F423473

General Info

Members Datasets Scaffolds Average Seq Length
364 229 728 163

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0703526|Ga0501071_0703526_161_718
Length 185
Sequence MLTVLPHSRCASAAERQKEKTAVLQFTMSSLAGEDIDLARYQGQVLLIVNVASACGYTPQYKGLQALHAKYAAQGFAVLGFPCNQFGQQEPGSAAQIATFCEQRYGVTFPMFAKEDVNGPRQCALYQHLTAQPTQPAPAGPIQWNFEKFLLARDGTVVARFRSHVAPESAQLVESIERELAKPAP

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
124 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
127 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
128 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
129 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
130 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
131 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
132 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
133 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
206 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
214 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
215 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
216 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
219 2547132424 Nocardia nova SH22a Isolate Unclassified
220 2643221692 Nocardia sp. Root136 Isolate Unclassified
221 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
222 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
223 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
224 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
225 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
226 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
227 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
228 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
229 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.7
Metatranscriptomes 0.27
Isolates 3.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.79
Nodule 0.27
Rhizoplane 12.36
Rhizosphere 70.05
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0703526 3300049587 Bacteria 778
2 JGI24751J29686_10010461 3300002459 Bacteria 1912
3 Ga0070683_100304928 3300005329 Bacteria 1515
4 Ga0070683_100815073 3300005329 Bacteria 895
5 Ga0068868_100220663 3300005338 Bacteria 1587
6 Ga0068868_100769322 3300005338 Bacteria 866
7 Ga0070660_100215156 3300005339 Bacteria 1561
8 Ga0070689_100884286 3300005340 Bacteria 790
9 Ga0070687_100485360 3300005343 Bacteria 829
10 Ga0070668_100210071 3300005347 Bacteria 1601
11 Ga0070669_100005981 3300005353 Bacteria 8779
12 Ga0070671_100000923 3300005355 Bacteria 21454
13 Ga0070674_100339681 3300005356 Bacteria 1209
14 Ga0070688_100091829 3300005365 Bacteria 1985
15 Ga0070659_101373602 3300005366 Bacteria 627
16 Ga0070667_100000535 3300005367 Bacteria 37853
17 Ga0070667_100034855 3300005367 Bacteria 4213
18 Ga0070667_100117804 3300005367 Bacteria 2307
19 Ga0070667_100765597 3300005367 Bacteria 895
20 Ga0070667_101681222 3300005367 Bacteria 597
21 Ga0070703_10266479 3300005406 Bacteria 701
22 Ga0070709_10044945 3300005434 Bacteria 2738
23 Ga0070709_10680476 3300005434 Bacteria 799
24 Ga0070710_10330354 3300005437 Bacteria 1004
25 Ga0070711_100051705 3300005439 Bacteria 2823
26 Ga0070663_100021756 3300005455 Bacteria 4272
27 Ga0070678_101151589 3300005456 Bacteria 718
28 Ga0070662_100163919 3300005457 Bacteria 1740
29 Ga0070684_100260416 3300005535 Bacteria 1587
30 Ga0068853_100191254 3300005539 Bacteria 1859
31 Ga0070686_100096902 3300005544 Bacteria 1985
32 Ga0070696_100009364 3300005546 Bacteria 6557
33 Ga0070693_100021074 3300005547 Bacteria 3448
34 Ga0070665_100039556 3300005548 Bacteria 4741
35 Ga0070665_100107369 3300005548 Bacteria 2794
