F423588

General Info

Members Datasets Scaffolds Average Seq Length
365 208 365 252

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100378538|Ga0070711_1003785382
Length 279
Sequence MRIATWNVNGIRARQAELQAWIERAQPDVVCLQEIKASTDQLPVWLCEIEGYWCYWHGVKGYSGVALHVSRHVSPERPVLEHPSFDYENRIVLTRLPTVSVVSVYVPNGGKDFPAKVRFLDSLEQFVAEAHAESRALVICGDLNIARTDMDVHPKERKPRAIGQLPEERAQLERIISHGLVDVSRALEPDNDQMFTWWAPWRNMRQRNIGWRLDYLLASQPIFDRVVSCRIERETGTSDHAPVIGEFNIESLIPESAGVDDATDSGIQGFRDQRFGIRD

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
131 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
134 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
157 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
193 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
194 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.3
Nodule 0
Rhizoplane 4.11
Rhizosphere 89.32
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10003395 3300005293 Bacteria 5376
2 Ga0065707_10107654 3300005295 Bacteria 2545
3 Ga0070658_10034621 3300005327 Bacteria 4064
4 Ga0070676_10155644 3300005328 Unclassified 1467
5 Ga0070676_10160145 3300005328 Bacteria 1448
6 Ga0070680_100172821 3300005336 Bacteria 1819
7 Ga0070680_100247542 3300005336 Bacteria 1507
8 Ga0070661_100212346 3300005344 Bacteria 1482
9 Ga0070668_100014229 3300005347 Bacteria 5944
10 Ga0070668_100597722 3300005347 Bacteria 965
11 Ga0070669_100004518 3300005353 Bacteria 10038
12 Ga0070669_100089020 3300005353 Bacteria 2311
13 Ga0070669_100182413 3300005353 Bacteria 1643
14 Ga0070675_100029810 3300005354 Unclassified 4402
15 Ga0070671_100028481 3300005355 Bacteria 4600
16 Ga0070671_100337548 3300005355 Bacteria 1285
17 Ga0070674_100020798 3300005356 Bacteria 4202
18 Ga0070674_100377133 3300005356 Bacteria 1153
19 Ga0070673_100321898 3300005364 Unclassified 1366
20 Ga0070673_100342031 3300005364 Unclassified 1326
21 Ga0070688_100092378 3300005365 Bacteria 1980
22 Ga0070659_100196559 3300005366 Bacteria 1659
23 Ga0070713_100005216 3300005436 Bacteria 8854
24 Ga0070711_100378538 3300005439 Bacteria 1144
25 Ga0070705_100217033 3300005440 Bacteria 1322
26 Ga0070694_100171932 3300005444 Unclassified 1597
27 Ga0070708_100170636 3300005445 Bacteria 2031
28 Ga0070678_100242159 3300005456 Bacteria 1508
29 Ga0070662_100278141 3300005457 Bacteria 1354
30 Ga0070662_100367323 3300005457 Bacteria 1182
31 Ga0070681_10027758 3300005458 Bacteria 5691
32 Ga0070681_10120030 3300005458 Bacteria 2564
33 Ga0070681_10317230 3300005458 Bacteria 1468
34 Ga0068867_100047230 3300005459 Bacteria 3164
35 Ga0068867_100422840 3300005459 Unclassified 1129
36 Ga0070707_100021893 3300005468 Bacteria 6043
37 Ga0070707_100101533 3300005468 Bacteria 2788
38 Ga0070698_100015563 3300005471 Bacteria 8033
39 Ga0070699_100009472 3300005518 Bacteria 8436
40 Ga0070699_100010728 3300005518 Bacteria 7927
41 Ga0070699_100055239 3300005518 Bacteria 3439
42 Ga0070679_100237482 3300005530 Bacteria 1781
43 Ga0070679_100358159 3300005530 Bacteria 1406
44 Ga0070697_100425811 3300005536 Bacteria 1154
45 Ga0068853_100000583 3300005539 Bacteria 24976
46 Ga0070672_100039988 3300005543 Bacteria 3595
47 Ga0070686_100060608 3300005544 Bacteria 2442
48 Ga0070686_100157351 3300005544 Unclassified 1597
49 Ga0070695_100251338 3300005545 Bacteria 1287
50 Ga0070696_100088947 3300005546 Bacteria 2196
51 Ga0070665_100273787 3300005548 Bacteria 1690
52 Ga0070665_100362907 3300005548 Bacteria 1455
53 Ga0070665_100393072 3300005548 Bacteria 1394
54 Ga0068855_100068659 3300005563 Bacteria 4126
55 Ga0070664_100377069 3300005564 Unclassified 1294
56 Ga0068857_100246994 3300005577 Unclassified 1635
57 Ga0068861_100136979 3300005719 Bacteria 1993
58 Ga0068861_100298033 3300005719 Bacteria 1395
59 Ga0068861_100619408 3300005719 Bacteria 996
60 Ga0068863_100000908 3300005841 Bacteria 29779
61 Ga0068858_100109123 3300005842 Bacteria 2583
62 Ga0068860_100029435 3300005843 Bacteria 5282
63 Ga0068860_100289940 3300005843 Unclassified 1601
64 Ga0068862_100007004 3300005844 Bacteria 9360
65 Ga0070717_10028641 3300006028 Bacteria 4460
66 Ga0075365_10105868 3300006038 Unclassified 1929
67 Ga0075368_10001004 3300006042 Bacteria 8821
68 Ga0075368_10069161 3300006042 Bacteria 1424
69 Ga0075363_100191982 3300006048 Bacteria 1165
70 Ga0075364_10016029 3300006051 Bacteria 4655
71 Ga0075362_10004497 3300006177 Bacteria 5021
72 Ga0075367_10004748 3300006178 Bacteria 6683
73 Ga0075367_10005019 3300006178 Bacteria 6525
74 Ga0075367_10037141 3300006178 Bacteria 2829
75 Ga0075366_10015959 3300006195 Bacteria 4312
76 Ga0075366_10029724 3300006195 Bacteria 3211
77 Ga0075366_10161751 3300006195 Bacteria 1357
78 Ga0097621_100089576 3300006237 Bacteria 2573
79 Ga0075370_10021945 3300006353 Unclassified 3501
80 Ga0068871_100149793 3300006358 Bacteria 1989
81 Ga0068871_100313384 3300006358 Bacteria 1380
82 Ga0075428_100008153 3300006844 Bacteria 11628
83 Ga0075428_100655232 3300006844 Bacteria 1120
84 Ga0075431_100027113 3300006847 Bacteria 5876
85 Ga0075431_100302958 3300006847 Bacteria 1614
86 Ga0075433_10009143 3300006852 Bacteria 7912
87 Ga0075433_10021190 3300006852 Bacteria 5448
88 Ga0075433_10036400 3300006852 Bacteria 4240
89 Ga0075433_10354501 3300006852 Bacteria 1296
90 Ga0075434_100003602 3300006871 Bacteria 13834
91 Ga0075434_100024008 3300006871 Bacteria 5954
92 Ga0075434_100325957 3300006871 Bacteria 1556
