F423308

General Info

Members Datasets Scaffolds Average Seq Length
364 179 728 54

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10361741|Ga0105239_103617413
Length 50
Sequence MMERWAYEDVLAFAQSWGAVYFTVMFYAWWPKNRPRFEQAAQIPLQDEDA

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
69 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
119 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
120 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
148 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
176 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
177 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
178 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.12
Nodule 0
Rhizoplane 0.55
Rhizosphere 93.96
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10361741 3300010375 Bacteria 1639
2 JGI25165J46597_1000017 3300003214 Bacteria 377013
3 JGI25153J46596_10000522 3300003215 Bacteria 24228
4 rootH1_10075520 3300003323 Bacteria 1063
5 Ga0055525_1016873 3300003759 Bacteria 619
6 Ga0070658_10005086 3300005327 Bacteria 10700
7 Ga0070658_10036256 3300005327 Bacteria 3975
8 Ga0070658_11024422 3300005327 Bacteria 718
9 Ga0070658_11470943 3300005327 Bacteria 591
10 Ga0070683_100963502 3300005329 Bacteria 819
11 Ga0070670_100256115 3300005331 Bacteria 1525
12 Ga0070670_101396169 3300005331 Bacteria 642
13 Ga0070670_102073846 3300005331 Bacteria 524
14 Ga0070666_10098809 3300005335 Bacteria 2010
15 Ga0070666_10130665 3300005335 Bacteria 1745
16 Ga0070680_100211422 3300005336 Bacteria 1636
17 Ga0068868_100210105 3300005338 Bacteria 1626
18 Ga0070660_100083563 3300005339 Bacteria 2508
19 Ga0070660_100729640 3300005339 Bacteria 831
20 Ga0070691_10080634 3300005341 Bacteria 1593
21 Ga0070691_10374649 3300005341 Bacteria 796
22 Ga0070661_100607189 3300005344 Bacteria 885
23 Ga0070661_100928696 3300005344 Bacteria 719
24 Ga0070661_100994398 3300005344 Bacteria 696
25 Ga0070668_100612880 3300005347 Bacteria 953
26 Ga0070669_100796158 3300005353 Bacteria 803
27 Ga0070671_101035462 3300005355 Bacteria 720
28 Ga0070667_100367342 3300005367 Bacteria 1305
29 Ga0070714_100003688 3300005435 Bacteria 11467
30 Ga0070713_101412654 3300005436 Bacteria 675
31 Ga0070678_100235985 3300005456 Bacteria 1527
32 Ga0070678_100362846 3300005456 Bacteria 1249
33 Ga0068867_102141811 3300005459 Unclassified 530
34 Ga0070679_100012083 3300005530 Bacteria 8246
35 Ga0070679_100187921 3300005530 Bacteria 2035
36 Ga0070679_101744865 3300005530 Bacteria 571
37 Ga0070684_100369267 3300005535 Bacteria 1321
38 Ga0068853_100081166 3300005539 Bacteria 2839
39 Ga0068853_100599534 3300005539 Bacteria 1046
40 Ga0068853_101039004 3300005539 Bacteria 789
41 Ga0068853_101225688 3300005539 Bacteria 725
42 Ga0068853_101263402 3300005539 Bacteria 713
43 Ga0070686_101624301 3300005544 Bacteria 547
44 Ga0070693_100530995 3300005547 Bacteria 839
45 Ga0070665_100000737 3300005548 Bacteria 43602
46 Ga0070665_100017359 3300005548 Bacteria 7224
47 Ga0070665_100064093 3300005548 Bacteria 3685
48 Ga0070665_100268712 3300005548 Bacteria 1707
49 Ga0070665_100713111 3300005548 Bacteria 1016
50 Ga0068855_100000063 3300005563 Bacteria 131058
51 Ga0068855_100010273 3300005563 Bacteria 11289
52 Ga0068857_100165874 3300005577 Bacteria 2006
53 Ga0068857_100479859 3300005577 Bacteria 1165
