F423344

General Info

Members Datasets Scaffolds Average Seq Length
364 217 728 109

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10410630|Ga0207693_104106302
Length 130
Sequence MIPGEIFPASGEIVLNKDRAAISVTVANTGDRPIQVGSHYHFAETNTALAFDRKAALGYRLDIPAGTAVRFEPGQSREVSLIPYAGARLVYGFNKAVMGALPAKRNGANRASPSRELRPAIIEGKRRRHR

Samples

Sample ID Description Type Environment
1 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
117 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
144 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
147 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
153 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
162 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
163 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
164 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
165 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
166 2922368715
167 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
168 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
169 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
170 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
171 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
172 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
173 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
174 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
175 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
176 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
177 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
178 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
179 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
180 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
181 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
182 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
183 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
184 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
185 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
186 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
187 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
188 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
189 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
190 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
191 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
192 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
193 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
194 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
195 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
196 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
197 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
198 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
199 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
200 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
201 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
202 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
203 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
204 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
205 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
206 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
207 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
208 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
209 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
210 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
211 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
212 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
213 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
214 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
215 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
216 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
217 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.3
Metatranscriptomes 0.28
Isolates 15.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.77
Nodule 14.56
Rhizoplane 3.57
Rhizosphere 71.98
Stem 0
Stem Tuber 0
Unclassified 14.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207693_10410630 3300025915 Unclassified 1058
2 JGI25153J46596_10018011 3300003215 Bacteria 2759
3 rootL2_10087879 3300003322 Bacteria 1769
4 JGI25404J52841_10023092 3300003659 Unclassified 1343
5 Ga0065165_1006510 3300005262 Bacteria 6095
6 Ga0065715_10692378 3300005293 Unclassified 657
7 Ga0068869_100052083 3300005334 Unclassified 2971
8 Ga0068868_100054525 3300005338 Bacteria 3151
9 Ga0070660_100979966 3300005339 Bacteria 714
10 Ga0070668_100310681 3300005347 Bacteria 1324
11 Ga0070671_100267607 3300005355 Bacteria 1453
12 Ga0070659_102030206 3300005366 Unclassified 516
13 Ga0070667_100178419 3300005367 Bacteria 1878
14 Ga0070709_10117134 3300005434 Unclassified 1800
15 Ga0070709_10411853 3300005434 Unclassified 1011
16 Ga0070709_11623267 3300005434 Bacteria 527
17 Ga0070714_100835292 3300005435 Bacteria 893
18 Ga0070713_100867979 3300005436 Bacteria 867
19 Ga0070710_10226050 3300005437 Bacteria 1193
20 Ga0070710_10865964 3300005437 Unclassified 650
21 Ga0070710_10956048 3300005437 Bacteria 622
22 Ga0070710_11194799 3300005437 Bacteria 562
23 Ga0070711_100572931 3300005439 Bacteria 939
24 Ga0070711_100578446 3300005439 Bacteria 935
25 Ga0070705_100448669 3300005440 Bacteria 967
26 Ga0070708_100000597 3300005445 Bacteria 27158
27 Ga0070708_100011558 3300005445 Bacteria 7187
28 Ga0070708_100039480 3300005445 Unclassified 4130
29 Ga0070708_100059533 3300005445 Unclassified 3405
30 Ga0070708_100126521 3300005445 Bacteria 2363
31 Ga0070708_100246495 3300005445 Bacteria 1678
32 Ga0070708_100360412 3300005445 Bacteria 1370
33 Ga0070708_101044601 3300005445 Bacteria 766
34 Ga0070663_100040670 3300005455 Bacteria 3256
35 Ga0070678_101855775 3300005456 Bacteria 569
36 Ga0068867_102411649 3300005459 Bacteria 501
37 Ga0070706_100000217 3300005467 Bacteria 70703
38 Ga0070706_100023771 3300005467 Bacteria 5642
39 Ga0070706_100039258 3300005467 Unclassified 4370
40 Ga0070706_100058677 3300005467 Bacteria 3552
41 Ga0070706_100070188 3300005467 Bacteria 3240
42 Ga0070706_100099661 3300005467 Bacteria 2699
43 Ga0070706_100239102 3300005467 Unclassified 1696
44 Ga0070706_100606574 3300005467 Bacteria 1017
45 Ga0070706_100634862 3300005467 Bacteria 992
46 Ga0070706_102139557 3300005467 Bacteria 506
47 Ga0070707_100010315 3300005468 Bacteria 8698
48 Ga0070707_100035669 3300005468 Bacteria 4745
49 Ga0070707_100226451 3300005468 Bacteria 1821
50 Ga0070707_100470064 3300005468 Bacteria 1219
51 Ga0070707_100786075 3300005468 Unclassified 915
52 Ga0070707_100971436 3300005468 Bacteria 815
53 Ga0070707_101153680 3300005468 Bacteria 741
54 Ga0070698_100019893 3300005471 Bacteria 7041
55 Ga0070698_100033752 3300005471 Bacteria 5301
56 Ga0070698_100089852 3300005471 Bacteria 3055
57 Ga0070698_100162822 3300005471 Bacteria 2174
58 Ga0070698_100164436 3300005471 Bacteria 2162
59 Ga0070698_100461908 3300005471 Bacteria 1205
60 Ga0070698_101204362 3300005471 Bacteria 707
61 Ga0070699_100009650 3300005518 Bacteria 8355
62 Ga0070699_100017203 3300005518 Bacteria 6209
63 Ga0070699_100163977 3300005518 Bacteria 1968
64 Ga0070699_100180481 3300005518 Bacteria 1873
65 Ga0070699_100189953 3300005518 Bacteria 1824
66 Ga0070699_100214621 3300005518 Bacteria 1714
67 Ga0070699_100475691 3300005518 Unclassified 1134
68 Ga0070699_100553208 3300005518 Bacteria 1047
69 Ga0070699_100961539 3300005518 Bacteria 783
70 Ga0070699_101466407 3300005518 Bacteria 626
71 Ga0070697_100004833 3300005536 Bacteria 10331
72 Ga0070697_100012537 3300005536 Bacteria 6642
73 Ga0070697_100052463 3300005536 Bacteria 3313
74 Ga0070697_100094081 3300005536 Bacteria 2482
75 Ga0070697_100109034 3300005536 Bacteria 2305
76 Ga0070697_100253568 3300005536 Bacteria 1505
77 Ga0070697_100355135 3300005536 Unclassified 1266
