F423469

General Info

Members Datasets Scaffolds Average Seq Length
364 190 728 323

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0253146|Ga0501046_0253146_30_1160
Length 376
Sequence MCWSGRIESLNSILDLRFWIKNQENNPMNLFPSRFLSHNLKSKSGSAGQNRKLVGRFAFVVALTVCGARAETQQPAKSWKIGVLVSSSVALNAARDEALRQGLHDLGYEEGKNIVLEYKYAEGKTDRFAQLARELVELKVDVIVVGGTAVAVAAKNATSTIPIVIAGAGDLVEAGLIKSFMYPGGNVTGVARTSADFFGDRIKLIKEVLPKAKQVSALTNPTNPGHGRSLKDAELGALSSGLSFQSVAAKSAIELDGAIGSAAKGGASALFILTDAMFNNNLARIAQRAIHHKLPAVYDRADFVAAGGLLGYGVNLPDLSRRAAEYVDKILKGAKPGDLTLVQPTKFDLAVNLKTANQIAVTIPPPVLARASKVVK

Samples

Sample ID Description Type Environment
1 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.2
Rhizosphere 97.53
Stem 0
Stem Tuber 0
Unclassified 16.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501046_0253146 3300049580 Bacteria 1296
2 rootH1_10201196 3300003323 Bacteria 2533
3 JGI25405J52794_10020786 3300003911 Bacteria 1323
4 Ga0065712_10000734 3300005290 Bacteria 8641
5 Ga0065712_10000812 3300005290 Bacteria 8440
6 Ga0065712_10003375 3300005290 Bacteria 4809
7 Ga0065712_10102430 3300005290 Bacteria 1971
8 Ga0065712_10133649 3300005290 Bacteria 1521
9 Ga0065715_10001570 3300005293 Bacteria 5957
10 Ga0065715_10001825 3300005293 Bacteria 7378
11 Ga0065715_10099732 3300005293 Bacteria 3378
12 Ga0065707_10083330 3300005295 Bacteria 9547
13 Ga0065707_10096000 3300005295 Unclassified 3314
14 Ga0070658_10048034 3300005327 Bacteria 3455
15 Ga0070676_10086952 3300005328 Bacteria 1907
16 Ga0070676_10099812 3300005328 Bacteria 1791
17 Ga0070690_100048369 3300005330 Bacteria 2708
18 Ga0070670_100003961 3300005331 Bacteria 12360
19 Ga0070670_100021327 3300005331 Bacteria 5573
20 Ga0070670_100278161 3300005331 Unclassified 1461
21 Ga0070677_10033770 3300005333 Bacteria 1972
22 Ga0068869_100007179 3300005334 Bacteria 7102
23 Ga0070666_10010904 3300005335 Bacteria 5694
24 Ga0070666_10105464 3300005335 Bacteria 1947
25 Ga0070680_100028678 3300005336 Bacteria 4466
26 Ga0070680_100031561 3300005336 Unclassified 4260
27 Ga0070680_100033411 3300005336 Bacteria 4146
28 Ga0070680_100142706 3300005336 Bacteria 2008
29 Ga0070660_100019325 3300005339 Bacteria 4990
30 Ga0070660_100023682 3300005339 Bacteria 4551
31 Ga0070660_100026473 3300005339 Bacteria 4318
32 Ga0070660_100045419 3300005339 Bacteria 3362
33 Ga0070660_100066239 3300005339 Unclassified 2811
34 Ga0070689_100113085 3300005340 Unclassified 2162
35 Ga0070689_100179130 3300005340 Unclassified 1721
36 Ga0070661_100018137 3300005344 Bacteria 5001
37 Ga0070661_100018185 3300005344 Bacteria 4994
38 Ga0070661_100038749 3300005344 Bacteria 3470
39 Ga0070675_100145396 3300005354 Bacteria 2029
40 Ga0070675_100155473 3300005354 Unclassified 1963
41 Ga0070675_100269255 3300005354 Bacteria 1494
42 Ga0070671_100125334 3300005355 Bacteria 2162
43 Ga0070673_100039692 3300005364 Bacteria 3605
44 Ga0070673_100040276 3300005364 Bacteria 3583
45 Ga0070659_100008281 3300005366 Bacteria 7590
46 Ga0070659_100023914 3300005366 Bacteria 4680
47 Ga0070659_100077424 3300005366 Bacteria 2652
48 Ga0070667_100069308 3300005367 Bacteria 3001
49 Ga0070713_100022651 3300005436 Bacteria 4857
50 Ga0070705_100051906 3300005440 Bacteria 2394
51 Ga0070694_100199504 3300005444 Bacteria 1491
52 Ga0070663_100125845 3300005455 Unclassified 1941
53 Ga0070678_100019522 3300005456 Unclassified 4422
54 Ga0070662_100065154 3300005457 Bacteria 2670
55 Ga0070662_100076987 3300005457 Unclassified 2474
56 Ga0070681_10017902 3300005458 Bacteria 7082
57 Ga0070681_10019886 3300005458 Bacteria 6727
58 Ga0070681_10044568 3300005458 Bacteria 4441