54 Ga0068857_101976816 3300005577 Bacteria 572
55 Ga0068854_100536525 3300005578 Bacteria 990
56 Ga0068856_100062829 3300005614 Bacteria 3668
57 Ga0068856_100154722 3300005614 Bacteria 2303
58 Ga0068856_101311321 3300005614 Bacteria 739
59 Ga0068856_101674199 3300005614 Bacteria 649
60 Ga0068856_101896502 3300005614 Bacteria 607
61 Ga0068856_102613901 3300005614 Bacteria 511
62 Ga0068852_100055429 3300005616 Bacteria 3422
63 Ga0068852_100174909 3300005616 Bacteria 2015
64 Ga0068852_101703780 3300005616 Bacteria 653
65 Ga0068852_102438120 3300005616 Bacteria 543
66 Ga0068859_100092783 3300005617 Bacteria 3071
67 Ga0068864_100676872 3300005618 Bacteria 1006
68 Ga0068864_101150578 3300005618 Bacteria 773
69 Ga0068861_100412952 3300005719 Bacteria 1201
70 Ga0068863_100008303 3300005841 Bacteria 10146
71 Ga0068863_102002675 3300005841 Bacteria 589
72 Ga0068858_100135925 3300005842 Bacteria 2307
73 Ga0075365_11173904 3300006038 Bacteria 540
74 Ga0097621_100020177 3300006237 Bacteria 5133
75 Ga0097621_100472917 3300006237 Bacteria 1132
76 Ga0097621_100950217 3300006237 Bacteria 802
77 Ga0097621_101510125 3300006237 Bacteria 638
78 Ga0068871_100173081 3300006358 Bacteria 1852
79 Ga0068871_100325612 3300006358 Bacteria 1354
80 Ga0068871_101032410 3300006358 Bacteria 767
81 Ga0068871_102364777 3300006358 Bacteria 507
82 Ga0068865_100014354 3300006881 Bacteria 5032
83 Ga0068865_102114250 3300006881 Bacteria 512
84 Ga0097620_100092782 3300006931 Bacteria 3071
85 Ga0105240_10001135 3300009093 Bacteria 46650
86 Ga0105240_10011146 3300009093 Bacteria 12562
87 Ga0105240_10013892 3300009093 Bacteria 11029
88 Ga0105240_10018215 3300009093 Bacteria 9440
89 Ga0105240_10023481 3300009093 Bacteria 8154
90 Ga0105240_10034776 3300009093 Bacteria 6497
91 Ga0105240_10111511 3300009093 Bacteria 3309
92 Ga0105245_10449829 3300009098 Bacteria 1296
93 Ga0105245_10605961 3300009098 Bacteria 1122
94 Ga0105245_11823128 3300009098 Bacteria 661
95 Ga0105247_10053310 3300009101 Bacteria 2495
96 Ga0105243_10470347 3300009148 Bacteria 1184
97 Ga0105241_10084261 3300009174 Bacteria 2496
98 Ga0105241_10119384 3300009174 Bacteria 2121
99 Ga0105241_10172933 3300009174 Bacteria 1785
100 Ga0105241_10189733 3300009174 Bacteria 1710
101 Ga0105241_10251513 3300009174 Bacteria 1498
102 Ga0105241_11147911 3300009174 Bacteria 734
103 Ga0105241_11340115 3300009174 Bacteria 683
104 Ga0105242_11490930 3300009176 Bacteria 707
105 Ga0105242_11977391 3300009176 Bacteria 625
106 Ga0105248_10000001 3300009177 Bacteria 1881304
107 Ga0105248_10000433 3300009177 Bacteria 47479
108 Ga0105248_10332333 3300009177 Bacteria 1711
109 Ga0105248_10664541 3300009177 Bacteria 1176
110 Ga0105237_10078317 3300009545 Bacteria 3295
111 Ga0105237_10450494 3300009545 Bacteria 1293
112 Ga0105237_10510781 3300009545 Bacteria 1208
113 Ga0105237_11071441 3300009545 Bacteria 813
114 Ga0105237_11439425 3300009545 Bacteria 696
115 Ga0105237_12036095 3300009545 Bacteria 583
116 Ga0105237_12329690 3300009545 Bacteria 545
117 Ga0105238_10029549 3300009551 Bacteria 5583
118 Ga0105238_10035061 3300009551 Bacteria 5103
119 Ga0105238_10068804 3300009551 Bacteria 3541
120 Ga0105238_10172945 3300009551 Bacteria 2136
121 Ga0105238_10199389 3300009551 Bacteria 1977
122 Ga0105238_10337463 3300009551 Bacteria 1495
123 Ga0105238_10371184 3300009551 Bacteria 1421