78 Ga0070697_100394859 3300005536 Bacteria 1199
79 Ga0070697_100837699 3300005536 Bacteria 815
80 Ga0070697_101171295 3300005536 Bacteria 685
81 Ga0068853_100636777 3300005539 Bacteria 1014
82 Ga0070696_101449305 3300005546 Unclassified 586
83 Ga0070696_101911915 3300005546 Unclassified 514
84 Ga0068857_100709598 3300005577 Bacteria 956
85 Ga0068852_100452996 3300005616 Bacteria 1270
86 Ga0068859_100486548 3300005617 Unclassified 1329
87 Ga0068864_100731286 3300005618 Bacteria 969
88 Ga0068861_100135223 3300005719 Unclassified 2005
89 Ga0068858_100069350 3300005842 Unclassified 3268
90 Ga0068858_101028351 3300005842 Bacteria 808
91 Ga0068860_100635911 3300005843 Unclassified 1074
92 Ga0068860_102752173 3300005843 Bacteria 510
93 Ga0068862_100731497 3300005844 Bacteria 961
94 Ga0081455_10472449 3300005937 Bacteria 850
95 Ga0081540_1000019 3300005983 Bacteria 163281
96 Ga0081540_1057522 3300005983 Unclassified 1880
97 Ga0070717_10034231 3300006028 Unclassified 4105
98 Ga0070717_10088782 3300006028 Bacteria 2606
99 Ga0070717_10102443 3300006028 Unclassified 2432
100 Ga0070717_10135897 3300006028 Bacteria 2117
101 Ga0070717_10765763 3300006028 Bacteria 878
102 Ga0070717_11366030 3300006028 Bacteria 644
103 Ga0070717_11613588 3300006028 Bacteria 588
104 Ga0075365_10210593 3300006038 Bacteria 1363
105 Ga0075368_10433048 3300006042 Bacteria 581
106 Ga0075364_10748412 3300006051 Bacteria 667
107 Ga0070715_10629126 3300006163 Unclassified 633
108 Ga0070715_10656242 3300006163 Bacteria 622
109 Ga0070716_100028327 3300006173 Bacteria 3018
110 Ga0070716_100121226 3300006173 Unclassified 1637
111 Ga0070716_100329272 3300006173 Bacteria 1073
112 Ga0070716_100488617 3300006173 Bacteria 906
113 Ga0070712_100065124 3300006175 Bacteria 2586
114 Ga0070712_100125587 3300006175 Bacteria 1937
115 Ga0070712_100173141 3300006175 Bacteria 1676
116 Ga0070712_100359789 3300006175 Bacteria 1193
117 Ga0070712_100516897 3300006175 Bacteria 1002
118 Ga0070712_101448337 3300006175 Bacteria 600
119 Ga0075367_10157924 3300006178 Bacteria 1410
120 Ga0075369_10196356 3300006186 Bacteria 931
121 Ga0075370_10836360 3300006353 Bacteria 562
122 Ga0075431_101359720 3300006847 Unclassified 670
123 Ga0075433_10532180 3300006852 Bacteria 1033
124 Ga0075433_10545410 3300006852 Bacteria 1020
125 Ga0075433_11183285 3300006852 Bacteria 664
126 Ga0075433_11339746 3300006852 Bacteria 620
127 Ga0075434_100004273 3300006871 Bacteria 12816
128 Ga0075434_100028020 3300006871 Bacteria 5532
129 Ga0075434_100095388 3300006871 Bacteria 2980
130 Ga0075434_101342098 3300006871 Bacteria 726
131 Ga0075434_102037476 3300006871 Bacteria 579
132 Ga0075429_100273923 3300006880 Bacteria 1478
133 Ga0068865_100023345 3300006881 Unclassified 4049
134 Ga0097620_100486534 3300006931 Unclassified 1329
135 Ga0075435_100078555 3300007076 Bacteria 2707
136 Ga0075435_100407028 3300007076 Bacteria 1170
137 Ga0075435_101392191 3300007076 Bacteria 615
138 Ga0099794_10000043 3300007265 Bacteria 49721
139 Ga0099794_10065906 3300007265 Bacteria 1767
140 Ga0099794_10083799 3300007265 Bacteria 1576
141 Ga0099794_10306359 3300007265 Bacteria 823
142 Ga0099795_10470544 3300007788 Bacteria 581
143 Ga0111539_10084902 3300009094 Bacteria 3721
144 Ga0105245_10293459 3300009098 Unclassified 1593
145 Ga0105245_10385240 3300009098 Bacteria 1397
146 Ga0114129_10510098 3300009147 Bacteria 1569
147 Ga0114129_10702881 3300009147 Unclassified 1299
148 Ga0114129_10707709 3300009147 Bacteria 1294
149 Ga0114129_10761254 3300009147 Unclassified 1239
150 Ga0114129_10859847 3300009147 Bacteria 1152
151 Ga0114129_11100852 3300009147 Bacteria 995
152 Ga0105243_10550908 3300009148 Bacteria 1102
153 Ga0105242_10637626 3300009176 Bacteria 1034
154 Ga0105248_10269120 3300009177 Bacteria 1918
155 Ga0105248_11480274 3300009177 Bacteria 768
156 Ga0105237_10649569 3300009545 Bacteria 1062
157 Ga0105238_10799289 3300009551 Bacteria 959
