F423567

General Info

Members Datasets Scaffolds Average Seq Length
365 210 730 107

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_102256752|Ga0068868_1022567521
Length 130
Sequence VAQDSGPALDRDPGERAPRKHRTMTTLSEQDFRVKSDESLERARKALLPLADEAGFEIELSNGVLNLIFEEPTEARFVVSPNAPVRQIWISAMSKSYKLSWAPEAGAFALNGEPLPLLLERLTRVQLEQT

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
143 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
144 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
145 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
146 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
147 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
148 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
151 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
162 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
163 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
203 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.38
Rhizosphere 94.79
Stem 0
Stem Tuber 0
Unclassified 31.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_102256752 3300005338 Unclassified 519
2 Ga0065712_10331023 3300005290 Bacteria 814
3 Ga0065715_10864754 3300005293 Unclassified 587
4 Ga0070683_100833008 3300005329 Unclassified 885
5 Ga0070683_101552800 3300005329 Unclassified 636
6 Ga0070690_100042976 3300005330 Bacteria 2864
7 Ga0068869_100132249 3300005334 Bacteria 1919
8 Ga0068869_100276172 3300005334 Bacteria 1350
9 Ga0068869_100523367 3300005334 Bacteria 993
10 Ga0068869_100712649 3300005334 Unclassified 857
11 Ga0070666_10078580 3300005335 Bacteria 2253
12 Ga0070666_10129381 3300005335 Unclassified 1754
13 Ga0070680_100322182 3300005336 Bacteria 1312
14 Ga0068868_100026392 3300005338 Bacteria 4427
15 Ga0068868_100032766 3300005338 Bacteria 3998
16 Ga0068868_100066126 3300005338 Bacteria 2874
17 Ga0070660_100047434 3300005339 Bacteria 3297
18 Ga0070687_100162873 3300005343 Bacteria 1320
19 Ga0070687_100722876 3300005343 Bacteria 698
20 Ga0070661_100944336 3300005344 Unclassified 713
21 Ga0070692_10151801 3300005345 Bacteria 1320
22 Ga0070692_10183953 3300005345 Unclassified 1213
23 Ga0070692_10898573 3300005345 Unclassified 612
24 Ga0070668_100425381 3300005347 Bacteria 1138
25 Ga0070671_100292192 3300005355 Bacteria 1387
26 Ga0070674_100159166 3300005356 Bacteria 1712
27 Ga0070674_100555966 3300005356 Bacteria 964
28 Ga0070673_100268312 3300005364 Bacteria 1493
29 Ga0070673_100810753 3300005364 Bacteria 865
30 Ga0070659_100787665 3300005366 Bacteria 826
31 Ga0070659_100898157 3300005366 Bacteria 774
32 Ga0070667_100992840 3300005367 Unclassified 783
33 Ga0070709_10024089 3300005434 Bacteria 3581
34 Ga0070713_101086216 3300005436 Unclassified 773
35 Ga0070713_101182339 3300005436 Unclassified 740
36 Ga0070713_102379452 3300005436 Bacteria 512
37 Ga0070710_10752364 3300005437 Unclassified 692
38 Ga0070701_11201513 3300005438 Bacteria 538
39 Ga0070711_100089474 3300005439 Unclassified 2214
40 Ga0070678_100169209 3300005456 Unclassified 1778
41 Ga0070678_100956004 3300005456 Bacteria 786
42 Ga0070681_10164903 3300005458 Bacteria 2139
43 Ga0070681_10735270 3300005458 Bacteria 903
44 Ga0068867_100564229 3300005459 Unclassified 988
45 Ga0068867_102329137 3300005459 Unclassified 509
46 Ga0070706_100528098 3300005467 Bacteria 1098
47 Ga0070706_101051187 3300005467 Bacteria 750
48 Ga0070698_102051266 3300005471 Unclassified 525
49 Ga0070699_100485902 3300005518 Unclassified 1121
50 Ga0070699_100974803 3300005518 Bacteria 777
51 Ga0070679_100025569 3300005530 Bacteria 5795
52 Ga0070684_100096267 3300005535 Unclassified 2638
53 Ga0070684_100306279 3300005535 Unclassified 1458