124 Ga0105238_11477421 3300009551 Bacteria 708
125 Ga0105249_10040881 3300009553 Bacteria 4213
126 Ga0105028_130428 3300009993 Bacteria 601
127 Ga0105239_10002901 3300010375 Bacteria 21418
128 Ga0105239_10004366 3300010375 Bacteria 16943
129 Ga0105239_10015472 3300010375 Bacteria 8451
130 Ga0105239_10367197 3300010375 Bacteria 1626
131 Ga0105239_10925833 3300010375 Bacteria 1001
132 Ga0105239_12661154 3300010375 Bacteria 584
133 Ga0105246_10740741 3300011119 Bacteria 866
134 Ga0157370_10008611 3300013104 Bacteria 10985
135 Ga0157369_10004877 3300013105 Bacteria 15741
136 Ga0157369_10143810 3300013105 Bacteria 2522
137 Ga0157369_10426609 3300013105 Bacteria 1374
138 Ga0157369_10977846 3300013105 Bacteria 867
139 Ga0157374_10841050 3300013296 Bacteria 934
140 Ga0157374_11271711 3300013296 Bacteria 758
141 Ga0157378_10135403 3300013297 Bacteria 2284
142 Ga0157378_10438989 3300013297 Bacteria 1293
143 Ga0157378_11471716 3300013297 Bacteria 725
144 Ga0163162_10136149 3300013306 Bacteria 2567
145 Ga0163162_12042574 3300013306 Bacteria 657
146 Ga0157372_10401063 3300013307 Bacteria 1598
147 Ga0157372_12324610 3300013307 Bacteria 616
148 Ga0157372_12461116 3300013307 Bacteria 598
149 Ga0157375_10066664 3300013308 Bacteria 3595
150 Ga0157375_11834712 3300013308 Bacteria 719
151 Ga0157375_13784967 3300013308 Bacteria 502
152 Ga0157380_11166262 3300014326 Bacteria 812
153 Ga0157377_11266603 3300014745 Bacteria 574
154 Ga0157379_10000441 3300014968 Bacteria 33650
155 Ga0157379_10031120 3300014968 Bacteria 4754
156 Ga0157376_10276519 3300014969 Bacteria 1580
157 Ga0163161_11769281 3300017792 Bacteria 549
158 Ga0213874_10065884 3300021377 Bacteria 1145
159 Ga0209563_111457 3300025230 Bacteria 1250
160 Ga0209233_1000006 3300025261 Bacteria 1473685
161 Ga0209233_1005148 3300025261 Bacteria 4371
162 Ga0209758_1000085 3300025297 Bacteria 256191
163 Ga0209758_1164174 3300025297 Bacteria 549
164 Ga0207656_10336287 3300025321 Bacteria 752
165 Ga0207682_10357862 3300025893 Unclassified 688
166 Ga0207680_10078674 3300025903 Bacteria 2066
167 Ga0207680_10263240 3300025903 Bacteria 1194
168 Ga0207645_10631009 3300025907 Archaea 728
169 Ga0207705_10002686 3300025909 Bacteria 13614
170 Ga0207705_10074306 3300025909 Bacteria 2467
171 Ga0207654_10017449 3300025911 Bacteria 3752
172 Ga0207654_10150100 3300025911 Bacteria 1495
173 Ga0207654_10211569 3300025911 Bacteria 1282
174 Ga0207654_10340092 3300025911 Bacteria 1031
175 Ga0207654_10414449 3300025911 Bacteria 939
176 Ga0207654_10641236 3300025911 Bacteria 760
177 Ga0207654_10999902 3300025911 Bacteria 608
178 Ga0207707_10688897 3300025912 Bacteria 859
179 Ga0207695_10000003 3300025913 Bacteria 1368691
180 Ga0207695_10018276 3300025913 Bacteria 8112
181 Ga0207695_10043710 3300025913 Bacteria 4773
182 Ga0207695_10048376 3300025913 Bacteria 4491
183 Ga0207695_10104180 3300025913 Bacteria 2827
184 Ga0207695_10303021 3300025913 Bacteria 1489
185 Ga0207671_10088948 3300025914 Bacteria 2324
186 Ga0207671_10099316 3300025914 Bacteria 2203
187 Ga0207671_11355947 3300025914 Bacteria 552
188 Ga0207660_10122899 3300025917 Bacteria 1968
189 Ga0207657_10028302 3300025919 Bacteria 5115
190 Ga0207657_10060612 3300025919 Bacteria 3246
191 Ga0207649_10574352 3300025920 Bacteria 865
192 Ga0207652_10014562 3300025921 Bacteria 6374
193 Ga0207652_10083100 3300025921 Bacteria 2804