158 Ga0105249_10105075 3300009553 Unclassified 2662
159 Ga0105249_10853595 3300009553 Bacteria 976
160 Ga0099796_10237829 3300010159 Bacteria 752
161 Ga0105239_10167839 3300010375 Bacteria 2454
162 Ga0105239_10676275 3300010375 Bacteria 1180
163 Ga0157373_10904481 3300013100 Bacteria 655
164 Ga0157374_10000262 3300013296 Bacteria 48624
165 Ga0157374_11101763 3300013296 Bacteria 814
166 Ga0157378_10042004 3300013297 Bacteria 4057
167 Ga0157378_10251838 3300013297 Unclassified 1691
168 Ga0163162_10098136 3300013306 Unclassified 3019
169 Ga0163162_11181848 3300013306 Bacteria 868
170 Ga0157375_10004773 3300013308 Bacteria 11780
171 Ga0157375_12132288 3300013308 Bacteria 667
172 Ga0157379_11205839 3300014968 Bacteria 728
173 Ga0209564_1008154 3300025295 Bacteria 5238
174 Ga0209758_1000899 3300025297 Bacteria 40410
175 Ga0209758_1022216 3300025297 Bacteria 2922
176 Ga0207426_1006988 3300025302 Bacteria 4795
177 Ga0207426_1010686 3300025302 Bacteria 3548
178 Ga0209257_1140951 3300025304 Bacteria 541
179 Ga0207692_10364990 3300025898 Bacteria 893
180 Ga0207688_10240292 3300025901 Bacteria 1095
181 Ga0207647_10112452 3300025904 Unclassified 1609
182 Ga0207685_10189385 3300025905 Bacteria 959
183 Ga0207699_10307430 3300025906 Bacteria 1109
184 Ga0207699_10432500 3300025906 Bacteria 941
185 Ga0207684_10000062 3300025910 Bacteria 202863
186 Ga0207684_10000307 3300025910 Bacteria 69402
187 Ga0207684_10002917 3300025910 Bacteria 16956
188 Ga0207684_10016701 3300025910 Bacteria 6304
189 Ga0207684_10233124 3300025910 Bacteria 1588
190 Ga0207684_10321095 3300025910 Bacteria 1335
191 Ga0207684_10697291 3300025910 Bacteria 863
192 Ga0207684_10871831 3300025910 Bacteria 758
193 Ga0207684_10891196 3300025910 Bacteria 748
194 Ga0207684_11589017 3300025910 Bacteria 530
195 Ga0207684_11611593 3300025910 Unclassified 525
196 Ga0207693_10073569 3300025915 Bacteria 2675
197 Ga0207693_10079246 3300025915 Bacteria 2570
198 Ga0207693_10142211 3300025915 Bacteria 1886
199 Ga0207693_10236117 3300025915 Bacteria 1435
200 Ga0207693_10347059 3300025915 Bacteria 1162
201 Ga0207663_10203606 3300025916 Bacteria 1429
202 Ga0207663_10302380 3300025916 Bacteria 1196
203 Ga0207663_10639195 3300025916 Bacteria 839
204 Ga0207663_11181908 3300025916 Bacteria 616
205 Ga0207657_10107184 3300025919 Bacteria 2312
206 Ga0207646_10000473 3300025922 Bacteria 53710
207 Ga0207646_10001038 3300025922 Bacteria 35444
208 Ga0207646_10007713 3300025922 Bacteria 10894
209 Ga0207646_10009967 3300025922 Bacteria 9335
210 Ga0207646_10103316 3300025922 Plasmid 2556
211 Ga0207646_10490204 3300025922 Bacteria 1108
212 Ga0207646_10865435 3300025922 Bacteria 803
213 Ga0207646_10970182 3300025922 Bacteria 752
214 Ga0207646_11680655 3300025922 Bacteria 546
215 Ga0207687_10190693 3300025927 Unclassified 1595
216 Ga0207700_10266648 3300025928 Unclassified 1468
217 Ga0207700_11030836 3300025928 Bacteria 736
218 Ga0207664_10349873 3300025929 Bacteria 1308
219 Ga0207686_11572781 3300025934 Unclassified 543
220 Ga0207709_10396536 3300025935 Bacteria 1054
221 Ga0207709_11512512 3300025935 Bacteria 557
222 Ga0207669_10716394 3300025937 Bacteria 824
223 Ga0207665_10043663 3300025939 Bacteria 2997
224 Ga0207665_10324918 3300025939 Unclassified 1155
225 Ga0207711_12005766 3300025941 Bacteria 521
226 Ga0207689_10015161 3300025942 Bacteria 6530
227 Ga0207712_10055581 3300025961 Bacteria 2785
228 Ga0207668_10236259 3300025972 Bacteria 1476
229 Ga0207677_10111166 3300026023 Bacteria 2041
230 Ga0207703_10052005 3300026035 Unclassified 3324
231 Ga0207678_10119340 3300026067 Bacteria 2250
232 Ga0207708_11625967 3300026075 Bacteria 568
233 Ga0207675_101530170 3300026118 Bacteria 688
234 Ga0207698_11303907 3300026142 Bacteria 741
235 Ga0209588_1000061 3300027671 Bacteria 38272
236 Ga0209813_10500388 3300027866 Bacteria 504
237 Ga0268266_10110466 3300028379 Bacteria 2436
238 Ga0268266_11124106 3300028379 Bacteria 760