54 Ga0070697_101390596 3300005536 Unclassified 627
55 Ga0070697_102043505 3300005536 Bacteria 513
56 Ga0068853_100895517 3300005539 Unclassified 852
57 Ga0070686_100399641 3300005544 Bacteria 1045
58 Ga0070686_101019031 3300005544 Bacteria 680
59 Ga0070695_100078353 3300005545 Bacteria 2179
60 Ga0070696_100386310 3300005546 Bacteria 1092
61 Ga0070693_100497957 3300005547 Unclassified 864
62 Ga0070693_101042464 3300005547 Unclassified 621
63 Ga0070693_101221375 3300005547 Bacteria 578
64 Ga0070665_100015165 3300005548 Bacteria 7737
65 Ga0070665_100041743 3300005548 Bacteria 4612
66 Ga0070665_101766802 3300005548 Bacteria 625
67 Ga0070665_102323965 3300005548 Bacteria 539
68 Ga0070704_100087483 3300005549 Bacteria 2313
69 Ga0068855_100056873 3300005563 Bacteria 4586
70 Ga0070664_100189963 3300005564 Bacteria 1830
71 Ga0070664_100394807 3300005564 Bacteria 1264
72 Ga0070664_101191906 3300005564 Unclassified 718
73 Ga0068854_101179560 3300005578 Unclassified 685
74 Ga0068854_101359284 3300005578 Unclassified 641
75 Ga0068856_100183623 3300005614 Bacteria 2105
76 Ga0068856_100330817 3300005614 Bacteria 1541
77 Ga0070702_100319838 3300005615 Unclassified 1081
78 Ga0070702_100765995 3300005615 Unclassified 743
79 Ga0068852_101697715 3300005616 Unclassified 654
80 Ga0068859_100805562 3300005617 Unclassified 1027
81 Ga0068859_100899682 3300005617 Bacteria 970
82 Ga0068859_101012378 3300005617 Bacteria 912
83 Ga0068859_101752331 3300005617 Bacteria 686
84 Ga0068864_100399533 3300005618 Bacteria 1306
85 Ga0068866_10140611 3300005718 Bacteria 1385
86 Ga0068866_10522707 3300005718 Unclassified 789
87 Ga0068861_100048884 3300005719 Bacteria 3200
88 Ga0068861_101081870 3300005719 Bacteria 770
89 Ga0068861_101972947 3300005719 Unclassified 582
90 Ga0068863_100166615 3300005841 Unclassified 2113
91 Ga0068863_101199096 3300005841 Bacteria 765
92 Ga0068863_102074611 3300005841 Unclassified 579
93 Ga0068858_100087997 3300005842 Bacteria 2889
94 Ga0068858_100315168 3300005842 Bacteria 1494
95 Ga0068858_100496510 3300005842 Bacteria 1179
96 Ga0068858_100890160 3300005842 Unclassified 870
97 Ga0068860_100102734 3300005843 Unclassified 2728
98 Ga0068860_100167932 3300005843 Bacteria 2119
99 Ga0068860_100290485 3300005843 Bacteria 1600
100 Ga0068860_101345424 3300005843 Bacteria 735
101 Ga0068860_101901145 3300005843 Bacteria 617
102 Ga0068862_100512739 3300005844 Unclassified 1140
103 Ga0068862_101028293 3300005844 Unclassified 816
104 Ga0081455_10163476 3300005937 Bacteria 1703
105 Ga0070715_10410216 3300006163 Bacteria 755
106 Ga0097621_100009469 3300006237 Bacteria 7071
107 Ga0097621_100019257 3300006237 Bacteria 5235
108 Ga0097621_100050539 3300006237 Bacteria 3381
109 Ga0097621_100128046 3300006237 Bacteria 2158
110 Ga0097621_100319877 3300006237 Unclassified 1374
111 Ga0097621_100638224 3300006237 Bacteria 976
112 Ga0068871_100012578 3300006358 Bacteria 6248
113 Ga0068871_100138556 3300006358 Bacteria 2067
114 Ga0068871_100152085 3300006358 Unclassified 1974
115 Ga0068871_100412043 3300006358 Bacteria 1205
116 Ga0075434_100308552 3300006871 Bacteria 1603
117 Ga0068865_100123519 3300006881 Bacteria 1929
118 Ga0068865_100172490 3300006881 Bacteria 1659
119 Ga0068865_100830914 3300006881 Bacteria 799
120 Ga0097620_100805385 3300006931 Unclassified 1027
121 Ga0097620_100899585 3300006931 Bacteria 970
122 Ga0097620_101012326 3300006931 Bacteria 912
123 Ga0097620_101752221 3300006931 Bacteria 686
124 Ga0075435_100254981 3300007076 Bacteria 1494
125 Ga0099795_10369669 3300007788 Bacteria 645
126 Ga0105240_10831826 3300009093 Bacteria 998
127 Ga0111539_10138436 3300009094 Unclassified 2851