36 Ga0070665_100716216 3300005548 Bacteria 1014
37 Ga0070665_100723877 3300005548 Bacteria 1008
38 Ga0070704_100562767 3300005549 Bacteria 997
39 Ga0070664_100188835 3300005564 Bacteria 1835
40 Ga0070702_100068518 3300005615 Bacteria 2088
41 Ga0068852_100133736 3300005616 Bacteria 2287
42 Ga0068852_100934184 3300005616 Bacteria 885
43 Ga0068859_100001716 3300005617 Bacteria 22359
44 Ga0068859_100174277 3300005617 Bacteria 2233
45 Ga0068859_100229941 3300005617 Bacteria 1942
46 Ga0068864_100414935 3300005618 Bacteria 1282
47 Ga0068866_10066913 3300005718 Bacteria 1884
48 Ga0068861_100429531 3300005719 Bacteria 1179
49 Ga0068870_10042804 3300005840 Bacteria 2359
50 Ga0068863_100000143 3300005841 Bacteria 75127
51 Ga0068863_100046189 3300005841 Bacteria 4133
52 Ga0068858_100004006 3300005842 Bacteria 14538
53 Ga0068858_100208351 3300005842 Bacteria 1850
54 Ga0068858_100278901 3300005842 Bacteria 1591
55 Ga0068858_101232097 3300005842 Bacteria 736
56 Ga0068860_100000079 3300005843 Bacteria 170752
57 Ga0068862_100000093 3300005844 Bacteria 106838
58 Ga0081455_10091834 3300005937 Bacteria 2458
59 Ga0075365_10055957 3300006038 Bacteria 2621
60 Ga0075363_100008264 3300006048 Bacteria 4838
61 Ga0075363_100022236 3300006048 Bacteria 3205
62 Ga0075363_100040567 3300006048 Bacteria 2454
63 Ga0075363_100063201 3300006048 Bacteria 1997
64 Ga0075363_100549997 3300006048 Bacteria 689
65 Ga0075364_10005466 3300006051 Bacteria 7386
66 Ga0075432_10118603 3300006058 Bacteria 992
67 Ga0075432_10195088 3300006058 Bacteria 799
68 Ga0070715_10033821 3300006163 Bacteria 2092
69 Ga0070716_100006495 3300006173 Bacteria 5714
70 Ga0070712_100010036 3300006175 Bacteria 5969
71 Ga0075362_10019583 3300006177 Bacteria 2817
72 Ga0075369_10000029 3300006186 Bacteria 39213
73 Ga0075369_10015259 3300006186 Bacteria 3081
74 Ga0075369_10080151 3300006186 Bacteria 1447
75 Ga0075370_10015782 3300006353 Bacteria 4052
76 Ga0075370_10040986 3300006353 Bacteria 2613
77 Ga0075370_10612589 3300006353 Bacteria 660
78 Ga0075430_100089275 3300006846 Bacteria 2579
79 Ga0097620_100001716 3300006931 Bacteria 22359
80 Ga0097620_100174281 3300006931 Bacteria 2233
81 Ga0097620_100229951 3300006931 Bacteria 1942
82 Ga0105251_10364058 3300009011 Bacteria 661
83 Ga0105240_11180242 3300009093 Bacteria 811
84 Ga0105245_10482957 3300009098 Bacteria 1253
85 Ga0105247_10001633 3300009101 Bacteria 15845
86 Ga0105247_10500241 3300009101 Bacteria 885
87 Ga0105243_10559854 3300009148 Bacteria 1094
88 Ga0105241_10170691 3300009174 Bacteria 1796
89 Ga0105242_10810787 3300009176 Bacteria 927
90 Ga0105248_10000641 3300009177 Bacteria 39742
91 Ga0105248_10223925 3300009177 Bacteria 2117
92 Ga0105248_10429705 3300009177 Bacteria 1487
93 Ga0105248_10729095 3300009177 Bacteria 1118
94 Ga0105249_10000049 3300009553 Bacteria 169899
95 Ga0099796_10078789 3300010159 Bacteria 1204
96 Ga0105239_12058203 3300010375 Bacteria 663
97 Ga0157369_10368288 3300013105 Bacteria 1492
98 Ga0157378_10021567 3300013297 Bacteria 5665
99 Ga0163162_10218931 3300013306 Bacteria 2034
100 Ga0163162_10464404 3300013306 Bacteria 1397
101 Ga0163162_10560677 3300013306 Bacteria 1270
102 Ga0157375_11493747 3300013308 Bacteria 797
103 Ga0157375_12129734 3300013308 Bacteria 668
104 Ga0163163_10119943 3300014325 Bacteria 2663
105 Ga0163163_10146429 3300014325 Bacteria 2406
106 Ga0163163_10192510 3300014325 Bacteria 2088
107 Ga0163163_10452348 3300014325 Bacteria 1344
108 Ga0163163_12505770 3300014325 Bacteria 574
109 Ga0157380_10355191 3300014326 Bacteria 1373
110 Ga0157377_10348226 3300014745 Bacteria 993
111 Ga0157379_10003299 3300014968 Bacteria 13654