93 Ga0075429_100024694 3300006880 Bacteria 5216
94 Ga0075436_100044474 3300006914 Bacteria 3062
95 Ga0075436_100290222 3300006914 Bacteria 1171
96 Ga0075435_100036341 3300007076 Unclassified 3914
97 Ga0075435_100066079 3300007076 Bacteria 2941
98 Ga0075435_100098504 3300007076 Bacteria 2420
99 Ga0105240_10000338 3300009093 Bacteria 87700
100 Ga0111539_10001537 3300009094 Bacteria 30729
101 Ga0111539_10021468 3300009094 Bacteria 7945
102 Ga0111539_10026081 3300009094 Bacteria 7154
103 Ga0111539_10375006 3300009094 Bacteria 1656
104 Ga0111539_11223081 3300009094 Unclassified 872
105 Ga0105245_10078871 3300009098 Bacteria 3006
106 Ga0105245_10377077 3300009098 Bacteria 1412
107 Ga0105247_10035444 3300009101 Bacteria 3041
108 Ga0105247_10327490 3300009101 Unclassified 1071
109 Ga0114129_10000589 3300009147 Bacteria 44910
110 Ga0114129_10031053 3300009147 Bacteria 7556
111 Ga0114129_10045191 3300009147 Bacteria 6191
112 Ga0114129_10064667 3300009147 Bacteria 5105
113 Ga0114129_10352158 3300009147 Bacteria 1950
114 Ga0114129_10509852 3300009147 Bacteria 1570
115 Ga0114129_10986054 3300009147 Bacteria 1062
116 Ga0105243_10015486 3300009148 Bacteria 5764
117 Ga0105242_10119425 3300009176 Bacteria 2260
118 Ga0105242_10616487 3300009176 Bacteria 1050
119 Ga0105248_10001067 3300009177 Bacteria 30324
120 Ga0105248_10006358 3300009177 Bacteria 12957
121 Ga0105248_10026099 3300009177 Bacteria 6500
122 Ga0105248_10059524 3300009177 Bacteria 4291
123 Ga0105248_10227349 3300009177 Bacteria 2100
124 Ga0105248_10305506 3300009177 Bacteria 1792
125 Ga0105237_10000081 3300009545 Bacteria 127733
126 Ga0105238_10017408 3300009551 Bacteria 7302
127 Ga0105238_10041368 3300009551 Unclassified 4667
128 Ga0105249_10003036 3300009553 Bacteria 14480
129 Ga0105249_10691074 3300009553 Bacteria 1080
130 Ga0157370_10190550 3300013104 Bacteria 1903
131 Ga0157369_10200602 3300013105 Bacteria 2094
132 Ga0157369_10681035 3300013105 Bacteria 1059
133 Ga0157378_10932799 3300013297 Bacteria 900
134 Ga0163162_10264878 3300013306 Bacteria 1850
135 Ga0157377_10009393 3300014745 Unclassified 4797
136 Ga0157377_10054930 3300014745 Bacteria 2256
137 Ga0157379_10006294 3300014968 Bacteria 10222
138 Ga0157376_10128168 3300014969 Bacteria 2260
139 Ga0157376_10278164 3300014969 Bacteria 1575
140 Ga0163161_10133302 3300017792 Bacteria 1876
141 Ga0207666_1005193 3300025271 Unclassified 1657
142 Ga0207710_10015427 3300025900 Bacteria 3228
143 Ga0207710_10168240 3300025900 Bacteria 1071
144 Ga0207699_10190747 3300025906 Bacteria 1383
145 Ga0207705_10260631 3300025909 Bacteria 1324
146 Ga0207684_10024247 3300025910 Bacteria 5174
147 Ga0207684_10038361 3300025910 Bacteria 4064
148 Ga0207707_10341692 3300025912 Bacteria 1291
149 Ga0207707_10516903 3300025912 Bacteria 1017
150 Ga0207695_10037697 3300025913 Bacteria 5214
151 Ga0207695_10413196 3300025913 Bacteria 1234
152 Ga0207671_10000077 3300025914 Bacteria 150801
153 Ga0207660_10108191 3300025917 Bacteria 2088
154 Ga0207652_10014973 3300025921 Bacteria 6291
155 Ga0207652_10093116 3300025921 Bacteria 2651
156 Ga0207652_10316627 3300025921 Bacteria 1408
157 Ga0207646_10023048 3300025922 Bacteria 5724
158 Ga0207646_10128109 3300025922 Bacteria 2283
159 Ga0207646_10250222 3300025922 Bacteria 1601
160 Ga0207681_10003694 3300025923 Bacteria 9507
161 Ga0207681_10160085 3300025923 Unclassified 1696
162 Ga0207694_10045258 3300025924 Bacteria 3399
163 Ga0207694_10051477 3300025924 Bacteria 3192
164 Ga0207659_10000180 3300025926 Bacteria 37729
165 Ga0207659_10095771 3300025926 Bacteria 2227
166 Ga0207700_10003346 3300025928 Bacteria 9298
167 Ga0207644_10025925 3300025931 Bacteria 4035
168 Ga0207644_10131275 3300025931 Bacteria 1918
169 Ga0207690_10148437 3300025932 Bacteria 1736
170 Ga0207706_10257631 3300025933 Bacteria 1523
171 Ga0207706_10355644 3300025933 Bacteria 1273
172 Ga0207706_10361009 3300025933 Bacteria 1262
173 Ga0207686_10123295 3300025934 Bacteria 1767
174 Ga0207686_10141349 3300025934 Bacteria 1664
175 Ga0207669_10027926 3300025937 Unclassified 3097
176 Ga0207669_10285817 3300025937 Bacteria 1246
177 Ga0207704_10488454 3300025938 Bacteria 990
178 Ga0207691_10016729 3300025940 Bacteria 6962
179 Ga0207691_10435474 3300025940 Bacteria 1116
180 Ga0207711_10031239 3300025941 Bacteria 4495
181 Ga0207711_10080080 3300025941 Bacteria 2852
182 Ga0207679_10245558 3300025945 Unclassified 1519
183 Ga0207679_10316526 3300025945 Unclassified 1350
184 Ga0207667_10369164 3300025949 Unclassified 1463
185 Ga0207667_10448626 3300025949 Bacteria 1311
186 Ga0207667_10450864 3300025949 Bacteria 1307
187 Ga0207651_10106908 3300025960 Bacteria 2090
188 Ga0207712_10115637 3300025961 Bacteria 2020
189 Ga0207712_10149907 3300025961 Bacteria 1800
190 Ga0207712_10529332 3300025961 Bacteria 1011
191 Ga0207712_10700237 3300025961 Bacteria 884
192 Ga0207668_10558668 3300025972 Unclassified 992
193 Ga0207677_10184512 3300026023 Bacteria 1644
194 Ga0207703_10143342 3300026035 Bacteria 2076
195 Ga0207639_10004111 3300026041 Bacteria 9810
196 Ga0207708_10143034 3300026075 Bacteria 1878
197 Ga0207702_10437229 3300026078 Bacteria 1267
198 Ga0207702_10537187 3300026078 Bacteria 1142
199 Ga0207641_10003798 3300026088 Bacteria 13248
200 Ga0207648_10066459 3300026089 Bacteria 3145
201 Ga0207676_10026308 3300026095 Bacteria 4327
202 Ga0207674_10042610 3300026116 Bacteria 4687