128 Ga0111539_12853485 3300009094 Unclassified 559
129 Ga0105245_10022013 3300009098 Bacteria 5594
130 Ga0105245_10066504 3300009098 Unclassified 3263
131 Ga0105245_10362095 3300009098 Bacteria 1439
132 Ga0105245_10446053 3300009098 Bacteria 1301
133 Ga0105245_10717174 3300009098 Bacteria 1034
134 Ga0105247_10122447 3300009101 Bacteria 1687
135 Ga0105247_10387910 3300009101 Bacteria 992
136 Ga0105247_11192906 3300009101 Unclassified 606
137 Ga0114129_10416531 3300009147 Bacteria 1768
138 Ga0105243_11108025 3300009148 Bacteria 800
139 Ga0105243_11537655 3300009148 Bacteria 690
140 Ga0105243_11745292 3300009148 Unclassified 652
141 Ga0105243_11963193 3300009148 Bacteria 619
142 Ga0105243_12057622 3300009148 Unclassified 606
143 Ga0105241_10722973 3300009174 Bacteria 911
144 Ga0105242_10033222 3300009176 Bacteria 4130
145 Ga0105242_10350803 3300009176 Bacteria 1363
146 Ga0105242_10420569 3300009176 Bacteria 1252
147 Ga0105248_10018733 3300009177 Bacteria 7655
148 Ga0105248_10080028 3300009177 Bacteria 3672
149 Ga0105248_10129315 3300009177 Bacteria 2849
150 Ga0105248_10290401 3300009177 Bacteria 1841
151 Ga0105248_10448354 3300009177 Bacteria 1454
152 Ga0105248_10750909 3300009177 Unclassified 1101
153 Ga0105248_10756902 3300009177 Bacteria 1096
154 Ga0105248_11049306 3300009177 Unclassified 921
155 Ga0105248_11155543 3300009177 Bacteria 875
156 Ga0105248_13169168 3300009177 Bacteria 523
157 Ga0105249_10583517 3300009553 Bacteria 1171
158 Ga0105246_11337581 3300011119 Archaea 665
159 Ga0105246_11508728 3300011119 Bacteria 631
160 Ga0157370_10213507 3300013104 Unclassified 1788
161 Ga0157370_10342098 3300013104 Bacteria 1379
162 Ga0157374_10055972 3300013296 Bacteria 3682
163 Ga0157374_10118383 3300013296 Bacteria 2554
164 Ga0157374_10405290 3300013296 Bacteria 1361
165 Ga0157378_10012898 3300013297 Bacteria 7317
166 Ga0157378_10158655 3300013297 Unclassified 2114
167 Ga0157378_11634449 3300013297 Bacteria 690
168 Ga0157378_13196581 3300013297 Unclassified 509
169 Ga0163162_10059743 3300013306 Bacteria 3845
170 Ga0163162_12386568 3300013306 Unclassified 608
171 Ga0157372_11690456 3300013307 Bacteria 728
172 Ga0157375_10118016 3300013308 Unclassified 2759
173 Ga0157375_10812169 3300013308 Bacteria 1083
174 Ga0163163_11298944 3300014325 Bacteria 790
175 Ga0163163_12405279 3300014325 Unclassified 585
176 Ga0163163_12622209 3300014325 Unclassified 561
177 Ga0163163_12926582 3300014325 Unclassified 533
178 Ga0157379_10359214 3300014968 Bacteria 1335
179 Ga0157379_10638930 3300014968 Unclassified 996
180 Ga0157376_10033860 3300014969 Bacteria 4118
181 Ga0157376_10860186 3300014969 Bacteria 923
182 Ga0157376_11057407 3300014969 Bacteria 836
183 Ga0157376_12601980 3300014969 Bacteria 546
184 Ga0157376_12762739 3300014969 Unclassified 531
185 Ga0163161_10536590 3300017792 Bacteria 957
186 Ga0213876_10131468 3300021384 Bacteria 1330
187 Ga0207642_10067632 3300025899 Unclassified 1687
188 Ga0207642_10094046 3300025899 Bacteria 1488
189 Ga0207685_10052116 3300025905 Bacteria 1584
190 Ga0207699_10093978 3300025906 Bacteria 1888
191 Ga0207645_10722864 3300025907 Unclassified 677
192 Ga0207705_10395434 3300025909 Bacteria 1068
193 Ga0207684_10852926 3300025910 Bacteria 768
194 Ga0207707_10169319 3300025912 Bacteria 1909
195 Ga0207707_10178483 3300025912 Bacteria 1854
196 Ga0207707_11302699 3300025912 Bacteria 584
197 Ga0207695_10048861 3300025913 Unclassified 4464
198 Ga0207663_10140509 3300025916 Bacteria 1681
199 Ga0207660_10074498 3300025917 Bacteria 2478
200 Ga0207662_10887769 3300025918 Unclassified 631
201 Ga0207657_10003281 3300025919 Bacteria 17313
202 Ga0207652_10018100 3300025921 Bacteria 5776