194 Ga0207694_10000005 3300025924 Bacteria 823704
195 Ga0207694_10046774 3300025924 Bacteria 3345
196 Ga0207694_10102142 3300025924 Bacteria 2273
197 Ga0207694_10187679 3300025924 Bacteria 1678
198 Ga0207694_11372079 3300025924 Bacteria 597
199 Ga0207694_11814290 3300025924 Bacteria 512
200 Ga0207650_11081731 3300025925 Bacteria 682
201 Ga0207659_11364073 3300025926 Bacteria 608
202 Ga0207687_10364437 3300025927 Bacteria 1180
203 Ga0207700_11348240 3300025928 Bacteria 635
204 Ga0207664_10017496 3300025929 Bacteria 5257
205 Ga0207664_10697661 3300025929 Bacteria 913
206 Ga0207644_10515265 3300025931 Bacteria 988
207 Ga0207686_10010958 3300025934 Bacteria 4946
208 Ga0207709_10312670 3300025935 Bacteria 1172
209 Ga0207669_10332316 3300025937 Bacteria 1167
210 Ga0207669_11411935 3300025937 Bacteria 593
211 Ga0207704_10255415 3300025938 Bacteria 1318
212 Ga0207704_11626217 3300025938 Bacteria 555
213 Ga0207711_10000002 3300025941 Bacteria 1228676
214 Ga0207711_10003393 3300025941 Bacteria 13791
215 Ga0207711_10404316 3300025941 Bacteria 1269
216 Ga0207711_11658911 3300025941 Bacteria 583
217 Ga0207661_10762291 3300025944 Bacteria 891
218 Ga0207667_10000183 3300025949 Bacteria 91183
219 Ga0207667_10024334 3300025949 Bacteria 6649
220 Ga0207667_10342026 3300025949 Bacteria 1527
221 Ga0207712_10015543 3300025961 Bacteria 4914
222 Ga0207640_10305738 3300025981 Bacteria 1260
223 Ga0207658_10381044 3300025986 Bacteria 1235
224 Ga0207677_10175425 3300026023 Bacteria 1681
225 Ga0207677_11893273 3300026023 Bacteria 554
226 Ga0207703_10023157 3300026035 Bacteria 4877
227 Ga0207639_10257735 3300026041 Bacteria 1524
228 Ga0207678_10701717 3300026067 Bacteria 891
229 Ga0207702_10079563 3300026078 Bacteria 2841
230 Ga0207702_11932991 3300026078 Bacteria 581
231 Ga0207641_10446941 3300026088 Bacteria 1248
232 Ga0207641_10644691 3300026088 Bacteria 1040
233 Ga0207648_10576143 3300026089 Bacteria 1036
234 Ga0207676_11110288 3300026095 Bacteria 782
235 Ga0207674_10060801 3300026116 Bacteria 3819
236 Ga0207674_10830644 3300026116 Bacteria 891
237 Ga0207675_100750520 3300026118 Bacteria 987
238 Ga0207683_10177458 3300026121 Bacteria 1931
239 Ga0207683_10515143 3300026121 Bacteria 1105
240 Ga0207698_10050006 3300026142 Bacteria 3186
241 Ga0207698_10373170 3300026142 Bacteria 1355
242 Ga0207698_10494497 3300026142 Bacteria 1189
243 Ga0268266_10000316 3300028379 Bacteria 76523
244 Ga0268266_10006188 3300028379 Bacteria 10993
245 Ga0268266_10053330 3300028379 Bacteria 3473
246 Ga0268266_10622865 3300028379 Bacteria 1037
247 Ga0268266_11305001 3300028379 Bacteria 701
248 Ga0268266_11665842 3300028379 Bacteria 613
249 Ga0268265_11173239 3300028380 Bacteria 765
250 Ga0265318_10011192 3300028577 Bacteria 3874
251 Ga0265338_10078991 3300028800 Bacteria 2771
252 Ga0265338_10338965 3300028800 Bacteria 1084
253 Ga0265338_11189777 3300028800 Bacteria 511
254 Ga0265332_10067724 3300031238 Bacteria 1522
255 Ga0265332_10108386 3300031238 Bacteria 1171
256 Ga0265332_10403881 3300031238 Bacteria 564
257 Ga0265328_10201444 3300031239 Bacteria 756
258 Ga0265320_10094204 3300031240 Bacteria 1385
259 Ga0265320_10118736 3300031240 Bacteria 1207
260 Ga0265325_10148170 3300031241 Bacteria 1112
261 Ga0265340_10081751 3300031247 Bacteria 1520
262 Ga0265339_10012681 3300031249 Bacteria 5131