112 Ga0157379_10130568 3300014968 Bacteria 2261
113 Ga0157376_11071454 3300014969 Bacteria 831
114 Ga0163161_11659045 3300017792 Bacteria 565
115 Ga0206352_11315392 3300020078 Bacteria 525
116 Ga0213876_10015330 3300021384 Bacteria 4058
117 Ga0209673_1042076 3300025273 Bacteria 1288
118 Ga0207642_10039317 3300025899 Bacteria 2054
119 Ga0207710_10000908 3300025900 Bacteria 15831
120 Ga0207699_10018712 3300025906 Bacteria 3677
121 Ga0207643_10033643 3300025908 Bacteria 2869
122 Ga0207643_10744927 3300025908 Bacteria 634
123 Ga0207671_10191419 3300025914 Bacteria 1595
124 Ga0207693_10000771 3300025915 Bacteria 28766
125 Ga0207663_10453632 3300025916 Bacteria 989
126 Ga0207662_10210476 3300025918 Bacteria 1262
127 Ga0207681_10020521 3300025923 Bacteria 4189
128 Ga0207687_10323224 3300025927 Bacteria 1250
129 Ga0207664_10430719 3300025929 Bacteria 1176
130 Ga0207644_10043133 3300025931 Bacteria 3200
131 Ga0207690_11166502 3300025932 Bacteria 643
132 Ga0207706_10054084 3300025933 Bacteria 3543
133 Ga0207686_10210790 3300025934 Bacteria 1397
134 Ga0207670_10433342 3300025936 Bacteria 1057
135 Ga0207669_11161948 3300025937 Bacteria 653
136 Ga0207704_10358848 3300025938 Bacteria 1137
137 Ga0207665_10002506 3300025939 Bacteria 12363
138 Ga0207711_10002851 3300025941 Bacteria 15167
139 Ga0207711_10274485 3300025941 Bacteria 1552
140 Ga0207661_10815114 3300025944 Bacteria 859
141 Ga0207679_10175489 3300025945 Bacteria 1768
142 Ga0207651_10437842 3300025960 Bacteria 1119
143 Ga0207712_10000038 3300025961 Bacteria 192762
144 Ga0207712_10380013 3300025961 Bacteria 1182
145 Ga0207668_10034076 3300025972 Bacteria 3379
146 Ga0207668_10172380 3300025972 Bacteria 1698
147 Ga0207668_10427754 3300025972 Bacteria 1125
148 Ga0207658_10002028 3300025986 Bacteria 15117
149 Ga0207658_10071799 3300025986 Bacteria 2622
150 Ga0207658_10258780 3300025986 Bacteria 1482
151 Ga0207677_10154907 3300026023 Bacteria 1773
152 Ga0207703_10047588 3300026035 Bacteria 3458
153 Ga0207703_10089322 3300026035 Bacteria 2588
154 Ga0207703_10703885 3300026035 Bacteria 961
155 Ga0207703_11104183 3300026035 Bacteria 762
156 Ga0207678_10013351 3300026067 Bacteria 7209
157 Ga0207708_10061648 3300026075 Bacteria 2864
158 Ga0207641_10000232 3300026088 Bacteria 71885
159 Ga0207641_10192423 3300026088 Bacteria 1875
160 Ga0207641_10997840 3300026088 Bacteria 834
161 Ga0207676_10259657 3300026095 Bacteria 1568
162 Ga0207698_10026087 3300026142 Bacteria 4129
163 Ga0207698_10249878 3300026142 Bacteria 1622
164 Ga0209179_1058808 3300027512 Bacteria 832
165 Ga0268266_10006941 3300028379 Bacteria 10300
166 Ga0268266_10022186 3300028379 Bacteria 5411
167 Ga0268265_10000053 3300028380 Bacteria 170215
168 Ga0268264_10000017 3300028381 Bacteria 498037
169 Ga0268264_11427480 3300028381 Bacteria 703
170 Ga0307413_10118465 3300031824 Bacteria 1788
171 Ga0307410_10537214 3300031852 Bacteria 967
172 Ga0307406_10247243 3300031901 Bacteria 1341
173 Ga0373961_0073017 3300035241 Bacteria 1065
174 Ga0316584_0084040 3300036712 Bacteria 2384
175 Ga0395905_0632697 3300037471 Bacteria 972
176 Ga0436364_1385689 3300037853 Bacteria 7516
177 Ga0436365_1317629 3300039437 Bacteria 6173
178 Ga0439461_0007220 3300041410 Bacteria 1960
179 Ga0439466_0020617 3300041411 Bacteria 2347
180 Ga0439465_0001890 3300041413 Bacteria 6858
181 Ga0451795_0183277 3300041456 Bacteria 1070
182 Ga0451835_0338568 3300041492 Bacteria 742
183 Ga0451851_0035895 3300041507 Bacteria 791
184 Ga0451843_1458389 3300041509 Bacteria 1062
185 Ga0439431_0000474 3300041997 Bacteria 8514
186 Ga0439434_0034004 3300042435 Bacteria 1556
187 Ga0439435_0067652 3300042436 Bacteria 1052