203 Ga0207652_10176041 3300025921 Bacteria 1921
204 Ga0207652_10968707 3300025921 Bacteria 749
205 Ga0207694_11740968 3300025924 Bacteria 524
206 Ga0207650_11665936 3300025925 Unclassified 541
207 Ga0207659_11451618 3300025926 Bacteria 587
208 Ga0207687_10027291 3300025927 Unclassified 3830
209 Ga0207687_10284318 3300025927 Bacteria 1327
210 Ga0207700_10381820 3300025928 Bacteria 1232
211 Ga0207644_10300324 3300025931 Bacteria 1294
212 Ga0207644_10449796 3300025931 Unclassified 1058
213 Ga0207644_11162431 3300025931 Bacteria 649
214 Ga0207690_10587978 3300025932 Bacteria 908
215 Ga0207686_10281797 3300025934 Bacteria 1227
216 Ga0207709_11001027 3300025935 Unclassified 683
217 Ga0207709_11436198 3300025935 Unclassified 572
218 Ga0207709_11740170 3300025935 Unclassified 518
219 Ga0207669_10500159 3300025937 Bacteria 972
220 Ga0207704_10939360 3300025938 Unclassified 729
221 Ga0207691_10298670 3300025940 Bacteria 1384
222 Ga0207711_10119305 3300025941 Bacteria 2353
223 Ga0207711_10179790 3300025941 Bacteria 1923
224 Ga0207711_10250562 3300025941 Bacteria 1626
225 Ga0207711_10307647 3300025941 Bacteria 1463
226 Ga0207711_10371208 3300025941 Unclassified 1327
227 Ga0207711_10735297 3300025941 Unclassified 920
228 Ga0207711_10841489 3300025941 Bacteria 854
229 Ga0207689_10162115 3300025942 Bacteria 1842
230 Ga0207689_10190306 3300025942 Bacteria 1693
231 Ga0207689_10263856 3300025942 Unclassified 1425
232 Ga0207689_10886308 3300025942 Bacteria 753
233 Ga0207661_11350623 3300025944 Unclassified 654
234 Ga0207679_10278303 3300025945 Unclassified 1434
235 Ga0207679_10570561 3300025945 Bacteria 1017
236 Ga0207667_10049222 3300025949 Bacteria 4452
237 Ga0207667_10827466 3300025949 Bacteria 921
238 Ga0207651_10199973 3300025960 Unclassified 1601
239 Ga0207651_10212342 3300025960 Bacteria 1559
240 Ga0207712_10417142 3300025961 Bacteria 1131
241 Ga0207712_10512893 3300025961 Unclassified 1026
242 Ga0207712_11156791 3300025961 Unclassified 690
243 Ga0207668_11116510 3300025972 Bacteria 707
244 Ga0207640_10184980 3300025981 Bacteria 1566
245 Ga0207658_10981723 3300025986 Unclassified 770
246 Ga0207658_11609726 3300025986 Unclassified 594
247 Ga0207677_10090348 3300026023 Bacteria 2225
248 Ga0207677_11029422 3300026023 Bacteria 748
249 Ga0207677_11527269 3300026023 Unclassified 617
250 Ga0207703_10211220 3300026035 Bacteria 1730
251 Ga0207703_10692878 3300026035 Bacteria 968
252 Ga0207703_10786383 3300026035 Unclassified 908
253 Ga0207703_10883173 3300026035 Bacteria 856
254 Ga0207702_10073067 3300026078 Bacteria 2956
255 Ga0207702_10583350 3300026078 Bacteria 1096
256 Ga0207641_10262667 3300026088 Unclassified 1617
257 Ga0207641_11162040 3300026088 Bacteria 771
258 Ga0207648_10121109 3300026089 Bacteria 2301
259 Ga0207648_10562586 3300026089 Unclassified 1048
260 Ga0207648_11985409 3300026089 Unclassified 543
261 Ga0207676_10257993 3300026095 Bacteria 1572
262 Ga0207675_100015362 3300026118 Bacteria 7141
263 Ga0207675_100251996 3300026118 Bacteria 1709
264 Ga0207675_100322052 3300026118 Bacteria 1509
265 Ga0207675_101413031 3300026118 Bacteria 717
266 Ga0207683_10130767 3300026121 Bacteria 2258
267 Ga0207683_10194876 3300026121 Bacteria 1840
268 Ga0207698_11187555 3300026142 Unclassified 777
269 Ga0209179_1143636 3300027512 Unclassified 533
270 Ga0268265_10264967 3300028380 Bacteria 1530
271 Ga0268265_11468714 3300028380 Unclassified 685
272 Ga0268264_10068390 3300028381 Unclassified 3001
273 Ga0268264_11054799 3300028381 Unclassified 820
274 Ga0268264_11243429 3300028381 Bacteria 754
275 Ga0307405_10028455 3300031731 Bacteria 3255
276 Ga0307413_10007543 3300031824 Bacteria 5060