263 Ga0265339_10327742 3300031249 Bacteria 725
264 Ga0265331_10000003 3300031250 Bacteria 499358
265 Ga0265331_10047798 3300031250 Bacteria 2059
266 Ga0265331_10064335 3300031250 Bacteria 1726
267 Ga0265331_10406449 3300031250 Bacteria 611
268 Ga0265316_10062468 3300031344 Bacteria 2890
269 Ga0265313_10002874 3300031595 Bacteria 14436
270 Ga0265313_10375350 3300031595 Bacteria 561
271 Ga0265314_10003106 3300031711 Bacteria 16342
272 Ga0265314_10029539 3300031711 Bacteria 4072
273 Ga0265314_10044682 3300031711 Bacteria 3138
274 Ga0265314_10063124 3300031711 Bacteria 2514
275 Ga0265342_10337293 3300031712 Bacteria 787
276 Ga0307516_10203131 3300031730 Bacteria 1700
277 Ga0373936_0621353 3300035113 Bacteria 508
278 Ga0373942_0061871 3300035207 Bacteria 1075
279 Ga0395898_0294706 3300037466 Bacteria 1548
280 Ga0436365_0685821 3300039437 Bacteria 986
281 Ga0436363_1288436 3300039450 Bacteria 14211
282 Ga0451807_2126899 3300041486 Bacteria 643
283 Ga0495617_091056 3300046452 Bacteria 995
284 Ga0495628_0256677 3300046516 Bacteria 1304
285 Ga0495652_1108388 3300046529 Bacteria 514
286 Ga0495586_0519029 3300046535 Bacteria 688
287 Ga0495587_0364052 3300046536 Bacteria 805
288 Ga0495587_0670629 3300046536 Bacteria 569
289 Ga0495609_0051893 3300046538 Bacteria 1825
290 Ga0495621_0034981 3300046539 Bacteria 1738
291 Ga0495621_0103077 3300046539 Bacteria 1088
292 Ga0495645_0454823 3300046543 Bacteria 807
293 Ga0495622_0012545 3300046557 Bacteria 3925
294 Ga0495599_0323020 3300046678 Bacteria 929
295 Ga0495670_0201271 3300046691 Bacteria 1055
296 Ga0495671_0282208 3300046692 Bacteria 800
297 Ga0495671_0471069 3300046692 Bacteria 600
298 Ga0495589_0139838 3300046794 Bacteria 1160
299 Ga0495600_0163997 3300046809 Bacteria 1436
300 Ga0495600_0770824 3300046809 Bacteria 575
301 Ga0495674_0372274 3300047319 Bacteria 1157
302 Ga0495680_1015028 3300047322 Bacteria 529
303 Ga0495602_0605921 3300048088 Bacteria 753
304 Ga0495602_0662518 3300048088 Bacteria 712
305 Ga0496106_1350742 3300048909 Bacteria 552
306 Ga0495682_0011496 3300049460 Bacteria 3406
307 Ga0501033_0008735 3300049570 Bacteria 7832
308 Ga0501033_0038417 3300049570 Bacteria 3578
309 Ga0501033_0049692 3300049570 Bacteria 3113
310 Ga0501033_0367408 3300049570 Bacteria 1006
311 Ga0501034_0007901 3300049571 Bacteria 11299
312 Ga0501034_0240917 3300049571 Bacteria 1755
313 Ga0501036_0136064 3300049572 Bacteria 2074
314 Ga0501037_0282015 3300049573 Bacteria 1157
315 Ga0501037_0320736 3300049573 Bacteria 1073
316 Ga0501038_0326326 3300049574 Bacteria 1200
317 Ga0501038_0472762 3300049574 Bacteria 961
318 Ga0501038_0533293 3300049574 Bacteria 895
319 Ga0501039_0334550 3300049575 Bacteria 1190
320 Ga0501039_0530690 3300049575 Bacteria 924
321 Ga0501039_0934896 3300049575 Bacteria 674
322 Ga0501043_0052435 3300049579 Bacteria 3204
323 Ga0501043_0084534 3300049579 Bacteria 2494
324 Ga0501043_0269110 3300049579 Bacteria 1308
325 Ga0501043_0624697 3300049579 Bacteria 794
326 Ga0501046_0246737 3300049580 Bacteria 1316
327 Ga0501047_0033800 3300049581 Bacteria 4936
328 Ga0501047_0049241 3300049581 Bacteria 4069
329 Ga0501047_0095889 3300049581 Bacteria 2845
330 Ga0501047_0256608 3300049581 Bacteria 1596
331 Ga0501047_0739134 3300049581 Bacteria 800
332 Ga0501047_0778626 3300049581 Bacteria 772
333 Ga0501047_0969570 3300049581 Bacteria 663