239 Ga0268265_11115113 3300028380 Bacteria 784
240 Ga0268264_10437770 3300028381 Bacteria 1264
241 Ga0268264_10593984 3300028381 Unclassified 1090
242 Ga0265760_10010402 3300031090 Unclassified 2656
243 Ga0395900_0197073 3300037418 Unclassified 2040
244 Ga0400488_35563 3300038741 Bacteria 5044
245 Ga0451853_3862016 3300041512 Bacteria 740
246 Ga0439448_0183916 3300042005 Bacteria 731
247 Ga0439463_112511 3300042016 Bacteria 703
248 Ga0495639_0234290 3300046475 Bacteria 905
249 Ga0495594_0481904 3300046499 Bacteria 705
250 Ga0495616_0201779 3300046513 Bacteria 874
251 Ga0495586_0438155 3300046535 Bacteria 753
252 Ga0495622_0121910 3300046557 Bacteria 1190
253 Ga0495668_0086335 3300046616 Bacteria 1721
254 Ga0495588_0026767 3300046674 Bacteria 2880
255 Ga0495647_0379132 3300046681 Bacteria 647
256 Ga0495658_0188884 3300046683 Bacteria 1280
257 Ga0495589_0183799 3300046794 Bacteria 991
258 Ga0495680_0718134 3300047322 Bacteria 659
259 Ga0495673_0027889 3300047469 Bacteria 2681
260 Ga0495686_0085259 3300047472 Bacteria 1924
261 Ga0496100_0240267 3300048903 Bacteria 1336
262 Ga0496101_0871481 3300048904 Bacteria 709
263 Ga0496103_0513487 3300048906 Bacteria 766
264 Ga0496104_0249574 3300048907 Bacteria 1687
265 Ga0496106_0323496 3300048909 Bacteria 1238
266 Ga0496107_0552275 3300048910 Bacteria 853
267 Ga0496108_0848948 3300048911 Bacteria 786
268 Ga0496110_0263721 3300048913 Bacteria 1568
269 Ga0496111_0420025 3300048914 Bacteria 988
270 Ga0496112_0047155 3300048915 Unclassified 4227
271 Ga0496112_0122598 3300048915 Bacteria 2570
272 Ga0496113_1153489 3300048916 Bacteria 606
273 Ga0496115_1109419 3300048918 Bacteria 599
274 Ga0496116_0013654 3300048919 Bacteria 6532
275 Ga0496120_0253976 3300048923 Bacteria 824
276 Ga0496121_0020362 3300048924 Bacteria 6573
277 Ga0496121_0116865 3300048924 Bacteria 2022
278 Ga0496122_0035520 3300048925 Bacteria 4052
279 Ga0496123_0485987 3300048926 Bacteria 542
280 Ga0496125_0534135 3300048928 Bacteria 653
281 Ga0496126_0235603 3300048929 Bacteria 1531
282 nmdc:mga00v17_264199_c1 3300050491 Bacteria 1116
283 nmdc:mga0yw44_165588_c1 3300050492 Bacteria 1449
284 nmdc:mga04h51_533912_c1 3300050495 Bacteria 504
285 nmdc:mga07m45_117442_c1 3300050496 Bacteria 1535
286 nmdc:mga05p37_1036069_c1 3300050507 Unclassified 867
287 nmdc:mga05p37_1755695_c1 3300050507 Bacteria 601
288 nmdc:mga05p37_532575_c1 3300050507 Unclassified 1341
289 nmdc:mga05p37_580366_c1 3300050507 Bacteria 1270
290 nmdc:mga05p37_780234_c1 3300050507 Bacteria 1049
291 nmdc:mga08y16_35623_c1 3300050511 Bacteria 5226
292 nmdc:mga0n895_117303_c1 3300050512 Bacteria 2681
293 nmdc:mga0n895_156065_c1 3300050512 Unclassified 2313
294 nmdc:mga0n895_246685_c1 3300050512 Bacteria 1812
295 nmdc:mga0n895_523290_c1 3300050512 Bacteria 1193
296 nmdc:mga0n895_54181_c1 3300050512 Bacteria 3944
297 nmdc:mga0n895_648013_c1 3300050512 Bacteria 1055
298 nmdc:mga0rr50_104298_c1 3300050513 Bacteria 2233
299 nmdc:mga0rr50_1151098_c1 3300050513 Bacteria 659
300 nmdc:mga0rr50_308632_c1 3300050513 Bacteria 1325
301 nmdc:mga0rr50_548954_c1 3300050513 Bacteria 984
302 nmdc:mga0rr50_606100_c1 3300050513 Bacteria 934
303 nmdc:mga0a205_442222_c1 3300050515 Unclassified 1161
304 nmdc:mga0a205_480268_c1 3300050515 Bacteria 1101
305 nmdc:mga0a205_506062_c1 3300050515 Bacteria 1064
306 nmdc:mga0sz30_2490_c1 3300050516 Bacteria 5323
307 Ga0500616_0091998 3300053153 Unclassified 1500
308 2528851354 2528768022 Bacteria 10457665
309 2824611058 2824609381 Bacteria 8672835
310 2824663721 2824661429 Bacteria 9877870
311 2879106602 2879099564 Bacteria 10442239
312 2888422198 2888419890 Bacteria 7857137
313 2922377498
314 2929622288 2929615660 Bacteria 9193770
315 2929630066 2929624759 Bacteria 9339455
316 2932788001 2932784394 Bacteria 9704911
317 2932813376 2932809354 Bacteria 9135765
318 2932820073 2932818245 Bacteria 9955613
319 2932832863 2932828146 Bacteria 9745859