277 Ga0307410_10007289 3300031852 Bacteria 6044
278 Ga0307406_10054777 3300031901 Archaea 2547
279 Ga0307407_10376415 3300031903 Unclassified 1012
280 Ga0307409_100113622 3300031995 Unclassified 2276
281 Ga0307416_100055963 3300032002 Bacteria 3179
282 Ga0307414_10081935 3300032004 Unclassified 2364
283 Ga0307411_10006794 3300032005 Bacteria 5759
284 Ga0307415_100374775 3300032126 Unclassified 1206
285 Ga0373948_0097505 3300034817 Bacteria 689
286 Ga0373950_0000159 3300034818 Bacteria 9864
287 Ga0373959_0000541 3300034820 Bacteria 6737
288 Ga0373938_0004574 3300034957 Bacteria 2319
289 Ga0373926_0194185 3300035083 Bacteria 780
290 Ga0373928_0002211 3300035084 Unclassified 3786
291 Ga0373929_0004761 3300035085 Bacteria 2432
292 Ga0373940_0007925 3300035088 Bacteria 2417
293 Ga0373949_0006579 3300035090 Unclassified 2555
294 Ga0373951_0002807 3300035091 Bacteria 4340
295 Ga0373923_0285589 3300035111 Bacteria 778
296 Ga0373936_0067104 3300035113 Bacteria 1474
297 Ga0373939_0015537 3300035114 Unclassified 1993
298 Ga0373941_0000527 3300035115 Bacteria 7669
299 Ga0373956_0082436 3300035119 Bacteria 1477
300 Ga0373960_0022915 3300035121 Unclassified 1677
301 Ga0373943_0005334 3300035170 Bacteria 5779
302 Ga0373943_0309953 3300035170 Bacteria 898
303 Ga0373946_0016837 3300035171 Bacteria 2790
304 Ga0373955_0017868 3300035172 Bacteria 3516
305 Ga0373955_0139642 3300035172 Bacteria 1420
306 Ga0373942_0000705 3300035207 Bacteria 9274
307 Ga0373961_0005082 3300035241 Unclassified 3164
308 Ga0373962_0001142 3300035242 Bacteria 6198
309 Ga0373935_0059293 3300035692 Bacteria 2446
310 Ga0373933_0080287 3300035724 Bacteria 1999
311 Ga0373937_0155532 3300036401 Unclassified 2143
312 Ga0373937_0805596 3300036401 Unclassified 887
313 Ga0373925_0019711 3300037068 Unclassified 4909
314 Ga0436365_0574438 3300039437 Archaea 1262
315 Ga0436365_1166966 3300039437 Bacteria 2495
316 Ga0495592_0903713 3300046454 Bacteria 519
317 Ga0495629_0163073 3300046459 Bacteria 1548
318 Ga0495582_0231063 3300046473 Bacteria 1059
319 Ga0495582_0845290 3300046473 Unclassified 529
320 Ga0495583_0282861 3300046506 Bacteria 661
321 Ga0495640_0152556 3300046533 Unclassified 1484
322 Ga0495634_0566665 3300046642 Bacteria 661
323 Ga0495634_0681506 3300046642 Bacteria 592
324 Ga0495657_0193791 3300046675 Bacteria 1241
325 Ga0495647_0067115 3300046681 Bacteria 1428
326 Ga0495658_0102744 3300046683 Bacteria 1708
327 Ga0495669_0004209 3300046684 Bacteria 5923
328 Ga0495613_0427248 3300046689 Bacteria 901
329 Ga0495613_0565677 3300046689 Bacteria 759
330 Ga0495604_0400792 3300047317 Bacteria 904
331 Ga0495680_0602969 3300047322 Unclassified 735
332 Ga0495684_0520916 3300047471 Bacteria 814
333 Ga0495614_0645735 3300048089 Bacteria 510
334 Ga0496100_0006897 3300048903 Bacteria 6220
335 Ga0496101_0000685 3300048904 Bacteria 20428
336 Ga0496102_0715840 3300048905 Unclassified 924
337 Ga0496104_0214743 3300048907 Bacteria 1835
338 Ga0496105_0042435 3300048908 Bacteria 3750
339 Ga0496105_0580282 3300048908 Bacteria 872
340 Ga0496105_0781714 3300048908 Bacteria 727
341 Ga0496106_0035820 3300048909 Unclassified 3711
342 Ga0496107_0236747 3300048910 Bacteria 1359
343 Ga0496108_0029582 3300048911 Bacteria 4538
344 Ga0496109_0446485 3300048912 Unclassified 1222
345 Ga0496111_0455302 3300048914 Bacteria 944
346 Ga0496112_0290751 3300048915 Bacteria 1580
347 Ga0496113_0050308 3300048916 Bacteria 3107
348 Ga0496114_0070631 3300048917 Bacteria 2933
349 Ga0496115_0054451 3300048918 Unclassified 3212
350 Ga0501034_0058013 3300049571 Bacteria 3892
351 Ga0501046_0663987 3300049580 Bacteria 736
352 Ga0501047_0234730 3300049581 Bacteria 1686
