0105240_101551923 | 94 |
| 121 | 3300009098 | Ga0105245_12566803 | Ga0105245_125668031 | 94 |
| 122 | 3300009101 | Ga0105247_10094052 | Ga0105247_100940522 | 94 |
| 123 | 3300009148 | Ga0105243_10334866 | Ga0105243_103348662 | 94 |
| 124 | 3300009177 | Ga0105248_10000071 | Ga0105248_1000007135 | 94 |
| 125 | 3300009551 | Ga0105238_10511040 | Ga0105238_105110402 | 94 |
| 126 | 3300009553 | Ga0105249_10010369 | Ga0105249_100103694 | 94 |
| 127 | 3300009553 | Ga0105249_10085827 | Ga0105249_100858272 | 94 |
| 128 | 3300009553 | Ga0105249_10161118 | Ga0105249_101611182 | 94 |
| 129 | 3300010375 | Ga0105239_10069920 | Ga0105239_100699202 | 94 |
| 130 | 3300011119 | Ga0105246_10067835 | Ga0105246_100678352 | 94 |
| 131 | 3300011119 | Ga0105246_10501765 | Ga0105246_105017652 | 94 |
| 132 | 3300013100 | Ga0157373_10057743 | Ga0157373_100577433 | 94 |
| 133 | 3300013102 | Ga0157371_10051359 | Ga0157371_100513595 | 94 |
| 134 | 3300013102 | Ga0157371_10068125 | Ga0157371_100681252 | 94 |
| 135 | 3300013102 | Ga0157371_10101447 | Ga0157371_101014472 | 94 |
| 136 | 3300013102 | Ga0157371_10101904 | Ga0157371_101019043 | 94 |
| 137 | 3300013104 | Ga0157370_10167427 | Ga0157370_101674273 | 94 |
| 138 | 3300013105 | Ga0157369_10017142 | Ga0157369_100171428 | 94 |
| 139 | 3300013105 | Ga0157369_10345928 | Ga0157369_103459282 | 94 |
| 140 | 3300013296 | Ga0157374_10810609 | Ga0157374_108106092 | 94 |
| 141 | 3300013296 | Ga0157374_12117745 | Ga0157374_121177451 | 94 |
| 142 | 3300013296 | Ga0157374_12302064 | Ga0157374_123020641 | 94 |
| 143 | 3300013297 | Ga0157378_11233621 | Ga0157378_112336212 | 94 |
| 144 | 3300013306 | Ga0163162_10041651 | Ga0163162_100416513 | 94 |
| 145 | 3300013306 | Ga0163162_10145849 | Ga0163162_101458493 | 94 |
| 146 | 3300013307 | Ga0157372_10102137 | Ga0157372_101021372 | 94 |
| 147 | 3300013307 | Ga0157372_10469276 | Ga0157372_104692762 | 94 |
| 148 | 3300013307 | Ga0157372_10544651 | Ga0157372_105446513 | 94 |
| 149 | 3300013307 | Ga0157372_12357406 | Ga0157372_123574062 | 94 |
| 150 | 3300013308 | Ga0157375_11156136 | Ga0157375_111561362 | 94 |
| 151 | 3300014325 | Ga0163163_10000424 | Ga0163163_1000042418 | 94 |
| 152 | 3300014325 | Ga0163163_10103350 | Ga0163163_101033503 | 94 |
| 153 | 3300014326 | Ga0157380_13218817 | Ga0157380_132188172 | 94 |
| 154 | 3300014745 | Ga0157377_10062220 | Ga0157377_100622202 | 94 |
| 155 | 3300014968 | Ga0157379_10047445 | Ga0157379_100474452 | 94 |
| 156 | 3300020081 | Ga0206354_11666149 | Ga0206354_116661492 | 94 |
| 157 | 3300020082 | Ga0206353_10466056 | Ga0206353_104660562 | 94 |
| 158 | 3300025321 | Ga0207656_10034194 | Ga0207656_100341942 | 94 |
| 159 | 3300025735 | Ga0207713_1081815 | Ga0207713_10818152 | 94 |
| 160 | 3300025899 | Ga0207642_10544635 | Ga0207642_105446352 | 94 |