334 Ga0501047_1024018 3300049581 Bacteria 639
335 Ga0501067_0233164 3300049583 Bacteria 1024
336 Ga0501068_0116357 3300049584 Bacteria 1665
337 Ga0501069_0083167 3300049585 Bacteria 1805
338 Ga0501070_0230087 3300049586 Bacteria 1519
339 Ga0501070_0867500 3300049586 Bacteria 705
340 Ga0501073_0112023 3300049589 Bacteria 1893
341 Ga0501073_0480570 3300049589 Bacteria 859
342 Ga0501080_0203180 3300049742 Bacteria 1818
343 Ga0501080_0279808 3300049742 Bacteria 1517
344 Ga0501080_0636434 3300049742 Bacteria 944
345 Ga0501080_0672079 3300049742 Bacteria 915
346 Ga0501083_0156862 3300049744 Bacteria 1490
347 Ga0501035_0000605 3300049822 Bacteria 39596
348 Ga0501035_0113097 3300049822 Bacteria 2378
349 Ga0501035_0539922 3300049822 Bacteria 956
350 Ga0501035_1479403 3300049822 Bacteria 518
351 Ga0501044_0001437 3300049823 Bacteria 27990
352 Ga0501044_0042750 3300049823 Bacteria 4712
353 Ga0501044_0073016 3300049823 Bacteria 3487
354 Ga0501044_0078379 3300049823 Bacteria 3348
355 Ga0501044_1084517 3300049823 Bacteria 670
356 nmdc:mga0yw44_1088984_c1 3300050492 Bacteria 540
357 Ga0495619_0930373 3300053085 Bacteria 584
358 Ga0500595_000317 3300053119 Bacteria 31735
359 Ga0500595_039696 3300053119 Bacteria 1522
360 Ga0500655_004629 3300053133 Bacteria 2470
361 Ga0500559_0018881 3300053136 Bacteria 2913
362 Ga0500573_0000006 3300053140 Bacteria 285988
363 Ga0501082_0272477 3300060353 Bacteria 1473
364 Ga0501082_1228759 3300060353 Bacteria 655
365 Ga0105239_10361741
366 JGI25165J46597_1000017
367 JGI25153J46596_10000522
368 rootH1_10075520
369 Ga0055525_1016873
370 Ga0070658_10005086
371 Ga0070658_10036256
372 Ga0070658_11024422
373 Ga0070658_11470943
374 Ga0070683_100963502
375 Ga0070670_100256115
376 Ga0070670_101396169
377 Ga0070670_102073846
378 Ga0070666_10098809
379 Ga0070666_10130665
380 Ga0070680_100211422
381 Ga0068868_100210105
382 Ga0070660_100083563
383 Ga0070660_100729640
384 Ga0070691_10080634
385 Ga0070691_10374649
386 Ga0070661_100607189
387 Ga0070661_100928696
388 Ga0070661_100994398
389 Ga0070668_100612880
390 Ga0070669_100796158
391 Ga0070671_101035462
392 Ga0070667_100367342
393 Ga0070714_100003688
394 Ga0070713_101412654
395 Ga0070678_100235985
396 Ga0070678_100362846
397 Ga0068867_102141811
398 Ga0070679_100012083
399 Ga0070679_100187921
400 Ga0070679_101744865
401 Ga0070684_100369267
402 Ga0068853_100081166
403 Ga0068853_100599534
404 Ga0068853_101039004
405 Ga0068853_101225688
406 Ga0068853_101263402
407 Ga0070686_101624301
408 Ga0070693_100530995
409 Ga0070665_100000737
410 Ga0070665_100017359
411 Ga0070665_100064093
412 Ga0070665_100268712
413 Ga0070665_100713111
414 Ga0068855_100000063
415 Ga0068855_100010273
416 Ga0068857_100165874
417 Ga0068857_100479859
418 Ga0068857_101976816
419 Ga0068854_100536525
420 Ga0068856_100062829
421 Ga0068856_100154722
422 Ga0068856_101311321
423 Ga0068856_101674199
424 Ga0068856_101896502
425 Ga0068856_102613901
426 Ga0068852_100055429
427 Ga0068852_100174909
428 Ga0068852_101703780
429 Ga0068852_102438120
430 Ga0068859_100092783
431 Ga0068864_100676872
432 Ga0068864_101150578
433 Ga0068861_100412952
434 Ga0068863_100008303
435 Ga0068863_102002675
436 Ga0068858_100135925
437 Ga0075365_11173904
438 Ga0097621_100020177
439 Ga0097621_100472917
440 Ga0097621_100950217
441 Ga0097621_101510125