203 Ga0207674_10365481 3300026116 Bacteria 1395
204 Ga0207675_100075181 3300026118 Bacteria 3162
205 Ga0207675_100176265 3300026118 Bacteria 2045
206 Ga0207675_100352666 3300026118 Bacteria 1442
207 Ga0207675_100359926 3300026118 Bacteria 1427
208 Ga0207698_10415775 3300026142 Bacteria 1289
209 Ga0207428_10009636 3300027907 Bacteria 8648
210 Ga0207428_10034873 3300027907 Bacteria 4118
211 Ga0268266_10005087 3300028379 Bacteria 12398
212 Ga0268266_10340438 3300028379 Bacteria 1408
213 Ga0268265_10477094 3300028380 Bacteria 1170
214 Ga0268264_10264574 3300028381 Unclassified 1604
215 Ga0268264_10576358 3300028381 Bacteria 1106
216 Ga0265334_10010690 3300028573 Bacteria 3874
217 Ga0265318_10000269 3300028577 Bacteria 44073
218 Ga0265318_10000304 3300028577 Bacteria 39457
219 Ga0265318_10010582 3300028577 Bacteria 4009
220 Ga0265323_10002806 3300028653 Bacteria 7841
221 Ga0265338_10000944 3300028800 Bacteria 48921
222 Ga0265338_10007665 3300028800 Bacteria 13309
223 Ga0265338_10027794 3300028800 Bacteria 5663
224 Ga0265338_10112201 3300028800 Bacteria 2193
225 Ga0265324_10000025 3300029957 Bacteria 161982
226 Ga0265330_10000002 3300031235 Bacteria 481237
227 Ga0265330_10003096 3300031235 Bacteria 8800
228 Ga0265330_10007175 3300031235 Bacteria 5458
229 Ga0265332_10000838 3300031238 Bacteria 18690
230 Ga0265332_10002344 3300031238 Bacteria 9664
231 Ga0265328_10000888 3300031239 Bacteria 13828
232 Ga0265328_10008351 3300031239 Bacteria 4276
233 Ga0265328_10021549 3300031239 Bacteria 2457
234 Ga0265320_10000052 3300031240 Bacteria 113701
235 Ga0265320_10002676 3300031240 Bacteria 12326
236 Ga0265320_10003908 3300031240 Bacteria 9855
237 Ga0265325_10016442 3300031241 Bacteria 4136
238 Ga0265325_10114291 3300031241 Bacteria 1308
239 Ga0265329_10000262 3300031242 Bacteria 27686
240 Ga0265329_10001921 3300031242 Bacteria 9792
241 Ga0265329_10090511 3300031242 Unclassified 971
242 Ga0265340_10003455 3300031247 Bacteria 8910
243 Ga0265339_10000014 3300031249 Bacteria 187463
244 Ga0265339_10002013 3300031249 Bacteria 14936
245 Ga0265339_10006635 3300031249 Bacteria 7570
246 Ga0265331_10000001 3300031250 Bacteria 798836
247 Ga0265331_10002505 3300031250 Bacteria 12394
248 Ga0265331_10009081 3300031250 Bacteria 5612
249 Ga0265316_10008063 3300031344 Bacteria 9826
250 Ga0265316_10009664 3300031344 Bacteria 8859
251 Ga0265316_10026584 3300031344 Bacteria 4810
252 Ga0307408_100181737 3300031548 Bacteria 1687
253 Ga0265313_10000134 3300031595 Bacteria 75861
254 Ga0265313_10006921 3300031595 Bacteria 7878
255 Ga0265313_10051969 3300031595 Unclassified 1958
256 Ga0265313_10070218 3300031595 Archaea 1614
257 Ga0265314_10000038 3300031711 Bacteria 224533
258 Ga0265314_10001496 3300031711 Bacteria 25911
259 Ga0265314_10004232 3300031711 Bacteria 13453
260 Ga0265314_10007510 3300031711 Bacteria 9448
261 Ga0265342_10000767 3300031712 Bacteria 32719
262 Ga0265342_10000829 3300031712 Bacteria 30983
263 Ga0265342_10001976 3300031712 Bacteria 18300
264 Ga0265342_10013348 3300031712 Bacteria 5518
265 Ga0307405_10188527 3300031731 Bacteria 1487
266 Ga0307413_10366874 3300031824 Bacteria 1117
267 Ga0307409_100035951 3300031995 Unclassified 3635
268 Ga0307409_100363834 3300031995 Unclassified 1369
269 Ga0307416_100880277 3300032002 Bacteria 995
270 Ga0307411_10310854 3300032005 Bacteria 1268
271 Ga0373928_0033613 3300035084 Bacteria 1147
272 Ga0373941_0110822 3300035115 Bacteria 967
273 Ga0373954_0238695 3300035118 Bacteria 895
274 Ga0373946_0024859 3300035171 Bacteria 2352
275 Ga0373935_0350370 3300035692 Unclassified 1052
276 Ga0373933_0025350 3300035724 Bacteria 3400
277 Ga0373937_0250148 3300036401 Unclassified 1671
278 Ga0373937_0620871 3300036401 Unclassified 1026
279 Ga0373937_0665444 3300036401 Unclassified 987
280 Ga0373937_1146283 3300036401 Bacteria 726
281 Ga0395905_0169504 3300037471 Bacteria 2051
282 Ga0436365_0884346 3300039437 Bacteria 3332
283 Ga0451802_0488582 3300041460 Bacteria 1013
284 Ga0439435_0033974 3300042436 Bacteria 1400
285 Ga0451577_0008553 3300042876 Bacteria 9953
286 Ga0453684_0042326 3300044712 Bacteria 6142
287 Ga0453684_0317944 3300044712 Bacteria 1764
288 Ga0453684_0331375 3300044712 Bacteria 1721
289 Ga0466967_0216841 3300045976 Bacteria 1817
290 Ga0495592_0250776 3300046454 Bacteria 1170
291 Ga0495629_0211526 3300046459 Bacteria 1339
292 Ga0495629_0336339 3300046459 Unclassified 1031
293 Ga0495582_0109557 3300046473 Bacteria 1551
294 Ga0495608_0299535 3300046511 Bacteria 996
295 Ga0495640_0048075 3300046533 Bacteria 2950
296 Ga0495640_0265376 3300046533 Bacteria 1072
297 Ga0495645_0007806 3300046543 Bacteria 7444
298 Ga0495633_0223449 3300046558 Bacteria 862
299 Ga0495667_0237698 3300046559 Bacteria 1161
300 Ga0495635_0048708 3300046663 Bacteria 2921
301 Ga0495635_0131539 3300046663 Unclassified 1706
302 Ga0495635_0135803 3300046663 Bacteria 1676
303 Ga0495647_0050435 3300046681 Bacteria 1615
304 Ga0495647_0088721 3300046681 Unclassified 1265
305 Ga0495658_0116256 3300046683 Unclassified 1613
306 Ga0495658_0190810 3300046683 Bacteria 1274
307 Ga0495658_0238267 3300046683 Bacteria 1142
308 Ga0495669_0091506 3300046684 Bacteria 1405
309 Ga0495613_0413122 3300046689 Unclassified 919
310 Ga0495674_0192244 3300047319 Unclassified 1696
311 Ga0496100_0181560 3300048903 Unclassified 1522
312 Ga0496101_0483081 3300048904 Bacteria 978