| 161 | 3300025901 | Ga0207688_10043915 | Ga0207688_100439152 | 94 |
| 162 | 3300025904 | Ga0207647_10004486 | Ga0207647_100044864 | 94 |
| 163 | 3300025904 | Ga0207647_10011342 | Ga0207647_100113423 | 94 |
| 164 | 3300025904 | Ga0207647_10018345 | Ga0207647_100183453 | 94 |
| 165 | 3300025904 | Ga0207647_10134491 | Ga0207647_101344912 | 94 |
| 166 | 3300025904 | Ga0207647_10489309 | Ga0207647_104893092 | 94 |
| 167 | 3300025907 | Ga0207645_10390705 | Ga0207645_103907052 | 94 |
| 168 | 3300025907 | Ga0207645_10572367 | Ga0207645_105723672 | 94 |
| 169 | 3300025907 | Ga0207645_10958851 | Ga0207645_109588512 | 94 |
| 170 | 3300025909 | Ga0207705_10019447 | Ga0207705_100194473 | 94 |
| 171 | 3300025909 | Ga0207705_10041500 | Ga0207705_100415002 | 94 |
| 172 | 3300025909 | Ga0207705_10151954 | Ga0207705_101519542 | 94 |
| 173 | 3300025909 | Ga0207705_10152803 | Ga0207705_101528032 | 94 |
| 174 | 3300025909 | Ga0207705_10367799 | Ga0207705_103677992 | 94 |
| 175 | 3300025909 | Ga0207705_10381865 | Ga0207705_103818652 | 94 |
| 176 | 3300025909 | Ga0207705_10764114 | Ga0207705_107641142 | 94 |
| 177 | 3300025913 | Ga0207695_10070645 | Ga0207695_100706454 | 94 |
| 178 | 3300025915 | Ga0207693_10831714 | Ga0207693_108317142 | 94 |
| 179 | 3300025919 | Ga0207657_10009192 | Ga0207657_1000919210 | 94 |
| 180 | 3300025919 | Ga0207657_10009585 | Ga0207657_100095859 | 94 |
| 181 | 3300025919 | Ga0207657_10062452 | Ga0207657_100624522 | 94 |
| 182 | 3300025919 | Ga0207657_10145795 | Ga0207657_101457953 | 94 |
| 183 | 3300025919 | Ga0207657_10198237 | Ga0207657_101982373 | 94 |
| 184 | 3300025921 | Ga0207652_10841868 | Ga0207652_108418681 | 94 |
| 185 | 3300025921 | Ga0207652_10981111 | Ga0207652_109811112 | 94 |
| 186 | 3300025923 | Ga0207681_10022270 | Ga0207681_100222703 | 94 |
| 187 | 3300025923 | Ga0207681_10171337 | Ga0207681_101713373 | 94 |
| 188 | 3300025923 | Ga0207681_10591908 | Ga0207681_105919082 | 94 |
| 189 | 3300025925 | Ga0207650_10094516 | Ga0207650_100945163 | 94 |
| 190 | 3300025925 | Ga0207650_10276030 | Ga0207650_102760302 | 94 |
| 191 | 3300025931 | Ga0207644_10053487 | Ga0207644_100534874 | 94 |
| 192 | 3300025932 | Ga0207690_10006245 | Ga0207690_100062452 | 94 |
| 193 | 3300025932 | Ga0207690_10031042 | Ga0207690_100310424 | 94 |
| 194 | 3300025932 | Ga0207690_10113978 | Ga0207690_101139783 | 94 |
| 195 | 3300025932 | Ga0207690_10131908 | Ga0207690_101319083 | 94 |
| 196 | 3300025932 | Ga0207690_10734073 | Ga0207690_107340731 | 94 |
| 197 | 3300025932 | Ga0207690_10861746 | Ga0207690_108617462 | 94 |
| 198 | 3300025933 | Ga0207706_10003775 | Ga0207706_1000377511 | 94 |
| 199 | 3300025933 | Ga0207706_10129674 | Ga0207706_101296744 | 94 |
| 200 | 3300025933 | Ga0207706_10289452 | Ga0207706_102894522 | 94 |