188 Ga0466972_0029543 3300044658 Bacteria 2699
189 Ga0466972_0087140 3300044658 Bacteria 1483
190 Ga0466972_0108762 3300044658 Bacteria 1310
191 Ga0466972_0220986 3300044658 Bacteria 886
192 Ga0466972_0277321 3300044658 Bacteria 783
193 Ga0466965_0126208 3300044683 Bacteria 1324
194 Ga0466965_0316972 3300044683 Bacteria 849
195 Ga0466966_0065050 3300044684 Bacteria 2294
196 Ga0466966_0080325 3300044684 Bacteria 2031
197 Ga0466961_0016299 3300044693 Bacteria 4772
198 Ga0466963_0037283 3300044694 Bacteria 3173
199 Ga0466963_0149204 3300044694 Bacteria 1623
200 Ga0466963_0190795 3300044694 Bacteria 1431
201 Ga0466968_0015206 3300044735 Bacteria 3047
202 Ga0466968_0026654 3300044735 Bacteria 2374
203 Ga0466968_0089099 3300044735 Bacteria 1365
204 Ga0466968_0453057 3300044735 Bacteria 635
205 Ga0466957_0180546 3300044842 Bacteria 1378
206 Ga0466960_0051492 3300044901 Bacteria 1989
207 Ga0466960_0229993 3300044901 Bacteria 1023
208 Ga0466959_0194763 3300045049 Bacteria 1413
209 Ga0466958_0013110 3300045836 Bacteria 4712
210 Ga0466958_0082456 3300045836 Bacteria 1981
211 Ga0466967_0008716 3300045976 Bacteria 7468
212 Ga0466967_0322606 3300045976 Bacteria 1490
213 Ga0466967_0506615 3300045976 Bacteria 1185
214 Ga0466967_0519456 3300045976 Bacteria 1170
215 Ga0466967_1666654 3300045976 Bacteria 635
216 Ga0495629_0040272 3300046459 Bacteria 3287
217 Ga0495638_0008416 3300046460 Bacteria 7317
218 Ga0495641_0027228 3300046461 Bacteria 2782
219 Ga0495582_0120795 3300046473 Bacteria 1476
220 Ga0495662_0075464 3300046476 Bacteria 1636
221 Ga0495594_0059010 3300046499 Bacteria 2121
222 Ga0495630_0273459 3300046517 Bacteria 1291
223 Ga0495666_0114731 3300046526 Bacteria 1264
224 Ga0495665_0071847 3300046531 Bacteria 1822
225 Ga0495640_0021572 3300046533 Bacteria 4726
226 Ga0495668_0668130 3300046616 Bacteria 574
227 Ga0495647_0121384 3300046681 Bacteria 1099
228 Ga0495671_0430681 3300046692 Bacteria 631
229 Ga0495649_0175013 3300046694 Bacteria 1122
230 Ga0495649_0401146 3300046694 Bacteria 688
231 Ga0495581_0039376 3300047315 Bacteria 2736
232 Ga0495676_0509807 3300047321 Bacteria 789
233 Ga0495593_0006211 3300047673 Bacteria 7024
234 Ga0496100_0037765 3300048903 Bacteria 3056
235 Ga0496100_0053285 3300048903 Bacteria 2634
236 Ga0496100_0242678 3300048903 Bacteria 1330
237 Ga0496101_0057413 3300048904 Bacteria 2815
238 Ga0496101_0080032 3300048904 Bacteria 2413
239 Ga0496102_0000559 3300048905 Bacteria 39807
240 Ga0496102_0002030 3300048905 Bacteria 17497
241 Ga0496102_0109017 3300048905 Bacteria 2579
242 Ga0496102_0126813 3300048905 Bacteria 2386
243 Ga0496102_0178709 3300048905 Bacteria 1999
244 Ga0496102_0195549 3300048905 Bacteria 1906
245 Ga0496103_0000556 3300048906 Bacteria 29725
246 Ga0496103_0128564 3300048906 Bacteria 1617
247 Ga0496103_0522935 3300048906 Bacteria 758
248 Ga0496104_0015016 3300048907 Bacteria 7006
249 Ga0496104_0128056 3300048907 Bacteria 2438
250 Ga0496104_0368541 3300048907 Bacteria 1349
251 Ga0496105_0060505 3300048908 Bacteria 3125
252 Ga0496105_0068811 3300048908 Bacteria 2925
253 Ga0496106_0029597 3300048909 Bacteria 4082
254 Ga0496106_0221819 3300048909 Bacteria 1508
255 Ga0496106_0810996 3300048909 Bacteria 742
256 Ga0496107_0015782 3300048910 Bacteria 5298
257 Ga0496107_0473571 3300048910 Bacteria 930
258 Ga0496107_0496674 3300048910 Bacteria 905
259 Ga0496108_0108755 3300048911 Bacteria 2368
260 Ga0496108_0193960 3300048911 Bacteria 1761
261 Ga0496109_0316934 3300048912 Bacteria 1471
262 Ga0496109_0412840 3300048912 Bacteria 1275
263 Ga0496110_0136439 3300048913 Bacteria 2217
264 Ga0496110_0586094 3300048913 Bacteria 1012