59 Ga0070681_10073149 3300005458 Bacteria 3390
60 Ga0070681_10116487 3300005458 Bacteria 2609
61 Ga0070681_10120917 3300005458 Bacteria 2553
62 Ga0070681_10274999 3300005458 Bacteria 1595
63 Ga0070706_100007180 3300005467 Bacteria 10472
64 Ga0070706_100064489 3300005467 Bacteria 3386
65 Ga0070706_100381294 3300005467 Unclassified 1313
66 Ga0070707_100021677 3300005468 Bacteria 6073
67 Ga0070698_100309638 3300005471 Bacteria 1510
68 Ga0070699_100103648 3300005518 Bacteria 2495
69 Ga0070679_100041271 3300005530 Bacteria 4592
70 Ga0070679_100043046 3300005530 Bacteria 4497
71 Ga0070679_100051854 3300005530 Bacteria 4087
72 Ga0070679_100104966 3300005530 Bacteria 2812
73 Ga0070679_100107374 3300005530 Bacteria 2777
74 Ga0070679_100304733 3300005530 Bacteria 1543
75 Ga0070697_100006900 3300005536 Bacteria 8825
76 Ga0070697_100135225 3300005536 Bacteria 2070
77 Ga0068853_100007119 3300005539 Bacteria 8945
78 Ga0068853_100370191 3300005539 Bacteria 1336
79 Ga0070672_100302262 3300005543 Unclassified 1356
80 Ga0070686_100047021 3300005544 Bacteria 2726
81 Ga0070686_100077114 3300005544 Bacteria 2196
82 Ga0070686_100239306 3300005544 Bacteria 1321
83 Ga0070696_100026553 3300005546 Bacteria 3940
84 Ga0070696_100088048 3300005546 Bacteria 2206
85 Ga0070696_100088660 3300005546 Bacteria 2199
86 Ga0070696_100132852 3300005546 Bacteria 1813
87 Ga0070696_100151437 3300005546 Bacteria 1703
88 Ga0070693_100122357 3300005547 Unclassified 1615
89 Ga0070693_100137043 3300005547 Bacteria 1536
90 Ga0070665_100136417 3300005548 Bacteria 2457
91 Ga0070704_100251879 3300005549 Bacteria 1451
92 Ga0068855_100053031 3300005563 Bacteria 4772
93 Ga0068855_100698712 3300005563 Bacteria 1085
94 Ga0070664_100001722 3300005564 Bacteria 17531
95 Ga0070664_100003429 3300005564 Bacteria 12806
96 Ga0068857_100014636 3300005577 Bacteria 6842
97 Ga0068857_100266761 3300005577 Bacteria 1573
98 Ga0068856_100110610 3300005614 Bacteria 2744
99 Ga0068852_100099048 3300005616 Bacteria 2627
100 Ga0068861_100216009 3300005719 Bacteria 1618
101 Ga0068870_10085163 3300005840 Bacteria 1756
102 Ga0068863_100124691 3300005841 Unclassified 2457
103 Ga0068860_100069756 3300005843 Bacteria 3341
104 Ga0068860_100162071 3300005843 Bacteria 2156
105 Ga0081455_10000993 3300005937 Bacteria 35989
106 Ga0081455_10006957 3300005937 Bacteria 12025
107 Ga0081455_10023221 3300005937 Bacteria 5777
108 Ga0081538_10086426 3300005981 Bacteria 1642
109 Ga0081540_1014301 3300005983 Bacteria 5094
110 Ga0081540_1091595 3300005983 Bacteria 1336
111 Ga0070717_10002091 3300006028 Bacteria 13991
112 Ga0070716_100295104 3300006173 Unclassified 1125
113 Ga0097621_100343152 3300006237 Unclassified 1326
114 Ga0075428_100378197 3300006844 Bacteria 1518
115 Ga0075428_100431800 3300006844 Bacteria 1411
116 Ga0075428_100469093 3300006844 Bacteria 1348
117 Ga0075430_100025882 3300006846 Bacteria 4992
118 Ga0075430_100030729 3300006846 Unclassified 4562
119 Ga0075430_100071001 3300006846 Unclassified 2921
120 Ga0075430_100089444 3300006846 Unclassified 2576
121 Ga0075431_100082759 3300006847 Bacteria 3313
122 Ga0075431_100088822 3300006847 Bacteria 3190
123 Ga0075431_100131549 3300006847 Unclassified 2580
124 Ga0075431_100167193 3300006847 Bacteria 2260
125 Ga0075433_10005304 3300006852 Bacteria 10110
126 Ga0075433_10025258 3300006852 Bacteria 5020
127 Ga0075433_10038221 3300006852 Unclassified 4144
128 Ga0075433_10061759 3300006852 Bacteria 3282
129 Ga0075433_10087438 3300006852 Bacteria 2752
130 Ga0075433_10089332 3300006852 Unclassified 2723