| 201 | 3300025933 | Ga0207706_10422541 | Ga0207706_104225412 | 94 |
| 202 | 3300025935 | Ga0207709_11417226 | Ga0207709_114172262 | 94 |
| 203 | 3300025937 | Ga0207669_10188879 | Ga0207669_101888792 | 94 |
| 204 | 3300025937 | Ga0207669_11869193 | Ga0207669_118691932 | 94 |
| 205 | 3300025940 | Ga0207691_10040048 | Ga0207691_100400483 | 94 |
| 206 | 3300025940 | Ga0207691_10084858 | Ga0207691_100848583 | 94 |
| 207 | 3300025941 | Ga0207711_10000046 | Ga0207711_100000468 | 94 |
| 208 | 3300025942 | Ga0207689_10206138 | Ga0207689_102061383 | 94 |
| 209 | 3300025944 | Ga0207661_10140345 | Ga0207661_101403452 | 94 |
| 210 | 3300025949 | Ga0207667_10207147 | Ga0207667_102071473 | 94 |
| 211 | 3300025949 | Ga0207667_10691235 | Ga0207667_106912352 | 94 |
| 212 | 3300025960 | Ga0207651_10008771 | Ga0207651_100087712 | 94 |
| 213 | 3300025960 | Ga0207651_10015770 | Ga0207651_100157702 | 94 |
| 214 | 3300025961 | Ga0207712_10002018 | Ga0207712_100020186 | 94 |
| 215 | 3300025961 | Ga0207712_10002162 | Ga0207712_100021625 | 94 |
| 216 | 3300025961 | Ga0207712_10232335 | Ga0207712_102323353 | 94 |
| 217 | 3300025972 | Ga0207668_10975917 | Ga0207668_109759172 | 94 |
| 218 | 3300025972 | Ga0207668_11841974 | Ga0207668_118419741 | 94 |
| 219 | 3300025981 | Ga0207640_10037833 | Ga0207640_100378333 | 94 |
| 220 | 3300025981 | Ga0207640_10356755 | Ga0207640_103567553 | 94 |
| 221 | 3300025981 | Ga0207640_10513284 | Ga0207640_105132842 | 94 |
| 222 | 3300025986 | Ga0207658_10002809 | Ga0207658_100028096 | 94 |
| 223 | 3300026023 | Ga0207677_10019883 | Ga0207677_100198833 | 94 |
| 224 | 3300026023 | Ga0207677_11286963 | Ga0207677_112869631 | 94 |
| 225 | 3300026035 | Ga0207703_10005976 | Ga0207703_100059765 | 94 |
| 226 | 3300026041 | Ga0207639_11830249 | Ga0207639_118302492 | 94 |
| 227 | 3300026041 | Ga0207639_12196103 | Ga0207639_121961031 | 94 |
| 228 | 3300026067 | Ga0207678_10038028 | Ga0207678_100380284 | 94 |
| 229 | 3300026067 | Ga0207678_10041857 | Ga0207678_100418573 | 94 |
| 230 | 3300026078 | Ga0207702_10661039 | Ga0207702_106610392 | 94 |
| 231 | 3300026088 | Ga0207641_10000188 | Ga0207641_1000018826 | 94 |
| 232 | 3300026088 | Ga0207641_10022827 | Ga0207641_100228273 | 94 |
| 233 | 3300026095 | Ga0207676_10000438 | Ga0207676_1000043832 | 94 |
| 234 | 3300026116 | Ga0207674_10000607 | Ga0207674_1000060731 | 94 |
| 235 | 3300026116 | Ga0207674_10003633 | Ga0207674_1000363313 | 94 |
| 236 | 3300026116 | Ga0207674_10056377 | Ga0207674_100563773 | 94 |
| 237 | 3300026118 | Ga0207675_101082574 | Ga0207675_1010825742 | 94 |
| 238 | 3300026118 | Ga0207675_101159113 | Ga0207675_1011591132 | 94 |
| 239 | 3300026121 | Ga0207683_10301570 | Ga0207683_103015701 | 94 |
| 240 | 3300026142 | Ga0207698_10208930 | Ga0207698_102089303 | 94 |
| 241 | 3300026142 | Ga0207698_10254737 | Ga0207698_102547372 | 94 |