313 Ga0496102_0024984 3300048905 Bacteria 5315
314 Ga0496102_0438030 3300048905 Bacteria 1227
315 Ga0496104_0062750 3300048907 Bacteria 3524
316 Ga0496105_0457318 3300048908 Bacteria 1007
317 Ga0496106_0035360 3300048909 Bacteria 3736
318 Ga0496108_0170753 3300048911 Bacteria 1881
319 Ga0496109_0836591 3300048912 Bacteria 858
320 Ga0496110_0070519 3300048913 Bacteria 3097
321 Ga0496112_0026323 3300048915 Bacteria 5594
322 Ga0496112_0079570 3300048915 Bacteria 3242
323 Ga0496113_0100645 3300048916 Bacteria 2239
324 Ga0496114_0330240 3300048917 Bacteria 1348
325 Ga0501046_0169803 3300049580 Bacteria 1638
326 Ga0501071_0062647 3300049587 Bacteria 2695
327 Ga0501073_0176044 3300049589 Bacteria 1481
328 Ga0501074_0250808 3300049590 Bacteria 1259
329 Ga0501080_0314460 3300049742 Unclassified 1419
330 Ga0501080_0371266 3300049742 Bacteria 1290
331 Ga0501263_000069 3300049760 Bacteria 5039
332 nmdc:mga03683_22322_c1 3300050489 Bacteria 2453
333 nmdc:mga03n38_81664_c1 3300050490 Bacteria 1520
334 nmdc:mga00v17_47102_c1 3300050491 Bacteria 2611
335 nmdc:mga0yw44_319294_c1 3300050492 Unclassified 1043
336 nmdc:mga0k408_5293_c1 3300050493 Bacteria 5347
337 nmdc:mga06z11_46839_c1 3300050494 Bacteria 2193
338 nmdc:mga06z11_7347_c1 3300050494 Bacteria 4527
339 nmdc:mga06z11_7456_c1 3300050494 Bacteria 4501
340 nmdc:mga07m45_6600_c1 3300050496 Bacteria 4266
341 nmdc:mga05p37_18494_c1 3300050507 Bacteria 8418
342 nmdc:mga05p37_254416_c1 3300050507 Bacteria 2105
343 nmdc:mga05p37_269954_c1 3300050507 Bacteria 2033
344 nmdc:mga05p37_52688_c1 3300050507 Bacteria 5003
345 nmdc:mga05p37_55238_c1 3300050507 Bacteria 4886
346 nmdc:mga05p37_91385_c1 3300050507 Bacteria 3751
347 nmdc:mga0qj67_159301_c1 3300050509 Unclassified 1832
348 nmdc:mga08y16_24879_c1 3300050511 Bacteria 6316
349 nmdc:mga08y16_25947_c1 3300050511 Bacteria 6182
350 nmdc:mga08y16_9641_c1 3300050511 Bacteria 10138
351 nmdc:mga0n895_14911_c1 3300050512 Bacteria 7077
352 nmdc:mga0n895_1957_c1 3300050512 Bacteria 15803
353 nmdc:mga0n895_41888_c1 3300050512 Unclassified 4453
354 nmdc:mga0rr50_110467_c1 3300050513 Bacteria 2175
355 nmdc:mga0rr50_185156_c1 3300050513 Bacteria 1704
356 nmdc:mga0rr50_36427_c1 3300050513 Unclassified 3543
357 nmdc:mga0a205_142491_c1 3300050515 Bacteria 2297
358 nmdc:mga0a205_145743_c1 3300050515 Unclassified 2268
359 nmdc:mga0a205_15936_c1 3300050515 Bacteria 7031
360 nmdc:mga0a205_19183_c1 3300050515 Bacteria 6444
361 nmdc:mga0a205_29335_c1 3300050515 Bacteria 5264
362 nmdc:mga0a205_50883_c1 3300050515 Unclassified 3999
363 Ga0495601_0125393 3300053077 Bacteria 1670
364 Ga0495619_0173717 3300053085 Bacteria 1490
365 Ga0500568_0001007 3300053139 Bacteria 19303

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100362907 Ga0070665_1003629071 200
2 3300009177 Ga0105248_10227349 Ga0105248_102273494 200
3 3300028379 Ga0268266_10005087 Ga0268266_1000508710 200
4 3300036401 Ga0373937_1146283 Ga0373937_1146283_95_709 200
5 3300046459 Ga0495629_0211526 Ga0495629_0211526_537_1151 200
6 3300046663 Ga0495635_0135803 Ga0495635_0135803_114_731 201
7 3300053085 Ga0495619_0173717 Ga0495619_0173717_330_947 201
8 3300005518 Ga0070699_100009472 Ga0070699_1000094722 205
9 3300006914 Ga0075436_100044474 Ga0075436_1000444743 205
10 3300005544 Ga0070686_100060608 Ga0070686_1000606083 238
11 3300005563 Ga0068855_100068659 Ga0068855_1000686594 239
12 3300005577 Ga0068857_100246994 Ga0068857_1002469942 239
13 3300005843 Ga0068860_100289940 Ga0068860_1002899402 239
14 3300009551 Ga0105238_10041368 Ga0105238_100413683 239
15 3300025924 Ga0207694_10051477 Ga0207694_100514773 239
16 3300025949 Ga0207667_10369164 Ga0207667_103691642 239
17 3300026116 Ga0207674_10365481 Ga0207674_103654811 239
18 3300028381 Ga0268264_10264574 Ga0268264_102645742 239
19 3300005457 Ga0070662_100278141 Ga0070662_1002781412 242
20 3300025933 Ga0207706_10361009 Ga0207706_103610092 242
21 3300049742 Ga0501080_0314460 Ga0501080_0314460_516_1268 242
22 3300026078 Ga0207702_10437229 Ga0207702_104372292 244
23 3300005440 Ga0070705_100217033 Ga0070705_1002170332 246
24 3300005518 Ga0070699_100010728 Ga0070699_1000107285 246
25 3300025910 Ga0207684_10024247 Ga0207684_100242473 246
26 3300025910 Ga0207684_10038361 Ga0207684_100383612 246
27 3300025922 Ga0207646_10128109 Ga0207646_101281092 246
28 3300005328 Ga0070676_10155644 Ga0070676_101556442 247
29 3300005458 Ga0070681_10027758 Ga0070681_100277583 247
30 3300005548 Ga0070665_100393072 Ga0070665_1003930722 247
31 3300013297 Ga0157378_10932799 Ga0157378_109327991 247
32 3300049760 Ga0501263_000069 Ga0501263_000069_1655_2404 247
33 3300005353 Ga0070669_100182413 Ga0070669_1001824132 248
34 3300005355 Ga0070671_100337548 Ga0070671_1003375482 248
35 3300005356 Ga0070674_100377133 Ga0070674_1003771332 248
36 3300005436 Ga0070713_100005216 Ga0070713_1000052167 248
37 3300005445 Ga0070708_100170636 Ga0070708_1001706362 248
38 3300005456 Ga0070678_100242159 Ga0070678_1002421591 248
39 3300005459 Ga0068867_100422840 Ga0068867_1004228401 248
40 3300005468 Ga0070707_100021893 Ga0070707_1000218934 248
41 3300005468 Ga0070707_100101533 Ga0070707_1001015333 248
42 3300005471 Ga0070698_100015563 Ga0070698_1000155635 248
43 3300005544 Ga0070686_100157351 Ga0070686_1001573512 248
44 3300005546 Ga0070696_100088947 Ga0070696_1000889471 248