131 Ga0075433_10092749 3300006852 Bacteria 2671
132 Ga0075433_10112367 3300006852 Bacteria 2416
133 Ga0075433_10363917 3300006852 Bacteria 1277
134 Ga0075434_100008214 3300006871 Bacteria 9687
135 Ga0075434_100009176 3300006871 Bacteria 9216
136 Ga0075434_100048081 3300006871 Bacteria 4233
137 Ga0075434_100073174 3300006871 Bacteria 3419
138 Ga0075434_100085773 3300006871 Bacteria 3148
139 Ga0075434_100088763 3300006871 Bacteria 3093
140 Ga0075429_100128849 3300006880 Bacteria 2213
141 Ga0075436_100014226 3300006914 Bacteria 5448
142 Ga0075436_100069363 3300006914 Bacteria 2436
143 Ga0075436_100141178 3300006914 Unclassified 1693
144 Ga0075436_100178109 3300006914 Bacteria 1502
145 Ga0075436_100287712 3300006914 Bacteria 1176
146 Ga0075435_100074150 3300007076 Bacteria 2783
147 Ga0075435_100076340 3300007076 Bacteria 2745
148 Ga0075435_100102483 3300007076 Bacteria 2372
149 Ga0075435_100151442 3300007076 Bacteria 1950
150 Ga0075435_100167890 3300007076 Bacteria 1851
151 Ga0075435_100193201 3300007076 Bacteria 1723
152 Ga0075435_100231895 3300007076 Bacteria 1569
153 Ga0105240_10015366 3300009093 Bacteria 10409
154 Ga0111539_10050359 3300009094 Bacteria 4961
155 Ga0111539_10067862 3300009094 Unclassified 4211
156 Ga0111539_10097527 3300009094 Unclassified 3453
157 Ga0111539_10426864 3300009094 Unclassified 1544
158 Ga0111539_10591183 3300009094 Bacteria 1293
159 Ga0111539_10591754 3300009094 Bacteria 1292
160 Ga0105245_10401771 3300009098 Unclassified 1369
161 Ga0114129_10511833 3300009147 Unclassified 1566
162 Ga0105241_10128919 3300009174 Bacteria 2045
163 Ga0105241_10204493 3300009174 Bacteria 1651
164 Ga0105237_10034471 3300009545 Bacteria 5125
165 Ga0105238_10003526 3300009551 Bacteria 15592
166 Ga0105238_10029780 3300009551 Bacteria 5561
167 Ga0105249_10368672 3300009553 Bacteria 1459
168 Ga0105239_10064158 3300010375 Bacteria 4032
169 Ga0105239_10262633 3300010375 Bacteria 1941
170 Ga0105239_10393292 3300010375 Bacteria 1568
171 Ga0105246_10146022 3300011119 Bacteria 1785
172 Ga0157373_10116661 3300013100 Bacteria 1876
173 Ga0157370_10042063 3300013104 Bacteria 4405
174 Ga0157370_10154326 3300013104 Unclassified 2136
175 Ga0157369_10046386 3300013105 Bacteria 4722
176 Ga0157374_10050965 3300013296 Bacteria 3850
177 Ga0157374_10158897 3300013296 Unclassified 2201
178 Ga0157374_10437970 3300013296 Bacteria 1307
179 Ga0157378_10279053 3300013297 Bacteria 1610
180 Ga0157378_10388060 3300013297 Bacteria 1373
181 Ga0163162_10042385 3300013306 Bacteria 4556
182 Ga0157372_10395992 3300013307 Bacteria 1609
183 Ga0157375_10459739 3300013308 Bacteria 1438
184 Ga0163163_10031083 3300014325 Bacteria 5151
185 Ga0163163_10102156 3300014325 Unclassified 2890
186 Ga0157376_10259394 3300014969 Bacteria 1627
187 Ga0157376_10343746 3300014969 Bacteria 1426
188 Ga0157376_10432756 3300014969 Unclassified 1279
189 Ga0207697_10009932 3300025315 Bacteria 4088
190 Ga0207697_10042466 3300025315 Unclassified 1868
191 Ga0207682_10053892 3300025893 Unclassified 1669
192 Ga0207680_10004876 3300025903 Bacteria 6386
193 Ga0207680_10106180 3300025903 Bacteria 1813
194 Ga0207645_10013576 3300025907 Bacteria 5484
195 Ga0207645_10032836 3300025907 Unclassified 3336
196 Ga0207645_10124031 3300025907 Bacteria 1678
197 Ga0207707_10005998 3300025912 Bacteria 10637
198 Ga0207707_10007863 3300025912 Bacteria 9272
199 Ga0207707_10014647 3300025912 Bacteria 6832
200 Ga0207707_10022418 3300025912 Bacteria 5520
201 Ga0207707_10033748 3300025912 Bacteria 4479
202 Ga0207707_10091071 3300025912 Bacteria 2665
203 Ga0207707_10133899 3300025912 Bacteria 2167