320 2933584098 2933577622 Bacteria 9116884
321 2935620347 2935616580 Bacteria 9032984
322 2935640672 2935638405 Bacteria 10015038
323 2935650236 2935648319 Bacteria 8801166
324 2935658383 2935656913 Bacteria 8965014
325 2935668865 2935665750 Bacteria 9571747
326 2935681410 2935675223 Bacteria 9928132
327 2935687172 2935684952 Bacteria 9590419
328 2935696857 2935694250 Bacteria 9291695
329 2935709052 2935703347 Bacteria 10242284
330 2935716860 2935713505 Bacteria 9608509
331 2935723015 2935722832 Bacteria 9608746
332 2935734572 2935732158 Bacteria 9706831
333 2935744637 2935741537 Bacteria 9707219
334 2935753138 2935750917 Bacteria 9590372
335 2935767543 2935760218 Bacteria 9817913
336 2935783618 2935777560 Bacteria 8077691
337 2935804782 2935801545 Bacteria 9301974
338 2935815931 2935810662 Bacteria 9401221
339 2935832179 2935827899 Bacteria 10038562
340 2935840991 2935837841 Bacteria 9454360
341 2935859233 2935855204 Bacteria 9035059
342 2935864417 2935864058 Bacteria 9784707
343 2935875231 2935873716 Bacteria 9632195
344 2935995795 2935992306 Bacteria 9802711
345 2936005706 2936002035 Bacteria 9362176
346 2936013205 2936011229 Bacteria 8801034
347 2936021708 2936019824 Bacteria 8804134
348 2936030498 2936028420 Bacteria 8965941
349 2936041834 2936037263 Bacteria 9446081
350 2936047902 2936046547 Bacteria 8903709
351 2936057904 2936055302 Bacteria 8785755
352 2940559051 2940556831 Bacteria 9590747
353 2941533313 2941531003 Bacteria 7653939
354 2941541747 2941538514 Bacteria 9402094
355 8016517348 8016511872 Bacteria 9921665
356 8016609862 8016603502 Bacteria 8731218
357 8016615078 8016613128 Bacteria 8794220
358 8017059257 8017057580 Bacteria 10023680
359 8019545506 8019538911 Bacteria 7872763
360 8019576373 8019576017 Bacteria 10049540
361 8019594250 8019586578 Bacteria 10212056
362 8019607317 8019597564 Bacteria 10041141
363 8019611203 8019608314 Bacteria 10042931
364 8055743463 8055742211 Bacteria 9226248
365 Ga0207693_10410630
366 JGI25153J46596_10018011
367 rootL2_10087879
368 JGI25404J52841_10023092
369 Ga0065165_1006510
370 Ga0065715_10692378
371 Ga0068869_100052083
372 Ga0068868_100054525
373 Ga0070660_100979966
374 Ga0070668_100310681
375 Ga0070671_100267607
376 Ga0070659_102030206
377 Ga0070667_100178419
378 Ga0070709_10117134
379 Ga0070709_10411853
380 Ga0070709_11623267
381 Ga0070714_100835292
382 Ga0070713_100867979
383 Ga0070710_10226050
384 Ga0070710_10865964
385 Ga0070710_10956048
386 Ga0070710_11194799
387 Ga0070711_100572931
388 Ga0070711_100578446
389 Ga0070705_100448669
390 Ga0070708_100000597
391 Ga0070708_100011558
392 Ga0070708_100039480
393 Ga0070708_100059533
394 Ga0070708_100126521
395 Ga0070708_100246495
396 Ga0070708_100360412
397 Ga0070708_101044601
398 Ga0070663_100040670
399 Ga0070678_101855775
400 Ga0068867_102411649
401 Ga0070706_100000217
402 Ga0070706_100023771
403 Ga0070706_100039258
404 Ga0070706_100058677
405 Ga0070706_100070188
406 Ga0070706_100099661
407 Ga0070706_100239102
408 Ga0070706_100606574
409 Ga0070706_100634862
410 Ga0070706_102139557
411 Ga0070707_100010315
412 Ga0070707_100035669
413 Ga0070707_100226451
414 Ga0070707_100470064
415 Ga0070707_100786075
416 Ga0070707_100971436
417 Ga0070707_101153680
418 Ga0070698_100019893
419 Ga0070698_100033752
420 Ga0070698_100089852
421 Ga0070698_100162822
422 Ga0070698_100164436
423 Ga0070698_100461908
424 Ga0070698_101204362
425 Ga0070699_100009650
426 Ga0070699_100017203
427 Ga0070699_100163977
428 Ga0070699_100180481
429 Ga0070699_100189953
430 Ga0070699_100214621
431 Ga0070699_100475691
432 Ga0070699_100553208
433 Ga0070699_100961539
434 Ga0070699_101466407
435 Ga0070697_100004833
436 Ga0070697_100012537
437 Ga0070697_100052463
438 Ga0070697_100094081
439 Ga0070697_100109034
440 Ga0070697_100253568
441 Ga0070697_100355135
442 Ga0070697_100394859
443 Ga0070697_100837699
444 Ga0070697_101171295
445 Ga0068853_100636777
446 Ga0070696_101449305