45 3300005548 Ga0070665_100273787 Ga0070665_1002737872 248
46 3300005719 Ga0068861_100136979 Ga0068861_1001369792 248
47 3300005841 Ga0068863_100000908 Ga0068863_1000009089 248
48 3300006028 Ga0070717_10028641 Ga0070717_100286414 248
49 3300006237 Ga0097621_100089576 Ga0097621_1000895762 248
50 3300006358 Ga0068871_100149793 Ga0068871_1001497931 248
51 3300006844 Ga0075428_100655232 Ga0075428_1006552321 248
52 3300006852 Ga0075433_10036400 Ga0075433_100364002 248
53 3300006852 Ga0075433_10354501 Ga0075433_103545011 248
54 3300006871 Ga0075434_100003602 Ga0075434_10000360213 248
55 3300006871 Ga0075434_100325957 Ga0075434_1003259571 248
56 3300007076 Ga0075435_100066079 Ga0075435_1000660791 248
57 3300007076 Ga0075435_100098504 Ga0075435_1000985042 248
58 3300009094 Ga0111539_10375006 Ga0111539_103750062 248
59 3300009098 Ga0105245_10377077 Ga0105245_103770772 248
60 3300009101 Ga0105247_10327490 Ga0105247_103274902 248
61 3300009147 Ga0114129_10045191 Ga0114129_100451917 248
62 3300009147 Ga0114129_10352158 Ga0114129_103521583 248
63 3300009147 Ga0114129_10509852 Ga0114129_105098522 248
64 3300009177 Ga0105248_10059524 Ga0105248_100595241 248
65 3300009177 Ga0105248_10305506 Ga0105248_103055062 248
66 3300014969 Ga0157376_10128168 Ga0157376_101281683 248
67 3300025271 Ga0207666_1005193 Ga0207666_10051932 248
68 3300025900 Ga0207710_10168240 Ga0207710_101682401 248
69 3300025906 Ga0207699_10190747 Ga0207699_101907472 248
70 3300025922 Ga0207646_10023048 Ga0207646_100230485 248
71 3300025923 Ga0207681_10160085 Ga0207681_101600852 248
72 3300025928 Ga0207700_10003346 Ga0207700_100033467 248
73 3300025931 Ga0207644_10131275 Ga0207644_101312753 248
74 3300025937 Ga0207669_10285817 Ga0207669_102858171 248
75 3300025938 Ga0207704_10488454 Ga0207704_104884541 248
76 3300026088 Ga0207641_10003798 Ga0207641_100037988 248
77 3300028379 Ga0268266_10340438 Ga0268266_103404382 248
78 3300028380 Ga0268265_10477094 Ga0268265_104770942 248
79 3300031824 Ga0307413_10366874 Ga0307413_103668742 248
80 3300035084 Ga0373928_0033613 Ga0373928_0033613_170_916 248
81 3300035118 Ga0373954_0238695 Ga0373954_0238695_95_856 248
82 3300036401 Ga0373937_0665444 Ga0373937_0665444_208_969 248
83 3300041460 Ga0451802_0488582 Ga0451802_0488582_202_948 248
84 3300045976 Ga0466967_0216841 Ga0466967_0216841_720_1466 248
85 3300046454 Ga0495592_0250776 Ga0495592_0250776_61_819 248
86 3300046473 Ga0495582_0109557 Ga0495582_0109557_607_1365 248
87 3300046511 Ga0495608_0299535 Ga0495608_0299535_175_933 248
88 3300046533 Ga0495640_0048075 Ga0495640_0048075_1153_1911 248
89 3300046533 Ga0495640_0265376 Ga0495640_0265376_216_977 248
90 3300046543 Ga0495645_0007806 Ga0495645_0007806_2896_3657 248
91 3300046559 Ga0495667_0237698 Ga0495667_0237698_109_867 248
92 3300046663 Ga0495635_0048708 Ga0495635_0048708_1313_2074 248
93 3300046681 Ga0495647_0050435 Ga0495647_0050435_613_1374 248
94 3300046681 Ga0495647_0088721 Ga0495647_0088721_232_990 248
95 3300048908 Ga0496105_0457318 Ga0496105_0457318_167_913 248
96 3300048913 Ga0496110_0070519 Ga0496110_0070519_2300_3046 248
97 3300048917 Ga0496114_0330240 Ga0496114_0330240_97_858 248
98 3300049589 Ga0501073_0176044 Ga0501073_0176044_587_1333 248
99 3300050507 nmdc:mga05p37_254416_c1 nmdc:mga05p37_254416_c1_586_1344 248
100 3300050507 nmdc:mga05p37_269954_c1 nmdc:mga05p37_269954_c1_766_1512 248
101 3300050507 nmdc:mga05p37_52688_c1 nmdc:mga05p37_52688_c1_1958_2704 248
102 3300050512 nmdc:mga0n895_14911_c1 nmdc:mga0n895_14911_c1_401_1159 248
103 3300050513 nmdc:mga0rr50_110467_c1 nmdc:mga0rr50_110467_c1_90_848 248
104 3300050513 nmdc:mga0rr50_185156_c1 nmdc:mga0rr50_185156_c1_865_1623 248
105 3300050515 nmdc:mga0a205_142491_c1 nmdc:mga0a205_142491_c1_867_1613 248
106 3300050515 nmdc:mga0a205_15936_c1 nmdc:mga0a205_15936_c1_968_1726 248
107 3300050515 nmdc:mga0a205_19183_c1 nmdc:mga0a205_19183_c1_5291_6037 248
108 3300053077 Ga0495601_0125393 Ga0495601_0125393_603_1361 248
109 3300005293 Ga0065715_10003395 Ga0065715_100033952 249
110 3300005295 Ga0065707_10107654 Ga0065707_101076541 249
111 3300005327 Ga0070658_10034621 Ga0070658_100346211 249
112 3300005328 Ga0070676_10160145 Ga0070676_101601452 249
113 3300005336 Ga0070680_100172821 Ga0070680_1001728211 249
114 3300005336 Ga0070680_100247542 Ga0070680_1002475422 249
115 3300005344 Ga0070661_100212346 Ga0070661_1002123463 249
116 3300005347 Ga0070668_100014229 Ga0070668_1000142297 249
117 3300005347 Ga0070668_100597722 Ga0070668_1005977221 249
118 3300005353 Ga0070669_100004518 Ga0070669_1000045183 249
119 3300005353 Ga0070669_100089020 Ga0070669_1000890203 249
120 3300005354 Ga0070675_100029810 Ga0070675_1000298103 249
121 3300005355 Ga0070671_100028481 Ga0070671_1000284814 249
122 3300005356 Ga0070674_100020798 Ga0070674_1000207983 249
123 3300005364 Ga0070673_100321898 Ga0070673_1003218981 249
124 3300005364 Ga0070673_100342031 Ga0070673_1003420312 249
125 3300005365 Ga0070688_100092378 Ga0070688_1000923782 249
126 3300005366 Ga0070659_100196559 Ga0070659_1001965592 249
127 3300005439 Ga0070711_100378538 Ga0070711_1003785382 249
128 3300005444 Ga0070694_100171932 Ga0070694_1001719322 249
129 3300005457 Ga0070662_100367323 Ga0070662_1003673232 249
130 3300005458 Ga0070681_10120030 Ga0070681_101200303 249
131 3300005458 Ga0070681_10317230 Ga0070681_103172302 249
132 3300005459 Ga0068867_100047230 Ga0068867_1000472302 249