353 Ga0501067_0644193 3300049583 Unclassified 595
354 Ga0501206_104681 3300049653 Unclassified 517
355 Ga0501209_164061 3300049656 Bacteria 673
356 nmdc:mga05p37_237511_c1 3300050507 Bacteria 2193
357 nmdc:mga08y16_77833_c1 3300050511 Bacteria 3458
358 nmdc:mga0n895_1874085_c1 3300050512 Unclassified 559
359 nmdc:mga0rr50_119160_c1 3300050513 Bacteria 2098
360 nmdc:mga0a205_1063731_c1 3300050515 Unclassified 656
361 nmdc:mga0a205_1451642_c1 3300050515 Unclassified 534
362 nmdc:mga0a205_176397_c1 3300050515 Bacteria 2032
363 Ga0495619_0616249 3300053085 Bacteria 742
364 Ga0495619_0659055 3300053085 Bacteria 713
365 Ga0501082_0093011 3300060353 Bacteria 2605
366 Ga0068868_102256752
367 Ga0065712_10331023
368 Ga0065715_10864754
369 Ga0070683_100833008
370 Ga0070683_101552800
371 Ga0070690_100042976
372 Ga0068869_100132249
373 Ga0068869_100276172
374 Ga0068869_100523367
375 Ga0068869_100712649
376 Ga0070666_10078580
377 Ga0070666_10129381
378 Ga0070680_100322182
379 Ga0068868_100026392
380 Ga0068868_100032766
381 Ga0068868_100066126
382 Ga0070660_100047434
383 Ga0070687_100162873
384 Ga0070687_100722876
385 Ga0070661_100944336
386 Ga0070692_10151801
387 Ga0070692_10183953
388 Ga0070692_10898573
389 Ga0070668_100425381
390 Ga0070671_100292192
391 Ga0070674_100159166
392 Ga0070674_100555966
393 Ga0070673_100268312
394 Ga0070673_100810753
395 Ga0070659_100787665
396 Ga0070659_100898157
397 Ga0070667_100992840
398 Ga0070709_10024089
399 Ga0070713_101086216
400 Ga0070713_101182339
401 Ga0070713_102379452
402 Ga0070710_10752364
403 Ga0070701_11201513
404 Ga0070711_100089474
405 Ga0070678_100169209
406 Ga0070678_100956004
407 Ga0070681_10164903
408 Ga0070681_10735270
409 Ga0068867_100564229
410 Ga0068867_102329137
411 Ga0070706_100528098
412 Ga0070706_101051187
413 Ga0070698_102051266
414 Ga0070699_100485902
415 Ga0070699_100974803
416 Ga0070679_100025569
417 Ga0070684_100096267
418 Ga0070684_100306279
419 Ga0070697_101390596
420 Ga0070697_102043505
421 Ga0068853_100895517
422 Ga0070686_100399641
423 Ga0070686_101019031
424 Ga0070695_100078353
425 Ga0070696_100386310
426 Ga0070693_100497957
427 Ga0070693_101042464
428 Ga0070693_101221375
429 Ga0070665_100015165
430 Ga0070665_100041743
431 Ga0070665_101766802
432 Ga0070665_102323965
433 Ga0070704_100087483
434 Ga0068855_100056873
435 Ga0070664_100189963
436 Ga0070664_100394807
437 Ga0070664_101191906
438 Ga0068854_101179560
439 Ga0068854_101359284
440 Ga0068856_100183623
441 Ga0068856_100330817
442 Ga0070702_100319838
443 Ga0070702_100765995
444 Ga0068852_101697715
445 Ga0068859_100805562
446 Ga0068859_100899682
447 Ga0068859_101012378
448 Ga0068859_101752331
449 Ga0068864_100399533
450 Ga0068866_10140611
451 Ga0068866_10522707
452 Ga0068861_100048884
453 Ga0068861_101081870
454 Ga0068861_101972947
455 Ga0068863_100166615
456 Ga0068863_101199096
457 Ga0068863_102074611
458 Ga0068858_100087997
459 Ga0068858_100315168
460 Ga0068858_100496510
461 Ga0068858_100890160
462 Ga0068860_100102734
463 Ga0068860_100167932
464 Ga0068860_100290485
465 Ga0068860_101345424
466 Ga0068860_101901145
467 Ga0068862_100512739
468 Ga0068862_101028293
469 Ga0081455_10163476
470 Ga0070715_10410216
471 Ga0097621_100009469
472 Ga0097621_100019257
473 Ga0097621_100050539
474 Ga0097621_100128046
475 Ga0097621_100319877
476 Ga0097621_100638224
477 Ga0068871_100012578
478 Ga0068871_100138556
479 Ga0068871_100152085
480 Ga0068871_100412043
481 Ga0075434_100308552
482 Ga0068865_100123519
483 Ga0068865_100172490
484 Ga0068865_100830914
485 Ga0097620_100805385
486 Ga0097620_100899585
487 Ga0097620_101012326
488 Ga0097620_101752221
489 Ga0075435_100254981
490 Ga0099795_10369669