204 Ga0207695_10095212 3300025913 Bacteria 2983
205 Ga0207671_10165836 3300025914 Bacteria 1713
206 Ga0207660_10034342 3300025917 Bacteria 3514
207 Ga0207660_10061066 3300025917 Bacteria 2712
208 Ga0207660_10069986 3300025917 Bacteria 2550
209 Ga0207660_10094552 3300025917 Bacteria 2222
210 Ga0207657_10020221 3300025919 Bacteria 6298
211 Ga0207657_10031457 3300025919 Bacteria 4806
212 Ga0207657_10046749 3300025919 Bacteria 3790
213 Ga0207657_10047987 3300025919 Bacteria 3730
214 Ga0207657_10092612 3300025919 Bacteria 2519
215 Ga0207649_10031550 3300025920 Bacteria 3150
216 Ga0207649_10108180 3300025920 Bacteria 1852
217 Ga0207652_10036910 3300025921 Bacteria 4133
218 Ga0207652_10052366 3300025921 Bacteria 3503
219 Ga0207650_10003562 3300025925 Bacteria 10689
220 Ga0207650_10005436 3300025925 Bacteria 8696
221 Ga0207650_10304597 3300025925 Unclassified 1302
222 Ga0207659_10045262 3300025926 Unclassified 3101
223 Ga0207659_10273206 3300025926 Unclassified 1379
224 Ga0207700_10112830 3300025928 Bacteria 2190
225 Ga0207644_10120169 3300025931 Unclassified 1999
226 Ga0207690_10006219 3300025932 Bacteria 7071
227 Ga0207690_10023832 3300025932 Bacteria 3826
228 Ga0207706_10092446 3300025933 Bacteria 2660
229 Ga0207706_10113702 3300025933 Bacteria 2381
230 Ga0207706_10113728 3300025933 Bacteria 2381
231 Ga0207670_10123042 3300025936 Unclassified 1889
232 Ga0207704_10153805 3300025938 Unclassified 1627
233 Ga0207704_10172839 3300025938 Bacteria 1552
234 Ga0207691_10007570 3300025940 Bacteria 10455
235 Ga0207691_10031286 3300025940 Bacteria 4968
236 Ga0207689_10021279 3300025942 Bacteria 5453
237 Ga0207689_10221470 3300025942 Bacteria 1563
238 Ga0207679_10001562 3300025945 Bacteria 14330
239 Ga0207679_10095285 3300025945 Unclassified 2313
240 Ga0207667_10052707 3300025949 Bacteria 4283
241 Ga0207667_10501590 3300025949 Bacteria 1231
242 Ga0207651_10029322 3300025960 Unclassified 3485
243 Ga0207651_10229090 3300025960 Bacteria 1507
244 Ga0207640_10128134 3300025981 Bacteria 1830
245 Ga0207658_10133953 3300025986 Bacteria 1995
246 Ga0207703_10155623 3300026035 Bacteria 1997
247 Ga0207639_10216805 3300026041 Bacteria 1651
248 Ga0207678_10068898 3300026067 Bacteria 3034
249 Ga0207678_10157112 3300026067 Unclassified 1942
250 Ga0207648_10265862 3300026089 Unclassified 1531
251 Ga0207676_10485412 3300026095 Bacteria 1171
252 Ga0207674_10033519 3300026116 Bacteria 5376
253 Ga0207674_10242687 3300026116 Bacteria 1749
254 Ga0207683_10021165 3300026121 Bacteria 5566
255 Ga0207683_10116818 3300026121 Bacteria 2392
256 Ga0207698_10410722 3300026142 Bacteria 1296
257 Ga0210000_1008197 3300027462 Bacteria 1530
258 Ga0210002_1008344 3300027617 Unclassified 1576
259 Ga0209588_1004211 3300027671 Bacteria 4044
260 Ga0209971_1007726 3300027682 Bacteria 2552
261 Ga0209966_1020879 3300027695 Bacteria 1271
262 Ga0209998_10005288 3300027717 Bacteria 2708
263 Ga0268266_10277583 3300028379 Bacteria 1557
264 Ga0268264_10513998 3300028381 Bacteria 1170
265 Ga0307408_100072636 3300031548 Unclassified 2548
266 Ga0307409_100091948 3300031995 Bacteria 2488
267 Ga0307416_100010352 3300032002 Bacteria 6155
268 Ga0307411_10013858 3300032005 Unclassified 4466
269 Ga0307415_100020784 3300032126 Unclassified 4017
270 Ga0373936_0043594 3300035113 Bacteria 1804
271 Ga0373943_0162746 3300035170 Bacteria 1216
272 Ga0373955_0027698 3300035172 Bacteria 2932
273 Ga0373924_0022717 3300035410 Bacteria 2454
274 Ga0373927_0096501 3300035695 Unclassified 1922
275 Ga0373947_0015168 3300035725 Bacteria 4424
276 Ga0373925_0036584 3300037068 Bacteria 3623