133 3300005518 Ga0070699_100055239 Ga0070699_1000552396 249
134 3300005530 Ga0070679_100237482 Ga0070679_1002374822 249
135 3300005530 Ga0070679_100358159 Ga0070679_1003581591 249
136 3300005536 Ga0070697_100425811 Ga0070697_1004258112 249
137 3300005539 Ga0068853_100000583 Ga0068853_10000058310 249
138 3300005543 Ga0070672_100039988 Ga0070672_1000399884 249
139 3300005545 Ga0070695_100251338 Ga0070695_1002513382 249
140 3300005564 Ga0070664_100377069 Ga0070664_1003770692 249
141 3300005719 Ga0068861_100298033 Ga0068861_1002980332 249
142 3300005719 Ga0068861_100619408 Ga0068861_1006194082 249
143 3300005842 Ga0068858_100109123 Ga0068858_1001091232 249
144 3300005843 Ga0068860_100029435 Ga0068860_1000294355 249
145 3300005844 Ga0068862_100007004 Ga0068862_1000070044 249
146 3300006038 Ga0075365_10105868 Ga0075365_101058683 249
147 3300006042 Ga0075368_10001004 Ga0075368_100010044 249
148 3300006042 Ga0075368_10069161 Ga0075368_100691613 249
149 3300006048 Ga0075363_100191982 Ga0075363_1001919821 249
150 3300006051 Ga0075364_10016029 Ga0075364_100160292 249
151 3300006177 Ga0075362_10004497 Ga0075362_100044974 249
152 3300006178 Ga0075367_10004748 Ga0075367_100047484 249
153 3300006178 Ga0075367_10005019 Ga0075367_100050194 249
154 3300006178 Ga0075367_10037141 Ga0075367_100371412 249
155 3300006195 Ga0075366_10015959 Ga0075366_100159592 249
156 3300006195 Ga0075366_10029724 Ga0075366_100297242 249
157 3300006195 Ga0075366_10161751 Ga0075366_101617512 249
158 3300006353 Ga0075370_10021945 Ga0075370_100219453 249
159 3300006358 Ga0068871_100313384 Ga0068871_1003133842 249
160 3300006844 Ga0075428_100008153 Ga0075428_1000081536 249
161 3300006847 Ga0075431_100027113 Ga0075431_1000271133 249
162 3300006847 Ga0075431_100302958 Ga0075431_1003029583 249
163 3300006852 Ga0075433_10009143 Ga0075433_100091437 249
164 3300006852 Ga0075433_10021190 Ga0075433_100211902 249
165 3300006871 Ga0075434_100024008 Ga0075434_1000240083 249
166 3300006880 Ga0075429_100024694 Ga0075429_1000246943 249
167 3300006914 Ga0075436_100290222 Ga0075436_1002902222 249
168 3300007076 Ga0075435_100036341 Ga0075435_1000363411 249
169 3300009093 Ga0105240_10000338 Ga0105240_1000033832 249
170 3300009094 Ga0111539_10001537 Ga0111539_100015378 249
171 3300009094 Ga0111539_10021468 Ga0111539_100214683 249
172 3300009094 Ga0111539_10026081 Ga0111539_100260817 249
173 3300009094 Ga0111539_11223081 Ga0111539_112230811 249
174 3300009098 Ga0105245_10078871 Ga0105245_100788712 249
175 3300009101 Ga0105247_10035444 Ga0105247_100354442 249
176 3300009147 Ga0114129_10000589 Ga0114129_1000058925 249
177 3300009147 Ga0114129_10031053 Ga0114129_100310536 249
178 3300009147 Ga0114129_10064667 Ga0114129_100646673 249
179 3300009147 Ga0114129_10986054 Ga0114129_109860541 249
180 3300009148 Ga0105243_10015486 Ga0105243_100154868 249
181 3300009176 Ga0105242_10119425 Ga0105242_101194252 249
182 3300009176 Ga0105242_10616487 Ga0105242_106164872 249
183 3300009177 Ga0105248_10001067 Ga0105248_100010674 249
184 3300009177 Ga0105248_10006358 Ga0105248_100063587 249
185 3300009177 Ga0105248_10026099 Ga0105248_100260993 249
186 3300009545 Ga0105237_10000081 Ga0105237_1000008196 249
187 3300009551 Ga0105238_10017408 Ga0105238_100174082 249
188 3300009553 Ga0105249_10003036 Ga0105249_100030369 249
189 3300009553 Ga0105249_10691074 Ga0105249_106910741 249
190 3300013104 Ga0157370_10190550 Ga0157370_101905502 249
191 3300013105 Ga0157369_10200602 Ga0157369_102006022 249
192 3300013105 Ga0157369_10681035 Ga0157369_106810352 249
193 3300013306 Ga0163162_10264878 Ga0163162_102648782 249
194 3300014745 Ga0157377_10009393 Ga0157377_100093932 249
195 3300014745 Ga0157377_10054930 Ga0157377_100549302 249
196 3300014968 Ga0157379_10006294 Ga0157379_100062945 249
197 3300014969 Ga0157376_10278164 Ga0157376_102781642 249
198 3300017792 Ga0163161_10133302 Ga0163161_101333022 249
199 3300025900 Ga0207710_10015427 Ga0207710_100154275 249
200 3300025909 Ga0207705_10260631 Ga0207705_102606312 249
201 3300025912 Ga0207707_10341692 Ga0207707_103416921 249
202 3300025912 Ga0207707_10516903 Ga0207707_105169031 249
203 3300025913 Ga0207695_10037697 Ga0207695_100376972 249
204 3300025913 Ga0207695_10413196 Ga0207695_104131962 249
205 3300025914 Ga0207671_10000077 Ga0207671_1000007766 249
206 3300025917 Ga0207660_10108191 Ga0207660_101081911 249
207 3300025921 Ga0207652_10014973 Ga0207652_100149732 249
208 3300025921 Ga0207652_10093116 Ga0207652_100931161 249
209 3300025921 Ga0207652_10316627 Ga0207652_103166271 249
210 3300025922 Ga0207646_10250222 Ga0207646_102502222 249
211 3300025923 Ga0207681_10003694 Ga0207681_1000369412 249
212 3300025924 Ga0207694_10045258 Ga0207694_100452583 249
213 3300025926 Ga0207659_10000180 Ga0207659_1000018022 249
214 3300025926 Ga0207659_10095771 Ga0207659_100957711 249
215 3300025931 Ga0207644_10025925 Ga0207644_100259254 249
216 3300025932 Ga0207690_10148437 Ga0207690_101484372 249
217 3300025933 Ga0207706_10257631 Ga0207706_102576312 249
218 3300025933 Ga0207706_10355644 Ga0207706_103556442 249
219 3300025934 Ga0207686_10123295 Ga0207686_101232952 249
220 3300025934 Ga0207686_10141349 Ga0207686_101413491 249
221 3300025937 Ga0207669_10027926 Ga0207669_100279262 249
222 3300025940 Ga0207691_10016729 Ga0207691_100167292 249