265 Ga0496111_0024563 3300048914 Bacteria 4245
266 Ga0496111_0118958 3300048914 Bacteria 1951
267 Ga0496112_0018109 3300048915 Bacteria 6628
268 Ga0496112_0027671 3300048915 Bacteria 5468
269 Ga0496112_0043063 3300048915 Bacteria 4419
270 Ga0496112_0067639 3300048915 Bacteria 3526
271 Ga0496112_0104996 3300048915 Bacteria 2795
272 Ga0496113_0004760 3300048916 Bacteria 8381
273 Ga0496113_0064720 3300048916 Bacteria 2765
274 Ga0496114_0044517 3300048917 Bacteria 3682
275 Ga0496114_0151301 3300048917 Bacteria 2013
276 Ga0496114_0155258 3300048917 Bacteria 1987
277 Ga0496114_0595744 3300048917 Bacteria 975
278 Ga0496117_0005020 3300048920 Bacteria 14189
279 Ga0496117_0051211 3300048920 Bacteria 2921
280 Ga0496118_0000358 3300048921 Bacteria 77310
281 Ga0496118_0004348 3300048921 Bacteria 16865
282 Ga0496119_0014096 3300048922 Bacteria 6290
283 Ga0496119_0126781 3300048922 Bacteria 1396
284 Ga0496120_0013454 3300048923 Bacteria 5506
285 Ga0496122_0126287 3300048925 Bacteria 1636
286 Ga0496123_0028948 3300048926 Bacteria 4089
287 Ga0496124_0100782 3300048927 Bacteria 2340
288 Ga0496124_0526828 3300048927 Bacteria 786
289 Ga0496125_0107958 3300048928 Bacteria 2026
290 Ga0496125_0153501 3300048928 Bacteria 1577
291 Ga0496126_0010778 3300048929 Bacteria 9544
292 Ga0496126_0019389 3300048929 Bacteria 6699
293 Ga0496126_0071532 3300048929 Bacteria 3087
294 Ga0501032_0012850 3300049569 Bacteria 5968
295 Ga0501032_0109948 3300049569 Bacteria 1824
296 Ga0501033_0060871 3300049570 Bacteria 2784
297 Ga0501034_0008577 3300049571 Bacteria 10786
298 Ga0501034_0018580 3300049571 Bacteria 7126
299 Ga0501034_0104716 3300049571 Bacteria 2822
300 Ga0501034_0821498 3300049571 Bacteria 821
301 Ga0501036_0001872 3300049572 Bacteria 16318
302 Ga0501036_0195475 3300049572 Bacteria 1702
303 Ga0501036_1016928 3300049572 Bacteria 678
304 Ga0501037_0000401 3300049573 Bacteria 36095
305 Ga0501037_0103972 3300049573 Bacteria 2048
306 Ga0501038_0007683 3300049574 Bacteria 9941
307 Ga0501038_0346664 3300049574 Bacteria 1157
308 Ga0501039_0003187 3300049575 Bacteria 12267
309 Ga0501043_0001795 3300049579 Bacteria 18430
310 Ga0501043_0154593 3300049579 Bacteria 1794
311 Ga0501046_0024756 3300049580 Bacteria 4919
312 Ga0501046_0034456 3300049580 Bacteria 4085
313 Ga0501047_0030000 3300049581 Bacteria 5243
314 Ga0501047_0298382 3300049581 Bacteria 1454
315 Ga0501048_0018568 3300049582 Bacteria 5112
316 Ga0501048_0254885 3300049582 Bacteria 1246
317 Ga0501068_0092201 3300049584 Bacteria 1870
318 Ga0501068_0319297 3300049584 Bacteria 995
319 Ga0501069_0250982 3300049585 Bacteria 1032
320 Ga0501069_0448725 3300049585 Bacteria 766
321 Ga0501070_0012220 3300049586 Bacteria 7244
322 Ga0501070_0033974 3300049586 Bacteria 4266
323 Ga0501071_0933669 3300049587 Bacteria 670
324 Ga0501073_0470629 3300049589 Bacteria 869
325 Ga0501074_0488361 3300049590 Bacteria 873
326 Ga0501076_0667913 3300049592 Unclassified 858
327 Ga0501076_0770255 3300049592 Bacteria 794
328 Ga0501080_0103035 3300049742 Bacteria 2647
329 Ga0501080_0469927 3300049742 Bacteria 1126
330 Ga0501035_0051098 3300049822 Bacteria 3702
331 Ga0501044_0005938 3300049823 Bacteria 13523
332 Ga0501044_0043957 3300049823 Bacteria 4639
333 Ga0501044_0141554 3300049823 Bacteria 2394
334 Ga0501044_0239293 3300049823 Bacteria 1759
335 nmdc:mga03683_1900_c1 3300050489 Bacteria 5668
336 nmdc:mga03n38_296917_c1 3300050490 Bacteria 867
337 nmdc:mga03n38_57560_c1 3300050490 Bacteria 1758
338 nmdc:mga00v17_258426_c1 3300050491 Bacteria 1130
339 nmdc:mga00v17_709_c1 3300050491 Bacteria 18242
340 nmdc:mga0yw44_115335_c1 3300050492 Bacteria 1725