277 Ga0439460_0057187 3300042461 Unclassified 1183
278 Ga0451576_0339233 3300045051 Unclassified 1573
279 Ga0451576_0447942 3300045051 Bacteria 1355
280 Ga0495629_0039830 3300046459 Bacteria 3307
281 Ga0495651_0009875 3300046462 Bacteria 7340
282 Ga0495580_0009229 3300046472 Bacteria 7772
283 Ga0495580_0058965 3300046472 Bacteria 2698
284 Ga0495662_0090301 3300046476 Bacteria 1493
285 Ga0495608_0031531 3300046511 Bacteria 3584
286 Ga0495628_0018661 3300046516 Bacteria 5741
287 Ga0495652_0029576 3300046529 Bacteria 4811
288 Ga0495657_0025114 3300046675 Bacteria 4234
289 Ga0495599_0014483 3300046678 Bacteria 4884
290 Ga0495600_0029853 3300046809 Bacteria 3531
291 Ga0495604_0017340 3300047317 Bacteria 5763
292 Ga0495674_0148269 3300047319 Bacteria 1968
293 Ga0495684_0046002 3300047471 Bacteria 3339
294 Ga0496109_0348850 3300048912 Bacteria 1398
295 Ga0496110_0484239 3300048913 Bacteria 1127
296 Ga0496112_0000018 3300048915 Bacteria 188820
297 Ga0496112_0005004 3300048915 Bacteria 11371
298 Ga0496112_0064974 3300048915 Unclassified 3601
299 Ga0496112_0092035 3300048915 Bacteria 3002
300 Ga0496112_0392840 3300048915 Bacteria 1327
301 Ga0496115_0073141 3300048918 Bacteria 2782
302 Ga0501036_0007614 3300049572 Bacteria 8839
303 Ga0501039_0002043 3300049575 Bacteria 14958
304 Ga0501040_0000853 3300049576 Bacteria 19112
305 Ga0501040_0351589 3300049576 Bacteria 1056
306 Ga0501041_0000047 3300049577 Bacteria 42489
307 Ga0501042_0004292 3300049578 Bacteria 9079
308 Ga0501046_0003254 3300049580 Bacteria 14910
309 Ga0501067_0136533 3300049583 Bacteria 1366
310 Ga0501070_0093522 3300049586 Bacteria 2487
311 Ga0501071_0000347 3300049587 Bacteria 22534
312 Ga0501071_0418641 3300049587 Bacteria 1024
313 Ga0501072_0000581 3300049588 Bacteria 26400
314 Ga0501075_0001830 3300049591 Bacteria 14023
315 Ga0501076_0000105 3300049592 Bacteria 46098
316 Ga0501076_0049980 3300049592 Bacteria 3308
317 Ga0501077_0000030 3300049593 Bacteria 71771
318 Ga0501077_0092381 3300049593 Bacteria 1918
319 Ga0501079_0000683 3300049741 Bacteria 22746
320 Ga0501080_0510294 3300049742 Bacteria 1074
321 Ga0501081_0006074 3300049743 Bacteria 7824
322 Ga0501083_0015969 3300049744 Bacteria 5258
323 Ga0501035_0008607 3300049822 Bacteria 9494
324 Ga0501045_0001282 3300049824 Bacteria 16686
325 nmdc:mga05p37_111468_c1 3300050507 Bacteria 3365
326 nmdc:mga05p37_152292_c1 3300050507 Bacteria 2828
327 nmdc:mga05p37_58513_c1 3300050507 Bacteria 4746
328 nmdc:mga05p37_622076_c1 3300050507 Unclassified 1215
329 nmdc:mga09592_112232_c1 3300050508 Bacteria 2339
330 nmdc:mga0qj67_115098_c1 3300050509 Unclassified 2172
331 nmdc:mga0qj67_17193_c1 3300050509 Bacteria 5495
332 nmdc:mga0qj67_191211_c1 3300050509 Bacteria 1663
333 nmdc:mga0qj67_27622_c1 3300050509 Unclassified 4400
334 nmdc:mga06r32_181592_c1 3300050510 Bacteria 2090
335 nmdc:mga06r32_60383_c1 3300050510 Unclassified 3648
336 nmdc:mga08y16_283850_c1 3300050511 Bacteria 1707
337 nmdc:mga0n895_121106_c1 3300050512 Bacteria 2638
338 nmdc:mga0n895_19207_c1 3300050512 Bacteria 6346
339 nmdc:mga0n895_202798_c1 3300050512 Bacteria 2014
340 nmdc:mga0n895_2236_c1 3300050512 Bacteria 14980
341 nmdc:mga0n895_39964_c1 3300050512 Bacteria 4556
342 nmdc:mga0n895_5727_c1 3300050512 Bacteria 10428
343 nmdc:mga0n895_60654_c1 3300050512 Bacteria 3733
344 nmdc:mga0n895_7616_c1 3300050512 Bacteria 9309
345 nmdc:mga0rr50_132714_c1 3300050513 Bacteria 1996
346 nmdc:mga0rr50_140099_c1 3300050513 Bacteria 1945
347 nmdc:mga0rr50_165116_c1 3300050513 Bacteria 1800
348 nmdc:mga0rr50_33568_c1 3300050513 Bacteria 3667