223 3300025940 Ga0207691_10435474 Ga0207691_104354742 249
224 3300025941 Ga0207711_10031239 Ga0207711_100312393 249
225 3300025941 Ga0207711_10080080 Ga0207711_100800804 249
226 3300025945 Ga0207679_10245558 Ga0207679_102455582 249
227 3300025945 Ga0207679_10316526 Ga0207679_103165262 249
228 3300025949 Ga0207667_10448626 Ga0207667_104486261 249
229 3300025949 Ga0207667_10450864 Ga0207667_104508641 249
230 3300025960 Ga0207651_10106908 Ga0207651_101069082 249
231 3300025961 Ga0207712_10115637 Ga0207712_101156372 249
232 3300025961 Ga0207712_10149907 Ga0207712_101499072 249
233 3300025961 Ga0207712_10529332 Ga0207712_105293321 249
234 3300025961 Ga0207712_10700237 Ga0207712_107002371 249
235 3300025972 Ga0207668_10558668 Ga0207668_105586681 249
236 3300026023 Ga0207677_10184512 Ga0207677_101845122 249
237 3300026035 Ga0207703_10143342 Ga0207703_101433424 249
238 3300026041 Ga0207639_10004111 Ga0207639_100041117 249
239 3300026075 Ga0207708_10143034 Ga0207708_101430342 249
240 3300026078 Ga0207702_10537187 Ga0207702_105371872 249
241 3300026089 Ga0207648_10066459 Ga0207648_100664592 249
242 3300026095 Ga0207676_10026308 Ga0207676_100263084 249
243 3300026116 Ga0207674_10042610 Ga0207674_100426104 249
244 3300026118 Ga0207675_100075181 Ga0207675_1000751812 249
245 3300026118 Ga0207675_100176265 Ga0207675_1001762653 249
246 3300026118 Ga0207675_100352666 Ga0207675_1003526662 249
247 3300026118 Ga0207675_100359926 Ga0207675_1003599262 249
248 3300026142 Ga0207698_10415775 Ga0207698_104157752 249
249 3300027907 Ga0207428_10009636 Ga0207428_100096362 249
250 3300027907 Ga0207428_10034873 Ga0207428_100348731 249
251 3300028381 Ga0268264_10576358 Ga0268264_105763582 249
252 3300028573 Ga0265334_10010690 Ga0265334_100106903 249
253 3300028577 Ga0265318_10000269 Ga0265318_100002694 249
254 3300028577 Ga0265318_10000304 Ga0265318_1000030420 249
255 3300028577 Ga0265318_10010582 Ga0265318_100105822 249
256 3300028653 Ga0265323_10002806 Ga0265323_100028062 249
257 3300028800 Ga0265338_10000944 Ga0265338_1000094415 249
258 3300028800 Ga0265338_10007665 Ga0265338_100076655 249
259 3300028800 Ga0265338_10027794 Ga0265338_100277945 249
260 3300028800 Ga0265338_10112201 Ga0265338_101122012 249
261 3300029957 Ga0265324_10000025 Ga0265324_10000025107 249
262 3300031235 Ga0265330_10000002 Ga0265330_10000002400 249
263 3300031235 Ga0265330_10003096 Ga0265330_100030966 249
264 3300031235 Ga0265330_10007175 Ga0265330_100071752 249
265 3300031238 Ga0265332_10000838 Ga0265332_1000083813 249
266 3300031238 Ga0265332_10002344 Ga0265332_100023444 249
267 3300031239 Ga0265328_10000888 Ga0265328_1000088811 249
268 3300031239 Ga0265328_10008351 Ga0265328_100083513 249
269 3300031239 Ga0265328_10021549 Ga0265328_100215491 249
270 3300031240 Ga0265320_10000052 Ga0265320_1000005231 249
271 3300031240 Ga0265320_10002676 Ga0265320_100026766 249
272 3300031240 Ga0265320_10003908 Ga0265320_100039089 249
273 3300031241 Ga0265325_10016442 Ga0265325_100164425 249
274 3300031241 Ga0265325_10114291 Ga0265325_101142912 249
275 3300031242 Ga0265329_10000262 Ga0265329_100002623 249
276 3300031242 Ga0265329_10001921 Ga0265329_100019214 249
277 3300031242 Ga0265329_10090511 Ga0265329_100905111 249
278 3300031247 Ga0265340_10003455 Ga0265340_100034553 249
279 3300031249 Ga0265339_10000014 Ga0265339_1000001463 249
280 3300031249 Ga0265339_10002013 Ga0265339_100020138 249
281 3300031249 Ga0265339_10006635 Ga0265339_100066356 249
282 3300031250 Ga0265331_10000001 Ga0265331_1000000155 249
283 3300031250 Ga0265331_10002505 Ga0265331_100025053 249
284 3300031250 Ga0265331_10009081 Ga0265331_100090811 249
285 3300031344 Ga0265316_10008063 Ga0265316_100080635 249
286 3300031344 Ga0265316_10009664 Ga0265316_100096644 249
287 3300031344 Ga0265316_10026584 Ga0265316_100265844 249
288 3300031548 Ga0307408_100181737 Ga0307408_1001817372 249
289 3300031595 Ga0265313_10000134 Ga0265313_1000013412 249
290 3300031595 Ga0265313_10006921 Ga0265313_100069215 249
291 3300031595 Ga0265313_10051969 Ga0265313_100519692 249
292 3300031595 Ga0265313_10070218 Ga0265313_100702182 249
293 3300031711 Ga0265314_10000038 Ga0265314_1000003861 249
294 3300031711 Ga0265314_10001496 Ga0265314_100014961 249
295 3300031711 Ga0265314_10004232 Ga0265314_100042324 249
296 3300031711 Ga0265314_10007510 Ga0265314_100075104 249
297 3300031712 Ga0265342_10000767 Ga0265342_1000076728 249
298 3300031712 Ga0265342_10000829 Ga0265342_100008299 249
299 3300031712 Ga0265342_10001976 Ga0265342_100019767 249
300 3300031712 Ga0265342_10013348 Ga0265342_100133484 249
301 3300031731 Ga0307405_10188527 Ga0307405_101885272 249
302 3300031995 Ga0307409_100035951 Ga0307409_1000359513 249
303 3300031995 Ga0307409_100363834 Ga0307409_1003638341 249
304 3300032002 Ga0307416_100880277 Ga0307416_1008802772 249
305 3300032005 Ga0307411_10310854 Ga0307411_103108542 249
306 3300035115 Ga0373941_0110822 Ga0373941_0110822_159_908 249
307 3300035171 Ga0373946_0024859 Ga0373946_0024859_911_1717 249
308 3300035692 Ga0373935_0350370 Ga0373935_0350370_69_830 249
309 3300035724 Ga0373933_0025350 Ga0373933_0025350_679_1500 249
310 3300036401 Ga0373937_0250148 Ga0373937_0250148_354_1115 249
311 3300036401 Ga0373937_0620871 Ga0373937_0620871_262_1014 249
312 3300037471 Ga0395905_0169504 Ga0395905_0169504_566_1315 249
313 3300039437 Ga0436365_0884346 Ga0436365_0884346_1365_2117 249