341 nmdc:mga0yw44_133605_c1 3300050492 Bacteria 1608
342 nmdc:mga0yw44_8098_c1 3300050492 Bacteria 5218
343 nmdc:mga07m45_511871_c1 3300050496 Bacteria 695
344 nmdc:mga0qj67_72636_c1 3300050509 Bacteria 2747
345 nmdc:mga0sz30_338_c1 3300050516 Bacteria 17911
346 Ga0495601_0407408 3300053077 Bacteria 881
347 Ga0500635_0002395 3300053080 Bacteria 4641
348 Ga0500643_003262 3300053087 Bacteria 7902
349 Ga0500641_0047764 3300053096 Bacteria 1752
350 Ga0500652_000371 3300053131 Bacteria 16112
351 Ga0500616_0001132 3300053153 Bacteria 27437
352 Ga0500645_000056 3300053730 Bacteria 92126
353 Ga0500645_060051 3300053730 Bacteria 1100
354 2548692598 2547132424 Bacteria 8348532
355 2644514797 2643221692 Bacteria 7282860
356 2739328843 2738543028 Bacteria 6917070
357 2842139494 2842134933 Bacteria 5847019
358 2861524033 2861520306 Bacteria 8348283
359 2902804133 2902799365 Bacteria 5419524
360 2902814508 2902810491 Bacteria 6794147
361 2902839223 2902837492 Bacteria 6697721
362 2929217910 2929212328 Bacteria 7708288
363 3006327822 3006321560 Bacteria 8247479
364 8057572503 8057568493 Bacteria 7221719
365 Ga0501071_0703526
366 JGI24751J29686_10010461
367 Ga0070683_100304928
368 Ga0070683_100815073
369 Ga0068868_100220663
370 Ga0068868_100769322
371 Ga0070660_100215156
372 Ga0070689_100884286
373 Ga0070687_100485360
374 Ga0070668_100210071
375 Ga0070669_100005981
376 Ga0070671_100000923
377 Ga0070674_100339681
378 Ga0070688_100091829
379 Ga0070659_101373602
380 Ga0070667_100000535
381 Ga0070667_100034855
382 Ga0070667_100117804
383 Ga0070667_100765597
384 Ga0070667_101681222
385 Ga0070703_10266479
386 Ga0070709_10044945
387 Ga0070709_10680476
388 Ga0070710_10330354
389 Ga0070711_100051705
390 Ga0070663_100021756
391 Ga0070678_101151589
392 Ga0070662_100163919
393 Ga0070684_100260416
394 Ga0068853_100191254
395 Ga0070686_100096902
396 Ga0070696_100009364
397 Ga0070693_100021074
398 Ga0070665_100039556
399 Ga0070665_100107369
400 Ga0070665_100716216
401 Ga0070665_100723877
402 Ga0070704_100562767
403 Ga0070664_100188835
404 Ga0070702_100068518
405 Ga0068852_100133736
406 Ga0068852_100934184
407 Ga0068859_100001716
408 Ga0068859_100174277
409 Ga0068859_100229941
410 Ga0068864_100414935
411 Ga0068866_10066913
412 Ga0068861_100429531
413 Ga0068870_10042804
414 Ga0068863_100000143
415 Ga0068863_100046189
416 Ga0068858_100004006
417 Ga0068858_100208351
418 Ga0068858_100278901
419 Ga0068858_101232097
420 Ga0068860_100000079
421 Ga0068862_100000093
422 Ga0081455_10091834
423 Ga0075365_10055957
424 Ga0075363_100008264
425 Ga0075363_100022236
426 Ga0075363_100040567
427 Ga0075363_100063201
428 Ga0075363_100549997
429 Ga0075364_10005466
430 Ga0075432_10118603
431 Ga0075432_10195088
432 Ga0070715_10033821
433 Ga0070716_100006495
434 Ga0070712_100010036
435 Ga0075362_10019583
436 Ga0075369_10000029
437 Ga0075369_10015259
438 Ga0075369_10080151
439 Ga0075370_10015782
440 Ga0075370_10040986
441 Ga0075370_10612589
442 Ga0075430_100089275
443 Ga0097620_100001716
444 Ga0097620_100174281
445 Ga0097620_100229951
446 Ga0105251_10364058
447 Ga0105240_11180242
448 Ga0105245_10482957
449 Ga0105247_10001633
450 Ga0105247_10500241
451 Ga0105243_10559854
452 Ga0105241_10170691
453 Ga0105242_10810787
454 Ga0105248_10000641
455 Ga0105248_10223925
456 Ga0105248_10429705
457 Ga0105248_10729095
458 Ga0105249_10000049
459 Ga0099796_10078789
460 Ga0105239_12058203
461 Ga0157369_10368288
462 Ga0157378_10021567
463 Ga0163162_10218931
464 Ga0163162_10464404
465 Ga0163162_10560677
466 Ga0157375_11493747
467 Ga0157375_12129734
468 Ga0163163_10119943
469 Ga0163163_10146429
470 Ga0163163_10192510
471 Ga0163163_10452348