| 242 | 3300026142 | Ga0207698_11969910 | Ga0207698_119699102 | 94 |
| 243 | 3300028379 | Ga0268266_10000133 | Ga0268266_1000013364 | 94 |
| 244 | 3300028379 | Ga0268266_10236991 | Ga0268266_102369912 | 94 |
| 245 | 3300028379 | Ga0268266_11210732 | Ga0268266_112107322 | 94 |
| 246 | 3300028380 | Ga0268265_10038048 | Ga0268265_100380484 | 94 |
| 247 | 3300028380 | Ga0268265_10090274 | Ga0268265_100902742 | 94 |
| 248 | 3300028380 | Ga0268265_10313961 | Ga0268265_103139612 | 94 |
| 249 | 3300028380 | Ga0268265_10389086 | Ga0268265_103890861 | 94 |
| 250 | 3300028381 | Ga0268264_10003474 | Ga0268264_1000347411 | 94 |
| 251 | 3300028381 | Ga0268264_10008704 | Ga0268264_100087049 | 94 |
| 252 | 3300028381 | Ga0268264_10263287 | Ga0268264_102632872 | 94 |
| 253 | 3300028381 | Ga0268264_10853077 | Ga0268264_108530772 | 94 |
| 254 | 3300031456 | Ga0307513_10355935 | Ga0307513_103559352 | 94 |
| 255 | 3300031901 | Ga0307406_11013290 | Ga0307406_110132902 | 94 |
| 256 | 3300035091 | Ga0373951_0128579 | Ga0373951_0128579_177_470 | 94 |
| 257 | 3300035114 | Ga0373939_0174547 | Ga0373939_0174547_64_357 | 94 |
| 258 | 3300037312 | Ga0395899_0164213 | Ga0395899_0164213_410_703 | 94 |
| 259 | 3300037418 | Ga0395900_0042842 | Ga0395900_0042842_2495_2788 | 94 |
| 260 | 3300037418 | Ga0395900_0218694 | Ga0395900_0218694_229_516 | 94 |
| 261 | 3300037418 | Ga0395900_1018035 | Ga0395900_1018035_381_674 | 94 |
| 262 | 3300037466 | Ga0395898_0344894 | Ga0395898_0344894_701_994 | 94 |
| 263 | 3300037471 | Ga0395905_0407089 | Ga0395905_0407089_38_331 | 94 |
| 264 | 3300037471 | Ga0395905_1111569 | Ga0395905_1111569_54_344 | 94 |
| 265 | 3300038443 | Ga0395901_0096908 | Ga0395901_0096908_443_736 | 94 |
| 266 | 3300038443 | Ga0395901_0098480 | Ga0395901_0098480_2638_2925 | 94 |
| 267 | 3300038443 | Ga0395901_2123459 | Ga0395901_2123459_106_399 | 94 |
| 268 | 3300044658 | Ga0466972_0331501 | Ga0466972_0331501_152_445 | 94 |
| 269 | 3300044901 | Ga0466960_0138599 | Ga0466960_0138599_691_984 | 94 |
| 270 | 3300045976 | Ga0466967_1321999 | Ga0466967_1321999_60_356 | 94 |
| 271 | 3300046616 | Ga0495668_0014796 | Ga0495668_0014796_2794_3087 | 94 |
| 272 | 3300046660 | Ga0495625_0532237 | Ga0495625_0532237_209_502 | 94 |
| 273 | 3300046684 | Ga0495669_0190761 | Ga0495669_0190761_329_622 | 94 |
| 274 | 3300048915 | Ga0496112_0699598 | Ga0496112_0699598_558_851 | 94 |
| 275 | 3300050493 | nmdc:mga0k408_108826_c1 | nmdc:mga0k408_108826_c1_171_491 | 94 |
| 276 | 3300050512 | nmdc:mga0n895_953045_c1 | nmdc:mga0n895_953045_c1_396_689 | 94 |
| 277 | 3300050513 | nmdc:mga0rr50_191958_c1 | nmdc:mga0rr50_191958_c1_756_1049 | 94 |
| 278 | 3300050515 | nmdc:mga0a205_62268_c1 | nmdc:mga0a205_62268_c1_720_1013 | 94 |