491 Ga0105240_10831826
492 Ga0111539_10138436
493 Ga0111539_12853485
494 Ga0105245_10022013
495 Ga0105245_10066504
496 Ga0105245_10362095
497 Ga0105245_10446053
498 Ga0105245_10717174
499 Ga0105247_10122447
500 Ga0105247_10387910
501 Ga0105247_11192906
502 Ga0114129_10416531
503 Ga0105243_11108025
504 Ga0105243_11537655
505 Ga0105243_11745292
506 Ga0105243_11963193
507 Ga0105243_12057622
508 Ga0105241_10722973
509 Ga0105242_10033222
510 Ga0105242_10350803
511 Ga0105242_10420569
512 Ga0105248_10018733
513 Ga0105248_10080028
514 Ga0105248_10129315
515 Ga0105248_10290401
516 Ga0105248_10448354
517 Ga0105248_10750909
518 Ga0105248_10756902
519 Ga0105248_11049306
520 Ga0105248_11155543
521 Ga0105248_13169168
522 Ga0105249_10583517
523 Ga0105246_11337581
524 Ga0105246_11508728
525 Ga0157370_10213507
526 Ga0157370_10342098
527 Ga0157374_10055972
528 Ga0157374_10118383
529 Ga0157374_10405290
530 Ga0157378_10012898
531 Ga0157378_10158655
532 Ga0157378_11634449
533 Ga0157378_13196581
534 Ga0163162_10059743
535 Ga0163162_12386568
536 Ga0157372_11690456
537 Ga0157375_10118016
538 Ga0157375_10812169
539 Ga0163163_11298944
540 Ga0163163_12405279
541 Ga0163163_12622209
542 Ga0163163_12926582
543 Ga0157379_10359214
544 Ga0157379_10638930
545 Ga0157376_10033860
546 Ga0157376_10860186
547 Ga0157376_11057407
548 Ga0157376_12601980
549 Ga0157376_12762739
550 Ga0163161_10536590
551 Ga0213876_10131468
552 Ga0207642_10067632
553 Ga0207642_10094046
554 Ga0207685_10052116
555 Ga0207699_10093978
556 Ga0207645_10722864
557 Ga0207705_10395434
558 Ga0207684_10852926
559 Ga0207707_10169319
560 Ga0207707_10178483
561 Ga0207707_11302699
562 Ga0207695_10048861
563 Ga0207663_10140509
564 Ga0207660_10074498
565 Ga0207662_10887769
566 Ga0207657_10003281
567 Ga0207652_10018100
568 Ga0207652_10176041
569 Ga0207652_10968707
570 Ga0207694_11740968
571 Ga0207650_11665936
572 Ga0207659_11451618
573 Ga0207687_10027291
574 Ga0207687_10284318
575 Ga0207700_10381820
576 Ga0207644_10300324
577 Ga0207644_10449796
578 Ga0207644_11162431
579 Ga0207690_10587978
580 Ga0207686_10281797
581 Ga0207709_11001027
582 Ga0207709_11436198
583 Ga0207709_11740170
584 Ga0207669_10500159
585 Ga0207704_10939360
586 Ga0207691_10298670
587 Ga0207711_10119305
588 Ga0207711_10179790
589 Ga0207711_10250562
590 Ga0207711_10307647
591 Ga0207711_10371208
592 Ga0207711_10735297
593 Ga0207711_10841489
594 Ga0207689_10162115
595 Ga0207689_10190306
596 Ga0207689_10263856
597 Ga0207689_10886308
598 Ga0207661_11350623
599 Ga0207679_10278303
600 Ga0207679_10570561
601 Ga0207667_10049222
602 Ga0207667_10827466
603 Ga0207651_10199973
604 Ga0207651_10212342
605 Ga0207712_10417142
606 Ga0207712_10512893
607 Ga0207712_11156791
608 Ga0207668_11116510
609 Ga0207640_10184980
610 Ga0207658_10981723
611 Ga0207658_11609726
612 Ga0207677_10090348
613 Ga0207677_11029422
614 Ga0207677_11527269
615 Ga0207703_10211220
616 Ga0207703_10692878
617 Ga0207703_10786383
618 Ga0207703_10883173
619 Ga0207702_10073067
620 Ga0207702_10583350
621 Ga0207641_10262667
622 Ga0207641_11162040
623 Ga0207648_10121109
624 Ga0207648_10562586
625 Ga0207648_11985409
626 Ga0207676_10257993
627 Ga0207675_100015362
628 Ga0207675_100251996
629 Ga0207675_100322052
630 Ga0207675_101413031
631 Ga0207683_10130767
632 Ga0207683_10194876
633 Ga0207698_11187555
634 Ga0209179_1143636
635 Ga0268265_10264967
636 Ga0268265_11468714
637 Ga0268264_10068390
638 Ga0268264_11054799
639 Ga0268264_11243429
640 Ga0307405_10028455
641 Ga0307413_10007543
642 Ga0307410_10007289
643 Ga0307406_10054777
644 Ga0307407_10376415
645 Ga0307409_100113622
646 Ga0307416_100055963
647 Ga0307414_10081935
648 Ga0307411_10006794