349 nmdc:mga0rr50_41956_c1 3300050513 Bacteria 3338
350 nmdc:mga0rr50_89691_c1 3300050513 Unclassified 2391
351 nmdc:mga0rr50_9981_c1 3300050513 Bacteria 6004
352 nmdc:mga08x19_122869_c1 3300050514 Unclassified 1742
353 nmdc:mga0a205_116769_c1 3300050515 Bacteria 2567
354 nmdc:mga0a205_31714_c1 3300050515 Bacteria 5064
355 nmdc:mga0a205_3444_c1 3300050515 Bacteria 14124
356 nmdc:mga0a205_380408_c1 3300050515 Unclassified 1277
357 nmdc:mga0a205_48194_c1 3300050515 Bacteria 4112
358 nmdc:mga0a205_78384_c1 3300050515 Bacteria 3192
359 Ga0495601_0032643 3300053077 Bacteria 3241
360 Ga0495595_0033361 3300053084 Bacteria 2322
361 Ga0501084_0000369 3300054114 Bacteria 34424
362 Ga0501084_0142940 3300054114 Bacteria 2015
363 Ga0501082_0001930 3300060353 Bacteria 18241
364 Ga0530510_0000982 3300061734 Bacteria 18882
365 Ga0501046_0253146
366 rootH1_10201196
367 JGI25405J52794_10020786
368 Ga0065712_10000734
369 Ga0065712_10000812
370 Ga0065712_10003375
371 Ga0065712_10102430
372 Ga0065712_10133649
373 Ga0065715_10001570
374 Ga0065715_10001825
375 Ga0065715_10099732
376 Ga0065707_10083330
377 Ga0065707_10096000
378 Ga0070658_10048034
379 Ga0070676_10086952
380 Ga0070676_10099812
381 Ga0070690_100048369
382 Ga0070670_100003961
383 Ga0070670_100021327
384 Ga0070670_100278161
385 Ga0070677_10033770
386 Ga0068869_100007179
387 Ga0070666_10010904
388 Ga0070666_10105464
389 Ga0070680_100028678
390 Ga0070680_100031561
391 Ga0070680_100033411
392 Ga0070680_100142706
393 Ga0070660_100019325
394 Ga0070660_100023682
395 Ga0070660_100026473
396 Ga0070660_100045419
397 Ga0070660_100066239
398 Ga0070689_100113085
399 Ga0070689_100179130
400 Ga0070661_100018137
401 Ga0070661_100018185
402 Ga0070661_100038749
403 Ga0070675_100145396
404 Ga0070675_100155473
405 Ga0070675_100269255
406 Ga0070671_100125334
407 Ga0070673_100039692
408 Ga0070673_100040276
409 Ga0070659_100008281
410 Ga0070659_100023914
411 Ga0070659_100077424
412 Ga0070667_100069308
413 Ga0070713_100022651
414 Ga0070705_100051906
415 Ga0070694_100199504
416 Ga0070663_100125845
417 Ga0070678_100019522
418 Ga0070662_100065154
419 Ga0070662_100076987
420 Ga0070681_10017902
421 Ga0070681_10019886
422 Ga0070681_10044568
423 Ga0070681_10073149
424 Ga0070681_10116487
425 Ga0070681_10120917
426 Ga0070681_10274999
427 Ga0070706_100007180
428 Ga0070706_100064489
429 Ga0070706_100381294
430 Ga0070707_100021677
431 Ga0070698_100309638
432 Ga0070699_100103648
433 Ga0070679_100041271
434 Ga0070679_100043046
435 Ga0070679_100051854
436 Ga0070679_100104966
437 Ga0070679_100107374
438 Ga0070679_100304733
439 Ga0070697_100006900
440 Ga0070697_100135225
441 Ga0068853_100007119
442 Ga0068853_100370191
443 Ga0070672_100302262
444 Ga0070686_100047021
445 Ga0070686_100077114
446 Ga0070686_100239306
447 Ga0070696_100026553
448 Ga0070696_100088048
449 Ga0070696_100088660
450 Ga0070696_100132852
451 Ga0070696_100151437
452 Ga0070693_100122357
453 Ga0070693_100137043
454 Ga0070665_100136417
455 Ga0070704_100251879
456 Ga0068855_100053031
457 Ga0068855_100698712
458 Ga0070664_100001722
459 Ga0070664_100003429
460 Ga0068857_100014636
461 Ga0068857_100266761
462 Ga0068856_100110610
463 Ga0068852_100099048
464 Ga0068861_100216009
465 Ga0068870_10085163
466 Ga0068863_100124691
467 Ga0068860_100069756
468 Ga0068860_100162071
469 Ga0081455_10000993
470 Ga0081455_10006957
471 Ga0081455_10023221
472 Ga0081538_10086426
473 Ga0081540_1014301
474 Ga0081540_1091595
475 Ga0070717_10002091
476 Ga0070716_100295104
477 Ga0097621_100343152
478 Ga0075428_100378197