442 Ga0068871_100173081
443 Ga0068871_100325612
444 Ga0068871_101032410
445 Ga0068871_102364777
446 Ga0068865_100014354
447 Ga0068865_102114250
448 Ga0097620_100092782
449 Ga0105240_10001135
450 Ga0105240_10011146
451 Ga0105240_10013892
452 Ga0105240_10018215
453 Ga0105240_10023481
454 Ga0105240_10034776
455 Ga0105240_10111511
456 Ga0105245_10449829
457 Ga0105245_10605961
458 Ga0105245_11823128
459 Ga0105247_10053310
460 Ga0105243_10470347
461 Ga0105241_10084261
462 Ga0105241_10119384
463 Ga0105241_10172933
464 Ga0105241_10189733
465 Ga0105241_10251513
466 Ga0105241_11147911
467 Ga0105241_11340115
468 Ga0105242_11490930
469 Ga0105242_11977391
470 Ga0105248_10000001
471 Ga0105248_10000433
472 Ga0105248_10332333
473 Ga0105248_10664541
474 Ga0105237_10078317
475 Ga0105237_10450494
476 Ga0105237_10510781
477 Ga0105237_11071441
478 Ga0105237_11439425
479 Ga0105237_12036095
480 Ga0105237_12329690
481 Ga0105238_10029549
482 Ga0105238_10035061
483 Ga0105238_10068804
484 Ga0105238_10172945
485 Ga0105238_10199389
486 Ga0105238_10337463
487 Ga0105238_10371184
488 Ga0105238_11477421
489 Ga0105249_10040881
490 Ga0105028_130428
491 Ga0105239_10002901
492 Ga0105239_10004366
493 Ga0105239_10015472
494 Ga0105239_10367197
495 Ga0105239_10925833
496 Ga0105239_12661154
497 Ga0105246_10740741
498 Ga0157370_10008611
499 Ga0157369_10004877
500 Ga0157369_10143810
501 Ga0157369_10426609
502 Ga0157369_10977846
503 Ga0157374_10841050
504 Ga0157374_11271711
505 Ga0157378_10135403
506 Ga0157378_10438989
507 Ga0157378_11471716
508 Ga0163162_10136149
509 Ga0163162_12042574
510 Ga0157372_10401063
511 Ga0157372_12324610
512 Ga0157372_12461116
513 Ga0157375_10066664
514 Ga0157375_11834712
515 Ga0157375_13784967
516 Ga0157380_11166262
517 Ga0157377_11266603
518 Ga0157379_10000441
519 Ga0157379_10031120
520 Ga0157376_10276519
521 Ga0163161_11769281
522 Ga0213874_10065884
523 Ga0209563_111457
524 Ga0209233_1000006
525 Ga0209233_1005148
526 Ga0209758_1000085
527 Ga0209758_1164174
528 Ga0207656_10336287
529 Ga0207682_10357862
530 Ga0207680_10078674
531 Ga0207680_10263240
532 Ga0207645_10631009
533 Ga0207705_10002686
534 Ga0207705_10074306
535 Ga0207654_10017449
536 Ga0207654_10150100
537 Ga0207654_10211569
538 Ga0207654_10340092
539 Ga0207654_10414449
540 Ga0207654_10641236
541 Ga0207654_10999902
542 Ga0207707_10688897
543 Ga0207695_10000003
544 Ga0207695_10018276
545 Ga0207695_10043710
546 Ga0207695_10048376
547 Ga0207695_10104180
548 Ga0207695_10303021
549 Ga0207671_10088948
550 Ga0207671_10099316
551 Ga0207671_11355947
552 Ga0207660_10122899
553 Ga0207657_10028302
554 Ga0207657_10060612
555 Ga0207649_10574352
556 Ga0207652_10014562
557 Ga0207652_10083100
558 Ga0207694_10000005
559 Ga0207694_10046774
560 Ga0207694_10102142
561 Ga0207694_10187679
562 Ga0207694_11372079
563 Ga0207694_11814290
564 Ga0207650_11081731
565 Ga0207659_11364073
566 Ga0207687_10364437
567 Ga0207700_11348240
568 Ga0207664_10017496
569 Ga0207664_10697661
570 Ga0207644_10515265
571 Ga0207686_10010958
572 Ga0207709_10312670
573 Ga0207669_10332316
574 Ga0207669_11411935
575 Ga0207704_10255415
576 Ga0207704_11626217
577 Ga0207711_10000002
578 Ga0207711_10003393
579 Ga0207711_10404316
580 Ga0207711_11658911
581 Ga0207661_10762291
582 Ga0207667_10000183
583 Ga0207667_10024334
584 Ga0207667_10342026
585 Ga0207712_10015543
586 Ga0207640_10305738