649 Ga0307415_100374775
650 Ga0373948_0097505
651 Ga0373950_0000159
652 Ga0373959_0000541
653 Ga0373938_0004574
654 Ga0373926_0194185
655 Ga0373928_0002211
656 Ga0373929_0004761
657 Ga0373940_0007925
658 Ga0373949_0006579
659 Ga0373951_0002807
660 Ga0373923_0285589
661 Ga0373936_0067104
662 Ga0373939_0015537
663 Ga0373941_0000527
664 Ga0373956_0082436
665 Ga0373960_0022915
666 Ga0373943_0005334
667 Ga0373943_0309953
668 Ga0373946_0016837
669 Ga0373955_0017868
670 Ga0373955_0139642
671 Ga0373942_0000705
672 Ga0373961_0005082
673 Ga0373962_0001142
674 Ga0373935_0059293
675 Ga0373933_0080287
676 Ga0373937_0155532
677 Ga0373937_0805596
678 Ga0373925_0019711
679 Ga0436365_0574438
680 Ga0436365_1166966
681 Ga0495592_0903713
682 Ga0495629_0163073
683 Ga0495582_0231063
684 Ga0495582_0845290
685 Ga0495583_0282861
686 Ga0495640_0152556
687 Ga0495634_0566665
688 Ga0495634_0681506
689 Ga0495657_0193791
690 Ga0495647_0067115
691 Ga0495658_0102744
692 Ga0495669_0004209
693 Ga0495613_0427248
694 Ga0495613_0565677
695 Ga0495604_0400792
696 Ga0495680_0602969
697 Ga0495684_0520916
698 Ga0495614_0645735
699 Ga0496100_0006897
700 Ga0496101_0000685
701 Ga0496102_0715840
702 Ga0496104_0214743
703 Ga0496105_0042435
704 Ga0496105_0580282
705 Ga0496105_0781714
706 Ga0496106_0035820
707 Ga0496107_0236747
708 Ga0496108_0029582
709 Ga0496109_0446485
710 Ga0496111_0455302
711 Ga0496112_0290751
712 Ga0496113_0050308
713 Ga0496114_0070631
714 Ga0496115_0054451
715 Ga0501034_0058013
716 Ga0501046_0663987
717 Ga0501047_0234730
718 Ga0501067_0644193
719 Ga0501206_104681
720 Ga0501209_164061
721 nmdc:mga05p37_237511_c1
722 nmdc:mga08y16_77833_c1
723 nmdc:mga0n895_1874085_c1
724 nmdc:mga0rr50_119160_c1
725 nmdc:mga0a205_1063731_c1
726 nmdc:mga0a205_1451642_c1
727 nmdc:mga0a205_176397_c1
728 Ga0495619_0616249
729 Ga0495619_0659055
730 Ga0501082_0093011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01491

Frataxin_Cyay

Frataxin-like domain

27

130

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z1p-assembly1.cif.gz_BR structure of the mitochondrial ribosome from tetrahymena thermophila 0.827 6 102
6fco-assembly2.cif.gz_B structural and functional characterisation of frataxin (fxn) like protein from chaetomium thermophilum 0.8217 1 101
3t3l-assembly1.cif.gz_A 1.15 a structure of human frataxin variant q153a 0.8159 4 106
3t3k-assembly1.cif.gz_A 1.24 a structure of friedreich's ataxia frataxin variant q148r 0.8078 3 106
6fco-assembly1.cif.gz_D structural and functional characterisation of frataxin (fxn) like protein from chaetomium thermophilum 0.8075 1 101
ID Description Score Start End Superfamily
6fcoB00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.8217 1 101 3.30.920.10
af_I1JK59_72_191_3.30.920.10 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.8174 4 106 3.30.920.10
af_Q07540_63_174_3.30.920.10 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.8155 4 105 3.30.920.10
af_Q54C45_74_193_3.30.920.10 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.8041 1 106 3.30.920.10
af_Q54C45_74_193_3.30.920.10 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.7975 1 106 3.30.920.10
ID Description Score Start End GO Terms
AF-A0A1F2SFF9-F1-model_v4 Iron donor protein CyaY 1.001 5 105 GO:0005737
GO:0008199
GO:0016226
AF-A0A7Y4WDA4-F1-model_v4 Iron donor protein CyaY 0.9891 3 106 GO:0005737
GO:0008199
GO:0016226
AF-A0A7Y4WDA4-F1-model_v4 Iron donor protein CyaY 0.9796 3 106 GO:0005737
GO:0008199
GO:0016226
AF-A0A1Q7K710-F1-model_v4 Iron donor protein CyaY 0.9501 3 88 GO:0005737
GO:0008199
GO:0016226
AF-A0A2V9BXV0-F1-model_v4 Iron donor protein CyaY 0.9495 5 106 GO:0005737
GO:0008199
GO:0016226

Map