479 Ga0075428_100431800
480 Ga0075428_100469093
481 Ga0075430_100025882
482 Ga0075430_100030729
483 Ga0075430_100071001
484 Ga0075430_100089444
485 Ga0075431_100082759
486 Ga0075431_100088822
487 Ga0075431_100131549
488 Ga0075431_100167193
489 Ga0075433_10005304
490 Ga0075433_10025258
491 Ga0075433_10038221
492 Ga0075433_10061759
493 Ga0075433_10087438
494 Ga0075433_10089332
495 Ga0075433_10092749
496 Ga0075433_10112367
497 Ga0075433_10363917
498 Ga0075434_100008214
499 Ga0075434_100009176
500 Ga0075434_100048081
501 Ga0075434_100073174
502 Ga0075434_100085773
503 Ga0075434_100088763
504 Ga0075429_100128849
505 Ga0075436_100014226
506 Ga0075436_100069363
507 Ga0075436_100141178
508 Ga0075436_100178109
509 Ga0075436_100287712
510 Ga0075435_100074150
511 Ga0075435_100076340
512 Ga0075435_100102483
513 Ga0075435_100151442
514 Ga0075435_100167890
515 Ga0075435_100193201
516 Ga0075435_100231895
517 Ga0105240_10015366
518 Ga0111539_10050359
519 Ga0111539_10067862
520 Ga0111539_10097527
521 Ga0111539_10426864
522 Ga0111539_10591183
523 Ga0111539_10591754
524 Ga0105245_10401771
525 Ga0114129_10511833
526 Ga0105241_10128919
527 Ga0105241_10204493
528 Ga0105237_10034471
529 Ga0105238_10003526
530 Ga0105238_10029780
531 Ga0105249_10368672
532 Ga0105239_10064158
533 Ga0105239_10262633
534 Ga0105239_10393292
535 Ga0105246_10146022
536 Ga0157373_10116661
537 Ga0157370_10042063
538 Ga0157370_10154326
539 Ga0157369_10046386
540 Ga0157374_10050965
541 Ga0157374_10158897
542 Ga0157374_10437970
543 Ga0157378_10279053
544 Ga0157378_10388060
545 Ga0163162_10042385
546 Ga0157372_10395992
547 Ga0157375_10459739
548 Ga0163163_10031083
549 Ga0163163_10102156
550 Ga0157376_10259394
551 Ga0157376_10343746
552 Ga0157376_10432756
553 Ga0207697_10009932
554 Ga0207697_10042466
555 Ga0207682_10053892
556 Ga0207680_10004876
557 Ga0207680_10106180
558 Ga0207645_10013576
559 Ga0207645_10032836
560 Ga0207645_10124031
561 Ga0207707_10005998
562 Ga0207707_10007863
563 Ga0207707_10014647
564 Ga0207707_10022418
565 Ga0207707_10033748
566 Ga0207707_10091071
567 Ga0207707_10133899
568 Ga0207695_10095212
569 Ga0207671_10165836
570 Ga0207660_10034342
571 Ga0207660_10061066
572 Ga0207660_10069986
573 Ga0207660_10094552
574 Ga0207657_10020221
575 Ga0207657_10031457
576 Ga0207657_10046749
577 Ga0207657_10047987
578 Ga0207657_10092612
579 Ga0207649_10031550
580 Ga0207649_10108180
581 Ga0207652_10036910
582 Ga0207652_10052366
583 Ga0207650_10003562
584 Ga0207650_10005436
585 Ga0207650_10304597
586 Ga0207659_10045262
587 Ga0207659_10273206
588 Ga0207700_10112830
589 Ga0207644_10120169
590 Ga0207690_10006219
591 Ga0207690_10023832
592 Ga0207706_10092446
593 Ga0207706_10113702
594 Ga0207706_10113728
595 Ga0207670_10123042
596 Ga0207704_10153805
597 Ga0207704_10172839
598 Ga0207691_10007570
599 Ga0207691_10031286
600 Ga0207689_10021279
601 Ga0207689_10221470
602 Ga0207679_10001562
603 Ga0207679_10095285
604 Ga0207667_10052707
605 Ga0207667_10501590
606 Ga0207651_10029322
607 Ga0207651_10229090
608 Ga0207640_10128134
609 Ga0207658_10133953
610 Ga0207703_10155623
611 Ga0207639_10216805
612 Ga0207678_10068898
613 Ga0207678_10157112
614 Ga0207648_10265862
615 Ga0207676_10485412
616 Ga0207674_10033519
617 Ga0207674_10242687
618 Ga0207683_10021165
619 Ga0207683_10116818
620 Ga0207698_10410722
621 Ga0210000_1008197
622 Ga0210002_1008344
623 Ga0209588_1004211
624 Ga0209971_1007726
625 Ga0209966_1020879
626 Ga0209998_10005288
627 Ga0268266_10277583
628 Ga0268264_10513998
629 Ga0307408_100072636
630 Ga0307409_100091948
631 Ga0307416_100010352
632 Ga0307411_10013858