587 Ga0207658_10381044
588 Ga0207677_10175425
589 Ga0207677_11893273
590 Ga0207703_10023157
591 Ga0207639_10257735
592 Ga0207678_10701717
593 Ga0207702_10079563
594 Ga0207702_11932991
595 Ga0207641_10446941
596 Ga0207641_10644691
597 Ga0207648_10576143
598 Ga0207676_11110288
599 Ga0207674_10060801
600 Ga0207674_10830644
601 Ga0207675_100750520
602 Ga0207683_10177458
603 Ga0207683_10515143
604 Ga0207698_10050006
605 Ga0207698_10373170
606 Ga0207698_10494497
607 Ga0268266_10000316
608 Ga0268266_10006188
609 Ga0268266_10053330
610 Ga0268266_10622865
611 Ga0268266_11305001
612 Ga0268266_11665842
613 Ga0268265_11173239
614 Ga0265318_10011192
615 Ga0265338_10078991
616 Ga0265338_10338965
617 Ga0265338_11189777
618 Ga0265332_10067724
619 Ga0265332_10108386
620 Ga0265332_10403881
621 Ga0265328_10201444
622 Ga0265320_10094204
623 Ga0265320_10118736
624 Ga0265325_10148170
625 Ga0265340_10081751
626 Ga0265339_10012681
627 Ga0265339_10327742
628 Ga0265331_10000003
629 Ga0265331_10047798
630 Ga0265331_10064335
631 Ga0265331_10406449
632 Ga0265316_10062468
633 Ga0265313_10002874
634 Ga0265313_10375350
635 Ga0265314_10003106
636 Ga0265314_10029539
637 Ga0265314_10044682
638 Ga0265314_10063124
639 Ga0265342_10337293
640 Ga0307516_10203131
641 Ga0373936_0621353
642 Ga0373942_0061871
643 Ga0395898_0294706
644 Ga0436365_0685821
645 Ga0436363_1288436
646 Ga0451807_2126899
647 Ga0495617_091056
648 Ga0495628_0256677
649 Ga0495652_1108388
650 Ga0495586_0519029
651 Ga0495587_0364052
652 Ga0495587_0670629
653 Ga0495609_0051893
654 Ga0495621_0034981
655 Ga0495621_0103077
656 Ga0495645_0454823
657 Ga0495622_0012545
658 Ga0495599_0323020
659 Ga0495670_0201271
660 Ga0495671_0282208
661 Ga0495671_0471069
662 Ga0495589_0139838
663 Ga0495600_0163997
664 Ga0495600_0770824
665 Ga0495674_0372274
666 Ga0495680_1015028
667 Ga0495602_0605921
668 Ga0495602_0662518
669 Ga0496106_1350742
670 Ga0495682_0011496
671 Ga0501033_0008735
672 Ga0501033_0038417
673 Ga0501033_0049692
674 Ga0501033_0367408
675 Ga0501034_0007901
676 Ga0501034_0240917
677 Ga0501036_0136064
678 Ga0501037_0282015
679 Ga0501037_0320736
680 Ga0501038_0326326
681 Ga0501038_0472762
682 Ga0501038_0533293
683 Ga0501039_0334550
684 Ga0501039_0530690
685 Ga0501039_0934896
686 Ga0501043_0052435
687 Ga0501043_0084534
688 Ga0501043_0269110
689 Ga0501043_0624697
690 Ga0501046_0246737
691 Ga0501047_0033800
692 Ga0501047_0049241
693 Ga0501047_0095889
694 Ga0501047_0256608
695 Ga0501047_0739134
696 Ga0501047_0778626
697 Ga0501047_0969570
698 Ga0501047_1024018
699 Ga0501067_0233164
700 Ga0501068_0116357
701 Ga0501069_0083167
702 Ga0501070_0230087
703 Ga0501070_0867500
704 Ga0501073_0112023
705 Ga0501073_0480570
706 Ga0501080_0203180
707 Ga0501080_0279808
708 Ga0501080_0636434
709 Ga0501080_0672079
710 Ga0501083_0156862
711 Ga0501035_0000605
712 Ga0501035_0113097
713 Ga0501035_0539922
714 Ga0501035_1479403
715 Ga0501044_0001437
716 Ga0501044_0042750
717 Ga0501044_0073016
718 Ga0501044_0078379
719 Ga0501044_1084517
720 nmdc:mga0yw44_1088984_c1
721 Ga0495619_0930373
722 Ga0500595_000317
723 Ga0500595_039696
724 Ga0500655_004629
725 Ga0500559_0018881
726 Ga0500573_0000006
727 Ga0501082_0272477
728 Ga0501082_1228759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05545

FixQ

Cbb3-type cytochrome oxidase component FixQ

6

48

0.95

Map