472 Ga0163163_12505770
473 Ga0157380_10355191
474 Ga0157377_10348226
475 Ga0157379_10003299
476 Ga0157379_10130568
477 Ga0157376_11071454
478 Ga0163161_11659045
479 Ga0206352_11315392
480 Ga0213876_10015330
481 Ga0209673_1042076
482 Ga0207642_10039317
483 Ga0207710_10000908
484 Ga0207699_10018712
485 Ga0207643_10033643
486 Ga0207643_10744927
487 Ga0207671_10191419
488 Ga0207693_10000771
489 Ga0207663_10453632
490 Ga0207662_10210476
491 Ga0207681_10020521
492 Ga0207687_10323224
493 Ga0207664_10430719
494 Ga0207644_10043133
495 Ga0207690_11166502
496 Ga0207706_10054084
497 Ga0207686_10210790
498 Ga0207670_10433342
499 Ga0207669_11161948
500 Ga0207704_10358848
501 Ga0207665_10002506
502 Ga0207711_10002851
503 Ga0207711_10274485
504 Ga0207661_10815114
505 Ga0207679_10175489
506 Ga0207651_10437842
507 Ga0207712_10000038
508 Ga0207712_10380013
509 Ga0207668_10034076
510 Ga0207668_10172380
511 Ga0207668_10427754
512 Ga0207658_10002028
513 Ga0207658_10071799
514 Ga0207658_10258780
515 Ga0207677_10154907
516 Ga0207703_10047588
517 Ga0207703_10089322
518 Ga0207703_10703885
519 Ga0207703_11104183
520 Ga0207678_10013351
521 Ga0207708_10061648
522 Ga0207641_10000232
523 Ga0207641_10192423
524 Ga0207641_10997840
525 Ga0207676_10259657
526 Ga0207698_10026087
527 Ga0207698_10249878
528 Ga0209179_1058808
529 Ga0268266_10006941
530 Ga0268266_10022186
531 Ga0268265_10000053
532 Ga0268264_10000017
533 Ga0268264_11427480
534 Ga0307413_10118465
535 Ga0307410_10537214
536 Ga0307406_10247243
537 Ga0373961_0073017
538 Ga0316584_0084040
539 Ga0395905_0632697
540 Ga0436364_1385689
541 Ga0436365_1317629
542 Ga0439461_0007220
543 Ga0439466_0020617
544 Ga0439465_0001890
545 Ga0451795_0183277
546 Ga0451835_0338568
547 Ga0451851_0035895
548 Ga0451843_1458389
549 Ga0439431_0000474
550 Ga0439434_0034004
551 Ga0439435_0067652
552 Ga0466972_0029543
553 Ga0466972_0087140
554 Ga0466972_0108762
555 Ga0466972_0220986
556 Ga0466972_0277321
557 Ga0466965_0126208
558 Ga0466965_0316972
559 Ga0466966_0065050
560 Ga0466966_0080325
561 Ga0466961_0016299
562 Ga0466963_0037283
563 Ga0466963_0149204
564 Ga0466963_0190795
565 Ga0466968_0015206
566 Ga0466968_0026654
567 Ga0466968_0089099
568 Ga0466968_0453057
569 Ga0466957_0180546
570 Ga0466960_0051492
571 Ga0466960_0229993
572 Ga0466959_0194763
573 Ga0466958_0013110
574 Ga0466958_0082456
575 Ga0466967_0008716
576 Ga0466967_0322606
577 Ga0466967_0506615
578 Ga0466967_0519456
579 Ga0466967_1666654
580 Ga0495629_0040272
581 Ga0495638_0008416
582 Ga0495641_0027228
583 Ga0495582_0120795
584 Ga0495662_0075464
585 Ga0495594_0059010
586 Ga0495630_0273459
587 Ga0495666_0114731
588 Ga0495665_0071847
589 Ga0495640_0021572
590 Ga0495668_0668130
591 Ga0495647_0121384
592 Ga0495671_0430681
593 Ga0495649_0175013
594 Ga0495649_0401146
595 Ga0495581_0039376
596 Ga0495676_0509807
597 Ga0495593_0006211
598 Ga0496100_0037765
599 Ga0496100_0053285
600 Ga0496100_0242678
601 Ga0496101_0057413
602 Ga0496101_0080032
603 Ga0496102_0000559
604 Ga0496102_0002030
605 Ga0496102_0109017
606 Ga0496102_0126813
607 Ga0496102_0178709
608 Ga0496102_0195549
609 Ga0496103_0000556
610 Ga0496103_0128564
611 Ga0496103_0522935
612 Ga0496104_0015016
613 Ga0496104_0128056
614 Ga0496104_0368541
615 Ga0496105_0060505
616 Ga0496105_0068811
617 Ga0496106_0029597
618 Ga0496106_0221819
619 Ga0496106_0810996
620 Ga0496107_0015782
621 Ga0496107_0473571
622 Ga0496107_0496674
623 Ga0496108_0108755
624 Ga0496108_0193960
625 Ga0496109_0316934
626 Ga0496109_0412840
627 Ga0496110_0136439
628 Ga0496110_0586094
629 Ga0496111_0024563
630 Ga0496111_0118958
631 Ga0496112_0018109
632 Ga0496112_0027671
633 Ga0496112_0043063