633 Ga0307415_100020784
634 Ga0373936_0043594
635 Ga0373943_0162746
636 Ga0373955_0027698
637 Ga0373924_0022717
638 Ga0373927_0096501
639 Ga0373947_0015168
640 Ga0373925_0036584
641 Ga0439460_0057187
642 Ga0451576_0339233
643 Ga0451576_0447942
644 Ga0495629_0039830
645 Ga0495651_0009875
646 Ga0495580_0009229
647 Ga0495580_0058965
648 Ga0495662_0090301
649 Ga0495608_0031531
650 Ga0495628_0018661
651 Ga0495652_0029576
652 Ga0495657_0025114
653 Ga0495599_0014483
654 Ga0495600_0029853
655 Ga0495604_0017340
656 Ga0495674_0148269
657 Ga0495684_0046002
658 Ga0496109_0348850
659 Ga0496110_0484239
660 Ga0496112_0000018
661 Ga0496112_0005004
662 Ga0496112_0064974
663 Ga0496112_0092035
664 Ga0496112_0392840
665 Ga0496115_0073141
666 Ga0501036_0007614
667 Ga0501039_0002043
668 Ga0501040_0000853
669 Ga0501040_0351589
670 Ga0501041_0000047
671 Ga0501042_0004292
672 Ga0501046_0003254
673 Ga0501067_0136533
674 Ga0501070_0093522
675 Ga0501071_0000347
676 Ga0501071_0418641
677 Ga0501072_0000581
678 Ga0501075_0001830
679 Ga0501076_0000105
680 Ga0501076_0049980
681 Ga0501077_0000030
682 Ga0501077_0092381
683 Ga0501079_0000683
684 Ga0501080_0510294
685 Ga0501081_0006074
686 Ga0501083_0015969
687 Ga0501035_0008607
688 Ga0501045_0001282
689 nmdc:mga05p37_111468_c1
690 nmdc:mga05p37_152292_c1
691 nmdc:mga05p37_58513_c1
692 nmdc:mga05p37_622076_c1
693 nmdc:mga09592_112232_c1
694 nmdc:mga0qj67_115098_c1
695 nmdc:mga0qj67_17193_c1
696 nmdc:mga0qj67_191211_c1
697 nmdc:mga0qj67_27622_c1
698 nmdc:mga06r32_181592_c1
699 nmdc:mga06r32_60383_c1
700 nmdc:mga08y16_283850_c1
701 nmdc:mga0n895_121106_c1
702 nmdc:mga0n895_19207_c1
703 nmdc:mga0n895_202798_c1
704 nmdc:mga0n895_2236_c1
705 nmdc:mga0n895_39964_c1
706 nmdc:mga0n895_5727_c1
707 nmdc:mga0n895_60654_c1
708 nmdc:mga0n895_7616_c1
709 nmdc:mga0rr50_132714_c1
710 nmdc:mga0rr50_140099_c1
711 nmdc:mga0rr50_165116_c1
712 nmdc:mga0rr50_33568_c1
713 nmdc:mga0rr50_41956_c1
714 nmdc:mga0rr50_89691_c1
715 nmdc:mga0rr50_9981_c1
716 nmdc:mga08x19_122869_c1
717 nmdc:mga0a205_116769_c1
718 nmdc:mga0a205_31714_c1
719 nmdc:mga0a205_3444_c1
720 nmdc:mga0a205_380408_c1
721 nmdc:mga0a205_48194_c1
722 nmdc:mga0a205_78384_c1
723 Ga0495601_0032643
724 Ga0495595_0033361
725 Ga0501084_0000369
726 Ga0501084_0142940
727 Ga0501082_0001930
728 Ga0530510_0000982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

80

375

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9285 28 321
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9194 28 321
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9159 28 322
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9129 28 322
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.908 32 322
ID Description Score Start End Superfamily
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8987 145 322 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8956 145 321 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8813 145 322 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8723 145 321 3.40.50.2300
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8694 28 293 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A127F3J2-F1-model_v4 ABC transporter substrate binding protein 0.993 32 323
AF-A0A127F3J2-F1-model_v4 ABC transporter substrate binding protein 0.9896 32 323
AF-A0A521SLV5-F1-model_v4 ABC transporter substrate-binding protein 0.9738 54 323
AF-A0A537SZT0-F1-model_v4 ABC transporter substrate-binding protein 0.9725 114 323
AF-A0A1I3X819-F1-model_v4 Putative ABC transport system substrate-binding protein 0.9702 177 323

Map