447 Ga0070696_101911915
448 Ga0068857_100709598
449 Ga0068852_100452996
450 Ga0068859_100486548
451 Ga0068864_100731286
452 Ga0068861_100135223
453 Ga0068858_100069350
454 Ga0068858_101028351
455 Ga0068860_100635911
456 Ga0068860_102752173
457 Ga0068862_100731497
458 Ga0081455_10472449
459 Ga0081540_1000019
460 Ga0081540_1057522
461 Ga0070717_10034231
462 Ga0070717_10088782
463 Ga0070717_10102443
464 Ga0070717_10135897
465 Ga0070717_10765763
466 Ga0070717_11366030
467 Ga0070717_11613588
468 Ga0075365_10210593
469 Ga0075368_10433048
470 Ga0075364_10748412
471 Ga0070715_10629126
472 Ga0070715_10656242
473 Ga0070716_100028327
474 Ga0070716_100121226
475 Ga0070716_100329272
476 Ga0070716_100488617
477 Ga0070712_100065124
478 Ga0070712_100125587
479 Ga0070712_100173141
480 Ga0070712_100359789
481 Ga0070712_100516897
482 Ga0070712_101448337
483 Ga0075367_10157924
484 Ga0075369_10196356
485 Ga0075370_10836360
486 Ga0075431_101359720
487 Ga0075433_10532180
488 Ga0075433_10545410
489 Ga0075433_11183285
490 Ga0075433_11339746
491 Ga0075434_100004273
492 Ga0075434_100028020
493 Ga0075434_100095388
494 Ga0075434_101342098
495 Ga0075434_102037476
496 Ga0075429_100273923
497 Ga0068865_100023345
498 Ga0097620_100486534
499 Ga0075435_100078555
500 Ga0075435_100407028
501 Ga0075435_101392191
502 Ga0099794_10000043
503 Ga0099794_10065906
504 Ga0099794_10083799
505 Ga0099794_10306359
506 Ga0099795_10470544
507 Ga0111539_10084902
508 Ga0105245_10293459
509 Ga0105245_10385240
510 Ga0114129_10510098
511 Ga0114129_10702881
512 Ga0114129_10707709
513 Ga0114129_10761254
514 Ga0114129_10859847
515 Ga0114129_11100852
516 Ga0105243_10550908
517 Ga0105242_10637626
518 Ga0105248_10269120
519 Ga0105248_11480274
520 Ga0105237_10649569
521 Ga0105238_10799289
522 Ga0105249_10105075
523 Ga0105249_10853595
524 Ga0099796_10237829
525 Ga0105239_10167839
526 Ga0105239_10676275
527 Ga0157373_10904481
528 Ga0157374_10000262
529 Ga0157374_11101763
530 Ga0157378_10042004
531 Ga0157378_10251838
532 Ga0163162_10098136
533 Ga0163162_11181848
534 Ga0157375_10004773
535 Ga0157375_12132288
536 Ga0157379_11205839
537 Ga0209564_1008154
538 Ga0209758_1000899
539 Ga0209758_1022216
540 Ga0207426_1006988
541 Ga0207426_1010686
542 Ga0209257_1140951
543 Ga0207692_10364990
544 Ga0207688_10240292
545 Ga0207647_10112452
546 Ga0207685_10189385
547 Ga0207699_10307430
548 Ga0207699_10432500
549 Ga0207684_10000062
550 Ga0207684_10000307
551 Ga0207684_10002917
552 Ga0207684_10016701
553 Ga0207684_10233124
554 Ga0207684_10321095
555 Ga0207684_10697291
556 Ga0207684_10871831
557 Ga0207684_10891196
558 Ga0207684_11589017
559 Ga0207684_11611593
560 Ga0207693_10073569
561 Ga0207693_10079246
562 Ga0207693_10142211
563 Ga0207693_10236117
564 Ga0207693_10347059
565 Ga0207663_10203606
566 Ga0207663_10302380
567 Ga0207663_10639195
568 Ga0207663_11181908
569 Ga0207657_10107184
570 Ga0207646_10000473
571 Ga0207646_10001038
572 Ga0207646_10007713
573 Ga0207646_10009967
574 Ga0207646_10103316
575 Ga0207646_10490204
576 Ga0207646_10865435
577 Ga0207646_10970182
578 Ga0207646_11680655
579 Ga0207687_10190693
580 Ga0207700_10266648
581 Ga0207700_11030836
582 Ga0207664_10349873
583 Ga0207686_11572781
584 Ga0207709_10396536
585 Ga0207709_11512512
586 Ga0207669_10716394
587 Ga0207665_10043663
588 Ga0207665_10324918
589 Ga0207711_12005766
590 Ga0207689_10015161
591 Ga0207712_10055581
592 Ga0207668_10236259
593 Ga0207677_10111166
594 Ga0207703_10052005
595 Ga0207678_10119340
596 Ga0207708_11625967
597 Ga0207675_101530170
598 Ga0207698_11303907
599 Ga0209588_1000061
600 Ga0209813_10500388
601 Ga0268266_10110466
602 Ga0268266_11124106
603 Ga0268265_11115113
604 Ga0268264_10437770
605 Ga0268264_10593984
606 Ga0265760_10010402
607 Ga0395900_0197073
608 Ga0400488_35563
609 Ga0451853_3862016
610 Ga0439448_0183916
611 Ga0439463_112511
612 Ga0495639_0234290
613 Ga0495594_0481904
614 Ga0495616_0201779
615 Ga0495586_0438155