| 279 | 3300053134 | Ga0500658_0000315 | Ga0500658_0000315_693_986 | 94 |
| 280 | 3300001979 | JGI24740J21852_10011600 | JGI24740J21852_100116003 | 95 |
| 281 | 3300005327 | Ga0070658_10508086 | Ga0070658_105080862 | 95 |
| 282 | 3300005327 | Ga0070658_11495521 | Ga0070658_114955211 | 95 |
| 283 | 3300005329 | Ga0070683_100018611 | Ga0070683_1000186113 | 95 |
| 284 | 3300005335 | Ga0070666_10017491 | Ga0070666_100174912 | 95 |
| 285 | 3300005336 | Ga0070680_100072921 | Ga0070680_1000729213 | 95 |
| 286 | 3300005339 | Ga0070660_100114145 | Ga0070660_1001141452 | 95 |
| 287 | 3300005344 | Ga0070661_100339669 | Ga0070661_1003396692 | 95 |
| 288 | 3300005345 | Ga0070692_10012343 | Ga0070692_100123433 | 95 |
| 289 | 3300005353 | Ga0070669_101340051 | Ga0070669_1013400512 | 95 |
| 290 | 3300005355 | Ga0070671_100268886 | Ga0070671_1002688863 | 95 |
| 291 | 3300005455 | Ga0070663_100019157 | Ga0070663_1000191573 | 95 |
| 292 | 3300005458 | Ga0070681_10146459 | Ga0070681_101464591 | 95 |
| 293 | 3300005535 | Ga0070684_100059231 | Ga0070684_1000592312 | 95 |
| 294 | 3300005563 | Ga0068855_100022702 | Ga0068855_1000227028 | 95 |
| 295 | 3300005564 | Ga0070664_100422771 | Ga0070664_1004227712 | 95 |
| 296 | 3300005578 | Ga0068854_100412182 | Ga0068854_1004121822 | 95 |
| 297 | 3300005614 | Ga0068856_100119331 | Ga0068856_1001193313 | 95 |
| 298 | 3300005842 | Ga0068858_100776847 | Ga0068858_1007768472 | 95 |
| 299 | 3300011119 | Ga0105246_11742363 | Ga0105246_117423632 | 95 |
| 300 | 3300013104 | Ga0157370_10118179 | Ga0157370_101181793 | 95 |
| 301 | 3300013296 | Ga0157374_10166778 | Ga0157374_101667783 | 95 |
| 302 | 3300025909 | Ga0207705_10020451 | Ga0207705_100204512 | 95 |
| 303 | 3300025912 | Ga0207707_10088280 | Ga0207707_100882803 | 95 |
| 304 | 3300025917 | Ga0207660_10041667 | Ga0207660_100416673 | 95 |
| 305 | 3300025919 | Ga0207657_10001484 | Ga0207657_100014843 | 95 |
| 306 | 3300025921 | Ga0207652_10031608 | Ga0207652_100316083 | 95 |
| 307 | 3300025923 | Ga0207681_11048049 | Ga0207681_110480491 | 95 |
| 308 | 3300025931 | Ga0207644_10024533 | Ga0207644_100245332 | 95 |
| 309 | 3300025931 | Ga0207644_10767601 | Ga0207644_107676012 | 95 |
| 310 | 3300025945 | Ga0207679_10736295 | Ga0207679_107362952 | 95 |
| 311 | 3300025949 | Ga0207667_10075694 | Ga0207667_100756943 | 95 |
| 312 | 3300025981 | Ga0207640_10143266 | Ga0207640_101432662 | 95 |
| 313 | 3300026023 | Ga0207677_10079165 | Ga0207677_100791652 | 95 |
| 314 | 3300026067 | Ga0207678_10000938 | Ga0207678_1000093825 | 95 |
| 315 | 3300026078 | Ga0207702_10027882 | Ga0207702_100278824 | 95 |
| 316 | 3300026142 | Ga0207698_12074535 | Ga0207698_120745352 | 95 |
| 317 | 3300028381 | Ga0268264_10979718 | Ga0268264_109797182 | 95 |
| 318 | 3300035691 | Ga0373931_0629488 | Ga0373931_0629488_364_651 | 95 |