314 3300042436 Ga0439435_0033974 Ga0439435_0033974_550_1386 249
315 3300042876 Ga0451577_0008553 Ga0451577_0008553_8631_9380 249
316 3300044712 Ga0453684_0042326 Ga0453684_0042326_2383_3132 249
317 3300044712 Ga0453684_0317944 Ga0453684_0317944_17_772 249
318 3300044712 Ga0453684_0331375 Ga0453684_0331375_280_1041 249
319 3300046459 Ga0495629_0336339 Ga0495629_0336339_67_828 249
320 3300046558 Ga0495633_0223449 Ga0495633_0223449_37_786 249
321 3300046663 Ga0495635_0131539 Ga0495635_0131539_228_989 249
322 3300046683 Ga0495658_0116256 Ga0495658_0116256_726_1487 249
323 3300046683 Ga0495658_0190810 Ga0495658_0190810_161_931 249
324 3300046683 Ga0495658_0238267 Ga0495658_0238267_102_929 249
325 3300046684 Ga0495669_0091506 Ga0495669_0091506_208_957 249
326 3300046689 Ga0495613_0413122 Ga0495613_0413122_62_823 249
327 3300047319 Ga0495674_0192244 Ga0495674_0192244_906_1667 249
328 3300048903 Ga0496100_0181560 Ga0496100_0181560_322_1071 249
329 3300048904 Ga0496101_0483081 Ga0496101_0483081_171_923 249
330 3300048905 Ga0496102_0024984 Ga0496102_0024984_2129_2881 249
331 3300048905 Ga0496102_0438030 Ga0496102_0438030_17_766 249
332 3300048907 Ga0496104_0062750 Ga0496104_0062750_923_1684 249
333 3300048909 Ga0496106_0035360 Ga0496106_0035360_1504_2256 249
334 3300048911 Ga0496108_0170753 Ga0496108_0170753_124_885 249
335 3300048912 Ga0496109_0836591 Ga0496109_0836591_65_814 249
336 3300048915 Ga0496112_0026323 Ga0496112_0026323_2014_2775 249
337 3300048915 Ga0496112_0079570 Ga0496112_0079570_1462_2214 249
338 3300048916 Ga0496113_0100645 Ga0496113_0100645_1282_2043 249
339 3300049580 Ga0501046_0169803 Ga0501046_0169803_412_1164 249
340 3300049587 Ga0501071_0062647 Ga0501071_0062647_45_797 249
341 3300049590 Ga0501074_0250808 Ga0501074_0250808_124_876 249
342 3300049742 Ga0501080_0371266 Ga0501080_0371266_321_1115 249
343 3300050489 nmdc:mga03683_22322_c1 nmdc:mga03683_22322_c1_131_883 249
344 3300050490 nmdc:mga03n38_81664_c1 nmdc:mga03n38_81664_c1_75_839 249
345 3300050491 nmdc:mga00v17_47102_c1 nmdc:mga00v17_47102_c1_112_864 249
346 3300050492 nmdc:mga0yw44_319294_c1 nmdc:mga0yw44_319294_c1_115_867 249
347 3300050493 nmdc:mga0k408_5293_c1 nmdc:mga0k408_5293_c1_2096_2848 249
348 3300050494 nmdc:mga06z11_46839_c1 nmdc:mga06z11_46839_c1_1314_2078 249
349 3300050494 nmdc:mga06z11_7347_c1 nmdc:mga06z11_7347_c1_606_1358 249
350 3300050494 nmdc:mga06z11_7456_c1 nmdc:mga06z11_7456_c1_3693_4445 249
351 3300050496 nmdc:mga07m45_6600_c1 nmdc:mga07m45_6600_c1_1303_2055 249
352 3300050507 nmdc:mga05p37_18494_c1 nmdc:mga05p37_18494_c1_1490_2239 249
353 3300050507 nmdc:mga05p37_55238_c1 nmdc:mga05p37_55238_c1_950_1699 249
354 3300050507 nmdc:mga05p37_91385_c1 nmdc:mga05p37_91385_c1_1161_1943 249
355 3300050509 nmdc:mga0qj67_159301_c1 nmdc:mga0qj67_159301_c1_386_1135 249
356 3300050511 nmdc:mga08y16_24879_c1 nmdc:mga08y16_24879_c1_1307_2056 249
357 3300050511 nmdc:mga08y16_25947_c1 nmdc:mga08y16_25947_c1_353_1102 249
358 3300050511 nmdc:mga08y16_9641_c1 nmdc:mga08y16_9641_c1_2341_3090 249
359 3300050512 nmdc:mga0n895_1957_c1 nmdc:mga0n895_1957_c1_6975_7742 249
360 3300050512 nmdc:mga0n895_41888_c1 nmdc:mga0n895_41888_c1_2428_3177 249
361 3300050513 nmdc:mga0rr50_36427_c1 nmdc:mga0rr50_36427_c1_35_784 249
362 3300050515 nmdc:mga0a205_145743_c1 nmdc:mga0a205_145743_c1_675_1460 249
363 3300050515 nmdc:mga0a205_29335_c1 nmdc:mga0a205_29335_c1_3401_4168 249
364 3300050515 nmdc:mga0a205_50883_c1 nmdc:mga0a205_50883_c1_1255_2004 249
365 3300053139 Ga0500568_0001007 Ga0500568_0001007_4729_5490 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

4

240

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2isi-assembly3.cif.gz_C crystal structure of ape1 from homo sapiens in a new crystal form complexed with a ligand 0.9208 1 249
1dew-assembly1.cif.gz_B crystal structure of human ape1 bound to abasic dna 0.9194 1 249
2o3h-assembly1.cif.gz_A crystal structure of the human c65a ape 0.9194 1 249
7svb-assembly1.cif.gz_B ape1 exonuclease substrate complex with 8oxog opposite c 0.9193 1 249
5wn3-assembly1.cif.gz_B ape1 f266a exonuclease substrate complex with a c/t mismatch 0.9177 1 249
ID Description Score Start End Superfamily
af_P27864_388_678_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9223 1 248 3.60.10.10
af_P27864_388_678_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9151 1 248 3.60.10.10
4qh9A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9148 1 249 3.60.10.10
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9136 1 249 3.60.10.10
4qh9A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9113 1 249 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A7V8XUG1-F1-model_v4 Endonuclease/exonuclease/phosphatase family protein 0.9843 1 196 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A7V8XUG1-F1-model_v4 Endonuclease/exonuclease/phosphatase family protein 0.9792 1 196 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A534P6L1-F1-model_v4 Exodeoxyribonuclease III (EC 3.1.11.2) 0.9743 1 249 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A2V7WBN2-F1-model_v4 Exodeoxyribonuclease III 0.9717 1 248 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A2V7PKQ2-F1-model_v4 Exodeoxyribonuclease III 0.971 1 247 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.92 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map