616 Ga0495622_0121910
617 Ga0495668_0086335
618 Ga0495588_0026767
619 Ga0495647_0379132
620 Ga0495658_0188884
621 Ga0495589_0183799
622 Ga0495680_0718134
623 Ga0495673_0027889
624 Ga0495686_0085259
625 Ga0496100_0240267
626 Ga0496101_0871481
627 Ga0496103_0513487
628 Ga0496104_0249574
629 Ga0496106_0323496
630 Ga0496107_0552275
631 Ga0496108_0848948
632 Ga0496110_0263721
633 Ga0496111_0420025
634 Ga0496112_0047155
635 Ga0496112_0122598
636 Ga0496113_1153489
637 Ga0496115_1109419
638 Ga0496116_0013654
639 Ga0496120_0253976
640 Ga0496121_0020362
641 Ga0496121_0116865
642 Ga0496122_0035520
643 Ga0496123_0485987
644 Ga0496125_0534135
645 Ga0496126_0235603
646 nmdc:mga00v17_264199_c1
647 nmdc:mga0yw44_165588_c1
648 nmdc:mga04h51_533912_c1
649 nmdc:mga07m45_117442_c1
650 nmdc:mga05p37_1036069_c1
651 nmdc:mga05p37_1755695_c1
652 nmdc:mga05p37_532575_c1
653 nmdc:mga05p37_580366_c1
654 nmdc:mga05p37_780234_c1
655 nmdc:mga08y16_35623_c1
656 nmdc:mga0n895_117303_c1
657 nmdc:mga0n895_156065_c1
658 nmdc:mga0n895_246685_c1
659 nmdc:mga0n895_523290_c1
660 nmdc:mga0n895_54181_c1
661 nmdc:mga0n895_648013_c1
662 nmdc:mga0rr50_104298_c1
663 nmdc:mga0rr50_1151098_c1
664 nmdc:mga0rr50_308632_c1
665 nmdc:mga0rr50_548954_c1
666 nmdc:mga0rr50_606100_c1
667 nmdc:mga0a205_442222_c1
668 nmdc:mga0a205_480268_c1
669 nmdc:mga0a205_506062_c1
670 nmdc:mga0sz30_2490_c1
671 Ga0500616_0091998
672 2528851354
673 2824611058
674 2824663721
675 2879106602
676 2888422198
677 2922377498
678 2929622288
679 2929630066
680 2932788001
681 2932813376
682 2932820073
683 2932832863
684 2933584098
685 2935620347
686 2935640672
687 2935650236
688 2935658383
689 2935668865
690 2935681410
691 2935687172
692 2935696857
693 2935709052
694 2935716860
695 2935723015
696 2935734572
697 2935744637
698 2935753138
699 2935767543
700 2935783618
701 2935804782
702 2935815931
703 2935832179
704 2935840991
705 2935859233
706 2935864417
707 2935875231
708 2935995795
709 2936005706
710 2936013205
711 2936021708
712 2936030498
713 2936041834
714 2936047902
715 2936057904
716 2940559051
717 2941533313
718 2941541747
719 8016517348
720 8016609862
721 8016615078
722 8017059257
723 8019545506
724 8019576373
725 8019594250
726 8019607317
727 8019611203
728 8055743463

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00699

Urease_beta

Urease beta subunit

3

100

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kns-assembly1.cif.gz_F cryo-em structure of jack bean urease 0.9451 23 92
4goa-assembly1.cif.gz_A crystal structure of jack bean urease inhibited with fluoride 0.932 19 92
4gy7-assembly1.cif.gz_A crystallographic structure analysis of urease from jack bean (canavalia ensiformis) at 1.49 a resolution 0.8756 18 92
4g7e-assembly1.cif.gz_B-3 crystal structure of pigeon pea urease 0.8748 18 92
3qga-assembly1.cif.gz_A 3.0 a model of iron containing urease urea2b2 from helicobacter mustelae 0.8472 8 92
ID Description Score Start End Superfamily
3la4A03 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.8988 23 92 2.10.150.10
3qgaA02 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.8472 8 92 2.10.150.10
1s3tB00 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.7833 1 92 2.10.150.10
1a5kB00 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.7332 1 101 2.10.150.10
1a5kB00 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.7272 1 101 2.10.150.10
ID Description Score Start End GO Terms
AF-A0A3C0N2Z2-F1-model_v4 Urease subunit beta 1.007 27 77 GO:0009039
GO:0035550
GO:0043419
AF-A0A7S0HBB0-F1-model_v4 Urease alpha-subunit N-terminal domain-containing protein 1.003 25 86 GO:0016810
GO:0035550
GO:0043419
GO:0046872
AF-A0A7S0UIM6-F1-model_v4 urease (EC 3.5.1.5) 1.002 25 86 GO:0009039
GO:0016151
GO:0035550
GO:0043419
AF-A0A0F7GA08-F1-model_v4 Urease B (EC 3.5.1.5) 0.9818 19 81 GO:0009039
GO:0035550
GO:0043419
AF-A0A821ZK10-F1-model_v4 Urease 0.978 30 88 GO:0016787
GO:0035550
GO:0043419

Map