| 319 | 3300037312 | Ga0395899_0066274 | Ga0395899_0066274_1560_1880 | 95 |
| 320 | 3300037312 | Ga0395899_0092848 | Ga0395899_0092848_1340_1672 | 95 |
| 321 | 3300037312 | Ga0395899_0217655 | Ga0395899_0217655_403_720 | 95 |
| 322 | 3300037418 | Ga0395900_0001365 | Ga0395900_0001365_2481_2813 | 95 |
| 323 | 3300037418 | Ga0395900_0025498 | Ga0395900_0025498_1106_1426 | 95 |
| 324 | 3300037418 | Ga0395900_0039946 | Ga0395900_0039946_2710_3030 | 95 |
| 325 | 3300037418 | Ga0395900_0109536 | Ga0395900_0109536_505_825 | 95 |
| 326 | 3300037418 | Ga0395900_0310698 | Ga0395900_0310698_829_1149 | 95 |
| 327 | 3300037418 | Ga0395900_0442018 | Ga0395900_0442018_642_962 | 95 |
| 328 | 3300037418 | Ga0395900_0478960 | Ga0395900_0478960_587_907 | 95 |
| 329 | 3300037418 | Ga0395900_0694472 | Ga0395900_0694472_163_483 | 95 |
| 330 | 3300037466 | Ga0395898_0004373 | Ga0395898_0004373_14483_14770 | 95 |
| 331 | 3300037466 | Ga0395898_0017607 | Ga0395898_0017607_3156_3476 | 95 |
| 332 | 3300037466 | Ga0395898_0043518 | Ga0395898_0043518_1067_1399 | 95 |
| 333 | 3300037466 | Ga0395898_0053393 | Ga0395898_0053393_3267_3587 | 95 |
| 334 | 3300037466 | Ga0395898_0379931 | Ga0395898_0379931_996_1316 | 95 |
| 335 | 3300037466 | Ga0395898_1330552 | Ga0395898_1330552_229_549 | 95 |
| 336 | 3300037466 | Ga0395898_1386153 | Ga0395898_1386153_133_453 | 95 |
| 337 | 3300037471 | Ga0395905_0001405 | Ga0395905_0001405_8252_8584 | 95 |
| 338 | 3300037471 | Ga0395905_0002442 | Ga0395905_0002442_5991_6311 | 95 |
| 339 | 3300037471 | Ga0395905_0002664 | Ga0395905_0002664_22_342 | 95 |
| 340 | 3300037471 | Ga0395905_0006674 | Ga0395905_0006674_6176_6496 | 95 |
| 341 | 3300037471 | Ga0395905_0009990 | Ga0395905_0009990_1660_1986 | 95 |
| 342 | 3300037471 | Ga0395905_0010084 | Ga0395905_0010084_4047_4364 | 95 |
| 343 | 3300037471 | Ga0395905_0023120 | Ga0395905_0023120_5131_5451 | 95 |
| 344 | 3300037471 | Ga0395905_0142166 | Ga0395905_0142166_768_1088 | 95 |
| 345 | 3300037471 | Ga0395905_0168698 | Ga0395905_0168698_1676_1993 | 95 |
| 346 | 3300037471 | Ga0395905_1181766 | Ga0395905_1181766_142_462 | 95 |
| 347 | 3300037471 | Ga0395905_1775330 | Ga0395905_1775330_99_419 | 95 |
| 348 | 3300037471 | Ga0395905_1775775 | Ga0395905_1775775_149_469 | 95 |
| 349 | 3300038443 | Ga0395901_0005264 | Ga0395901_0005264_7248_7580 | 95 |
| 350 | 3300038443 | Ga0395901_0012250 | Ga0395901_0012250_4333_4650 | 95 |
| 351 | 3300038443 | Ga0395901_0029181 | Ga0395901_0029181_1192_1512 | 95 |
| 352 | 3300038443 | Ga0395901_0033245 | Ga0395901_0033245_1952_2272 | 95 |
| 353 | 3300038443 | Ga0395901_0034269 | Ga0395901_0034269_4683_5003 | 95 |
| 354 | 3300038443 | Ga0395901_0060837 | Ga0395901_0060837_2032_2352 | 95 |
| 355 | 3300038443 | Ga0395901_0277514 | Ga0395901_0277514_232_552 | 95 |