634 Ga0496112_0067639
635 Ga0496112_0104996
636 Ga0496113_0004760
637 Ga0496113_0064720
638 Ga0496114_0044517
639 Ga0496114_0151301
640 Ga0496114_0155258
641 Ga0496114_0595744
642 Ga0496117_0005020
643 Ga0496117_0051211
644 Ga0496118_0000358
645 Ga0496118_0004348
646 Ga0496119_0014096
647 Ga0496119_0126781
648 Ga0496120_0013454
649 Ga0496122_0126287
650 Ga0496123_0028948
651 Ga0496124_0100782
652 Ga0496124_0526828
653 Ga0496125_0107958
654 Ga0496125_0153501
655 Ga0496126_0010778
656 Ga0496126_0019389
657 Ga0496126_0071532
658 Ga0501032_0012850
659 Ga0501032_0109948
660 Ga0501033_0060871
661 Ga0501034_0008577
662 Ga0501034_0018580
663 Ga0501034_0104716
664 Ga0501034_0821498
665 Ga0501036_0001872
666 Ga0501036_0195475
667 Ga0501036_1016928
668 Ga0501037_0000401
669 Ga0501037_0103972
670 Ga0501038_0007683
671 Ga0501038_0346664
672 Ga0501039_0003187
673 Ga0501043_0001795
674 Ga0501043_0154593
675 Ga0501046_0024756
676 Ga0501046_0034456
677 Ga0501047_0030000
678 Ga0501047_0298382
679 Ga0501048_0018568
680 Ga0501048_0254885
681 Ga0501068_0092201
682 Ga0501068_0319297
683 Ga0501069_0250982
684 Ga0501069_0448725
685 Ga0501070_0012220
686 Ga0501070_0033974
687 Ga0501071_0933669
688 Ga0501073_0470629
689 Ga0501074_0488361
690 Ga0501076_0667913
691 Ga0501076_0770255
692 Ga0501080_0103035
693 Ga0501080_0469927
694 Ga0501035_0051098
695 Ga0501044_0005938
696 Ga0501044_0043957
697 Ga0501044_0141554
698 Ga0501044_0239293
699 nmdc:mga03683_1900_c1
700 nmdc:mga03n38_296917_c1
701 nmdc:mga03n38_57560_c1
702 nmdc:mga00v17_258426_c1
703 nmdc:mga00v17_709_c1
704 nmdc:mga0yw44_115335_c1
705 nmdc:mga0yw44_133605_c1
706 nmdc:mga0yw44_8098_c1
707 nmdc:mga07m45_511871_c1
708 nmdc:mga0qj67_72636_c1
709 nmdc:mga0sz30_338_c1
710 Ga0495601_0407408
711 Ga0500635_0002395
712 Ga0500643_003262
713 Ga0500641_0047764
714 Ga0500652_000371
715 Ga0500616_0001132
716 Ga0500645_000056
717 Ga0500645_060051
718 2548692598
719 2644514797
720 2739328843
721 2842139494
722 2861524033
723 2902804133
724 2902814508
725 2902839223
726 2929217910
727 3006327822
728 8057572503

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

23

130

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cmi-assembly1.cif.gz_A crystal structure of glutathione-dependent phospholipid peroxidase hyr1 from the yeast saccharomyces cerevisiae 0.9214 4 160
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9169 1 163
2p5q-assembly2.cif.gz_D crystal structure of the poplar glutathione peroxidase 5 in the reduced form 0.9074 3 160
5l71-assembly1.cif.gz_A crystal structure of mouse phospholipid hydroperoxide glutathione peroxidase 4 (gpx4) 0.902 1 161
2wgr-assembly1.cif.gz_A combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase 0.8997 1 160
ID Description Score Start End Superfamily
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9276 2 160 3.40.30.10
af_Q4CY93_66_221_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9271 3 160 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9245 1 161 3.40.30.10
af_P06610_1_183_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.922 3 160 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9189 1 161 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A839QE42-F1-model_v4 Glutathione peroxidase 0.9788 1 163 GO:0004601
GO:0034599
AF-A0A4Y9MQB4-F1-model_v4 Glutathione peroxidase 0.9779 2 163 GO:0004601
GO:0034599
AF-A0A1A3ID35-F1-model_v4 Glutathione peroxidase 0.9763 2 163 GO:0004601
GO:0034599
AF-A0A7I9YSB1-F1-model_v4 Glutathione peroxidase 0.9749 2 163 GO:0004601
GO:0034599
AF-A0A429BCQ9-F1-model_v4 Glutathione peroxidase 0.9749 2 161 GO:0004601
GO:0034599

Map