| 356 | 3300038443 | Ga0395901_0690107 | Ga0395901_0690107_213_533 | 95 |
| 357 | 3300038443 | Ga0395901_0775275 | Ga0395901_0775275_30_347 | 95 |
| 358 | 3300042012 | Ga0439455_0141462 | Ga0439455_0141462_175_495 | 95 |
| 359 | 3300042157 | Ga0439458_0001899 | Ga0439458_0001899_2502_2822 | 95 |
| 360 | 3300042157 | Ga0439458_0004254 | Ga0439458_0004254_1089_1409 | 95 |
| 361 | 3300044842 | Ga0466957_0124029 | Ga0466957_0124029_279_581 | 95 |
| 362 | 3300044842 | Ga0466957_0262137 | Ga0466957_0262137_305_610 | 95 |
| 363 | 3300045836 | Ga0466958_0108496 | Ga0466958_0108496_1142_1447 | 95 |
| 364 | 3300048904 | Ga0496101_0137792 | Ga0496101_0137792_1065_1352 | 95 |
| 365 | 3300048918 | Ga0496115_0048046 | Ga0496115_0048046_1576_1863 | 95 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ulj-assembly3.cif.gz_C | crystal structure of scheffersomyces stipitis rai1 in complex with (3'-nadp)+ and calcium ion | 0.9078 | 78 | 93 |
| 8ezi-assembly1.cif.gz_B | a tethered niacin-derived pincer complex with a nickel-carbon bond in lactate racemase r98a/r100a variant modeled with separated sulfite and npn | 0.8658 | 78 | 92 |
| 6d6z-assembly1.cif.gz_A | structure of the malate racemase apoprotein from thermoanaerobacterium thermosaccharolyticum | 0.8266 | 78 | 92 |
| 7s91-assembly1.cif.gz_A | structure of the malate racemase mar2 apoprotein from thermoanaerobacterium thermosaccharolyticum at 2.25 angstroms resolution | 0.8101 | 78 | 92 |
| 1vbw-assembly1.cif.gz_A | crystal structure of bitter gourd trypsin inhibitor | 0.7836 | 38 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0VE32_15_87_3.30.10.10 | Alpha Beta;2-Layer Sandwich;Trypsin Inhibitor V; Chain A;Trypsin Inhibitor V, subunit A | 0.8026 | 38 | 95 | 3.30.10.10 |
| af_C6Y4A9_11_76_3.30.10.10 | Alpha Beta;2-Layer Sandwich;Trypsin Inhibitor V; Chain A;Trypsin Inhibitor V, subunit A | 0.797 | 58 | 93 | 3.30.10.10 |
| af_Q53PR9_2_67_3.30.10.10 | Alpha Beta;2-Layer Sandwich;Trypsin Inhibitor V; Chain A;Trypsin Inhibitor V, subunit A | 0.7912 | 37 | 95 | 3.30.10.10 |
| af_Q9STF8_18_85_3.30.10.10 | Alpha Beta;2-Layer Sandwich;Trypsin Inhibitor V; Chain A;Trypsin Inhibitor V, subunit A | 0.7888 | 38 | 95 | 3.30.10.10 |
| af_A0A1P8B9R8_9_84_3.30.10.10 | Alpha Beta;2-Layer Sandwich;Trypsin Inhibitor V; Chain A;Trypsin Inhibitor V, subunit A | 0.7883 | 37 | 92 | 3.30.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350KXC5-F1-model_v4 | deleted | 0.9474 | 28 | 95 |
|
| AF-W1L063-F1-model_v4 | deleted | 0.9458 | 28 | 95 |
|
| AF-A0A5C6U955-F1-model_v4 | Peptidase inhibitor I78 | 0.9386 | 22 | 95 |
|
| AF-A0A291A7A7-F1-model_v4 | deleted | 0.9348 | 38 | 95 |
|
| AF-A0A2N1Y521-F1-model_v4 | Peptidase inhibitor I78 family protein | 0.9342 | 30 | 95 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar