F423272

General Info

Members Datasets Scaffolds Average Seq Length
364 194 728 146

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10527010|Ga0075433_105270102
Length 167
Sequence MPSGGLKTEIDTLAQAGTFLPMRPPCSDYQKIKGLIYFARMLDKIRLHAAGELPPDYCVGVDEPDLFDARCTRFLGVDYDQLAKRTLEGGTDEEILDWCFVHGRRPSEEEIEIWNAFLAKRGWRDAGSADLQLAKERYGWGARDDIQTWVDLHDVDEGRTPGRNLAE

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
137 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
138 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.69
Rhizosphere 91.48
Stem 0
Stem Tuber 0
Unclassified 33.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10527010 3300006852 Bacteria 1039
2 JGI24035J26624_1010585 3300002126 Bacteria 918
3 JGI25406J46586_10068578 3300003203 Unclassified 1120
4 rootH2_10035167 3300003320 Bacteria 7348
5 rootL2_10115280 3300003322 Bacteria 7624
6 Ga0065704_10166175 3300005289 Bacteria 1321
7 Ga0065704_10710212 3300005289 Unclassified 557
8 Ga0065712_10002575 3300005290 Bacteria 5054
9 Ga0065712_10210736 3300005290 Unclassified 1074
10 Ga0065715_10005624 3300005293 Bacteria 6006
11 Ga0065715_10164645 3300005293 Bacteria 1597
12 Ga0070658_11033014 3300005327 Unclassified 715
13 Ga0070676_10017439 3300005328 Bacteria 3974
14 Ga0070676_10072112 3300005328 Bacteria 2076
15 Ga0070683_100509553 3300005329 Archaea 1150
16 Ga0070690_100034239 3300005330 Bacteria 3183
17 Ga0070670_100006841 3300005331 Bacteria 9660
18 Ga0070670_100102335 3300005331 Bacteria 2467
19 Ga0070670_100133254 3300005331 Bacteria 2146
20 Ga0070677_10804000 3300005333 Unclassified 537
21 Ga0070666_10055362 3300005335 Unclassified 2677
22 Ga0070666_10153043 3300005335 Bacteria 1609
23 Ga0068868_100016118 3300005338 Bacteria 5544
24 Ga0068868_100113085 3300005338 Bacteria 2207
25 Ga0068868_100745193 3300005338 Unclassified 880
26 Ga0070660_101026128 3300005339 Unclassified 697
27 Ga0070689_100840752 3300005340 Unclassified 809
28 Ga0070687_100955891 3300005343 Bacteria 618
29 Ga0070661_100645625 3300005344 Unclassified 859
30 Ga0070668_100008317 3300005347 Bacteria 7702
31 Ga0070668_100053100 3300005347 Bacteria 3126
32 Ga0070668_100337329 3300005347 Bacteria 1273
33 Ga0070668_100394829 3300005347 Unclassified 1180
34 Ga0070669_100016893 3300005353 Bacteria 5210
35 Ga0070669_100041627 3300005353 Bacteria 3342
36 Ga0070669_100547942 3300005353 Bacteria 964
37 Ga0070675_100021297 3300005354 Bacteria 5180
38 Ga0070675_100114403 3300005354 Unclassified 2286
39 Ga0070675_100140497 3300005354 Bacteria 2064
40 Ga0070671_100005953 3300005355 Bacteria 9715
41 Ga0070671_100010467 3300005355 Bacteria 7441
42 Ga0070671_100037401 3300005355 Bacteria 4025
43 Ga0070671_100922220 3300005355 Unclassified 763
44 Ga0070671_101487093 3300005355 Bacteria 599
45 Ga0070674_100052354 3300005356 Bacteria 2816
46 Ga0070674_100386025 3300005356 Bacteria 1140
47 Ga0070673_100042992 3300005364 Bacteria 3488
48 Ga0070673_100658653 3300005364 Unclassified 959
49 Ga0070659_100339024 3300005366 Bacteria 1259
50 Ga0070667_100007357 3300005367 Bacteria 9144
51 Ga0070709_10100720 3300005434 Bacteria 1924
52 Ga0070709_10120137 3300005434 Bacteria 1780
53 Ga0070709_10558567 3300005434 Unclassified 877
54 Ga0070714_100739516 3300005435 Unclassified 950
55 Ga0070714_100895435 3300005435 Bacteria 861
56 Ga0070713_100078269 3300005436 Bacteria 2814
57 Ga0070713_100392121 3300005436 Unclassified 1295
58 Ga0070710_10111236 3300005437 Bacteria 1646
59 Ga0070710_10118297 3300005437 Bacteria 1600
60 Ga0070711_100173683 3300005439 Bacteria 1644
61 Ga0070711_100327548 3300005439 Bacteria 1225
62 Ga0070705_100061044 3300005440 Bacteria 2239
63 Ga0070708_100173947 3300005445 Bacteria 2011
64 Ga0070708_100610380 3300005445 Bacteria 1028
65 Ga0070678_100078525 3300005456 Bacteria 2493
66 Ga0070678_100236054 3300005456 Viruses 1527
67 Ga0070678_101045642 3300005456 Bacteria 752
68 Ga0070681_11434742 3300005458 Bacteria 614
69 Ga0068867_100614885 3300005459 Bacteria 949
70 Ga0070706_100003887 3300005467 Bacteria 14581
71 Ga0070706_100009594 3300005467 Bacteria 9000
72 Ga0070706_100044260 3300005467 Bacteria 4111
73 Ga0070706_100104818 3300005467 Bacteria 2630
74 Ga0070706_100181071 3300005467 Unclassified 1967
75 Ga0070706_100195762 3300005467 Bacteria 1888
76 Ga0070706_101300529 3300005467 Unclassified 667
77 Ga0070707_100013568 3300005468 Bacteria 7626
78 Ga0070707_100021654 3300005468 Bacteria 6077
79 Ga0070707_100036095 3300005468 Bacteria 4716
80 Ga0070707_100173280 3300005468 Bacteria 2103
81 Ga0070707_100389414 3300005468 Bacteria 1353
82 Ga0070698_100070061 3300005471 Bacteria 3519
83 Ga0070698_100619585 3300005471 Unclassified 1023
84 Ga0070699_100063486 3300005518 Unclassified 3203
85 Ga0070699_100374262 3300005518 Unclassified 1285
86 Ga0070699_100447694 3300005518 Bacteria 1171
87 Ga0070697_100090992 3300005536 Bacteria 2522
88 Ga0070697_100118510 3300005536 Unclassified 2212
89 Ga0070697_100147643 3300005536 Unclassified 1980
90 Ga0070672_100096357 3300005543 Bacteria 2394
91 Ga0070672_100181624 3300005543 Unclassified 1753
92 Ga0070695_100299837 3300005545 Bacteria 1187
93 Ga0070695_100454717 3300005545 Bacteria 982
94 Ga0070696_100035418 3300005546 Bacteria 3437
95 Ga0070665_100106610 3300005548 Bacteria 2804
96 Ga0070665_100110680 3300005548 Bacteria 2749
97 Ga0070665_100593871 3300005548 Unclassified 1120
98 Ga0070665_101508117 3300005548 Bacteria 681
99 Ga0070704_100207004 3300005549 Bacteria 1587
100 Ga0070704_100342164 3300005549 Bacteria 1260
101 Ga0068855_100403017 3300005563 Bacteria 1499
102 Ga0068855_100519490 3300005563 Bacteria 1292
103 Ga0070664_100078267 3300005564 Archaea 2845
104 Ga0068854_100545978 3300005578 Bacteria 982
105 Ga0068856_100175845 3300005614 Bacteria 2153
106 Ga0068856_100917000 3300005614 Unclassified 895
107 Ga0070702_100046381 3300005615 Bacteria 2463
108 Ga0068859_100180276 3300005617 Unclassified 2195
109 Ga0068859_101553695 3300005617 Unclassified 731
110 Ga0068864_100491028 3300005618 Unclassified 1180
111 Ga0068866_10110575 3300005718 Bacteria 1532
112 Ga0068863_100150216 3300005841 Bacteria 2229
113 Ga0068863_100295306 3300005841 Bacteria 1571
114 Ga0068858_100220373 3300005842 Bacteria 1797
115 Ga0068860_100099834 3300005843 Bacteria 2769
116 Ga0068860_100501251 3300005843 Bacteria 1212
117 Ga0068862_100141594 3300005844 Bacteria 2135
118 Ga0081539_10022924 3300005985 Bacteria 4108
119 Ga0070717_10523645 3300006028 Bacteria 1072
120 Ga0070716_100048378 3300006173 Bacteria 2403
121 Ga0070716_100064374 3300006173 Bacteria 2132
122 Ga0070712_100008603 3300006175 Bacteria 6423
123 Ga0070712_100248743 3300006175 Bacteria 1419
124 Ga0097621_100012301 3300006237 Bacteria 6335
125 Ga0097621_100649865 3300006237 Bacteria 967
126 Ga0068871_100029403 3300006358 Bacteria 4316
127 Ga0068871_100042299 3300006358 Bacteria 3657
128 Ga0068871_100498159 3300006358 Bacteria 1098
129 Ga0075428_100991272 3300006844 Bacteria 890
130 Ga0075434_100433098 3300006871 Unclassified 1336
131 Ga0068865_100136718 3300006881 Unclassified 1843
132 Ga0068865_100153724 3300006881 Bacteria 1748
133 Ga0075436_101417378 3300006914 Unclassified 527
134 Ga0097620_100180266 3300006931 Unclassified 2195
135 Ga0097620_101553694 3300006931 Unclassified 731
136 Ga0075435_100125765 3300007076 Bacteria 2142
137 Ga0099795_10082837 3300007788 Unclassified 1230
138 Ga0105240_11060947 3300009093 Bacteria 864
139 Ga0111539_10877311 3300009094 Unclassified 1044
140 Ga0105245_11526342 3300009098 Unclassified 719
141 Ga0114129_10393332 3300009147 Bacteria 1828
142 Ga0114129_11831933 3300009147 Bacteria 737
143 Ga0105249_12366836 3300009553 Bacteria 604
144 Ga0105239_11123737 3300010375 Unclassified 905
145 Ga0157371_10139302 3300013102 Bacteria 1728
146 Ga0157371_10316715 3300013102 Unclassified 1131
147 Ga0157369_11846211 3300013105 Unclassified 614
148 Ga0157374_10055128 3300013296 Bacteria 3709
149 Ga0157374_10170852 3300013296 Bacteria 2120
150 Ga0157374_10284885 3300013296 Unclassified 1632
151 Ga0157374_10434269 3300013296 Unclassified 1313
152 Ga0157378_10030394 3300013297 Bacteria 4774
153 Ga0157378_10065871 3300013297 Bacteria 3243
154 Ga0157378_10098789 3300013297 Bacteria 2662
155 Ga0157378_10149832 3300013297 Bacteria 2173
156 Ga0157378_10293860 3300013297 Unclassified 1570
157 Ga0157378_10505944 3300013297 Unclassified 1207
158 Ga0157378_10549015 3300013297 Bacteria 1160
159 Ga0163162_10020409 3300013306 Bacteria 6511
160 Ga0163162_10029487 3300013306 Bacteria 5430
161 Ga0163162_10055199 3300013306 Bacteria 3998
162 Ga0163162_10813629 3300013306 Unclassified 1051
163 Ga0157372_10030381 3300013307 Bacteria 5912
164 Ga0157372_10129280 3300013307 Bacteria 2905
165 Ga0157372_11410124 3300013307 Unclassified 803
166 Ga0157375_10009424 3300013308 Bacteria 8569
167 Ga0157375_10066902 3300013308 Bacteria 3589
168 Ga0157375_10087656 3300013308 Bacteria 3165
169 Ga0157375_10106556 3300013308 Bacteria 2895
170 Ga0157375_10382433 3300013308 Bacteria 1574
171 Ga0157375_10746867 3300013308 Unclassified 1130
172 Ga0163163_11398187 3300014325 Unclassified 761
173 Ga0157380_12607839 3300014326 Unclassified 572
174 Ga0157379_11010452 3300014968 Bacteria 793
175 Ga0157376_10072998 3300014969 Unclassified 2921
176 Ga0157376_10507940 3300014969 Bacteria 1186
177 Ga0163161_10013937 3300017792 Bacteria 5599
178 Ga0163161_10499059 3300017792 Unclassified 991
179 Ga0207673_1013936 3300025290 Bacteria 1058
180 Ga0207697_10005972 3300025315 Bacteria 5580
181 Ga0207697_10010699 3300025315 Bacteria 3911
182 Ga0207682_10153342 3300025893 Bacteria 1040
183 Ga0207692_10211572 3300025898 Bacteria 1145
184 Ga0207692_10319175 3300025898 Unclassified 950
185 Ga0207688_10056634 3300025901 Unclassified 2203
186 Ga0207688_10126682 3300025901 Unclassified 1494
187 Ga0207680_10056588 3300025903 Bacteria 2369
188 Ga0207699_10049313 3300025906 Bacteria 2478
189 Ga0207699_10097176 3300025906 Bacteria 1861
190 Ga0207699_10559572 3300025906 Unclassified 830
191 Ga0207699_10582635 3300025906 Unclassified 813
192 Ga0207645_10008104 3300025907 Bacteria 7363
193 Ga0207645_10080867 3300025907 Bacteria 2083
194 Ga0207645_10508856 3300025907 Bacteria 816
195 Ga0207684_10002487 3300025910 Bacteria 18534
196 Ga0207684_10103146 3300025910 Bacteria 2439
197 Ga0207684_10105580 3300025910 Unclassified 2409
198 Ga0207684_10125838 3300025910 Bacteria 2199
199 Ga0207684_10217118 3300025910 Bacteria 1650
200 Ga0207693_10011975 3300025915 Bacteria 7013
201 Ga0207693_10044934 3300025915 Bacteria 3471
202 Ga0207693_10269868 3300025915 Unclassified 1333
203 Ga0207649_10368764 3300025920 Bacteria 1067
204 Ga0207646_10003906 3300025922 Bacteria 16548
205 Ga0207646_10041444 3300025922 Bacteria 4139
206 Ga0207646_10117424 3300025922 Bacteria 2389
207 Ga0207681_10029174 3300025923 Bacteria 3580
208 Ga0207681_10061286 3300025923 Bacteria 2585
209 Ga0207650_10029998 3300025925 Bacteria 3914
210 Ga0207650_10280674 3300025925 Bacteria 1356
211 Ga0207659_10024637 3300025926 Bacteria 4035
212 Ga0207659_10073299 3300025926 Unclassified 2506
213 Ga0207659_10077748 3300025926 Unclassified 2443
214 Ga0207659_10125261 3300025926 Bacteria 1975
215 Ga0207659_10887552 3300025926 Unclassified 767
216 Ga0207700_10025689 3300025928 Bacteria 4095
217 Ga0207700_10490038 3300025928 Bacteria 1087
218 Ga0207644_10003514 3300025931 Bacteria 10145
219 Ga0207644_10028673 3300025931 Bacteria 3856
220 Ga0207644_10260551 3300025931 Unclassified 1386
221 Ga0207644_11432702 3300025931 Unclassified 580
222 Ga0207690_10412034 3300025932 Bacteria 1080
223 Ga0207706_10107479 3300025933 Bacteria 2455
224 Ga0207670_10734917 3300025936 Unclassified 819
225 Ga0207669_10057568 3300025937 Bacteria 2367
226 Ga0207669_10441078 3300025937 Bacteria 1029
227 Ga0207704_10139912 3300025938 Archaea 1691
228 Ga0207665_10004292 3300025939 Bacteria 9477
229 Ga0207665_10020888 3300025939 Unclassified 4304
230 Ga0207665_10686342 3300025939 Unclassified 804
231 Ga0207665_10841094 3300025939 Bacteria 726
232 Ga0207691_10010382 3300025940 Bacteria 8934
233 Ga0207691_10055604 3300025940 Bacteria 3606
234 Ga0207691_10082058 3300025940 Archaea 2897
235 Ga0207691_10237189 3300025940 Unclassified 1578
236 Ga0207661_11361057 3300025944 Unclassified 652
237 Ga0207667_10570342 3300025949 Bacteria 1143
238 Ga0207651_10044404 3300025960 Bacteria 2974
239 Ga0207651_10221437 3300025960 Unclassified 1530
240 Ga0207651_10240439 3300025960 Bacteria 1475
241 Ga0207651_10574827 3300025960 Unclassified 982
242 Ga0207651_11548097 3300025960 Unclassified 597
243 Ga0207712_11021503 3300025961 Unclassified 734
244 Ga0207668_10233165 3300025972 Unclassified 1485
245 Ga0207668_10298096 3300025972 Bacteria 1329
246 Ga0207668_10334028 3300025972 Unclassified 1262
247 Ga0207640_10678802 3300025981 Bacteria 881
248 Ga0207658_10050595 3300025986 Bacteria 3058
249 Ga0207658_10170521 3300025986 Bacteria 1792
250 Ga0207658_10170901 3300025986 Bacteria 1791
251 Ga0207658_10215957 3300025986 Bacteria 1610
252 Ga0207658_10253834 3300025986 Unclassified 1495
253 Ga0207677_10093613 3300026023 Bacteria 2191
254 Ga0207677_10987921 3300026023 Unclassified 763
255 Ga0207703_10544785 3300026035 Bacteria 1093
256 Ga0207678_10658679 3300026067 Bacteria 920
257 Ga0207708_10725825 3300026075 Bacteria 851
258 Ga0207702_10893632 3300026078 Bacteria 880
259 Ga0207641_11188959 3300026088 Bacteria 762
260 Ga0207641_11968271 3300026088 Unclassified 586
261 Ga0207676_10567726 3300026095 Unclassified 1086
262 Ga0207683_10046023 3300026121 Unclassified 3817
263 Ga0207683_10146702 3300026121 Bacteria 2128
264 Ga0207683_10269907 3300026121 Unclassified 1554
265 Ga0207683_11560047 3300026121 Unclassified 609
266 Ga0268266_10067763 3300028379 Bacteria 3089
267 Ga0268266_10156797 3300028379 Bacteria 2057
268 Ga0268266_10414156 3300028379 Unclassified 1276
269 Ga0268266_10443025 3300028379 Unclassified 1234
270 Ga0268266_10744078 3300028379 Bacteria 946
271 Ga0268265_10062382 3300028380 Bacteria 2864
272 Ga0268264_10080767 3300028381 Bacteria 2777
273 Ga0268264_10392110 3300028381 Bacteria 1332
274 Ga0268264_11137375 3300028381 Unclassified 790
275 Ga0265337_1024855 3300028556 Bacteria 1827
276 Ga0265338_10641437 3300028800 Unclassified 737
277 Ga0265328_10019211 3300031239 Unclassified 2628
278 Ga0265328_10148446 3300031239 Unclassified 881
279 Ga0265320_10000143 3300031240 Bacteria 60406
280 Ga0265329_10002367 3300031242 Bacteria 8597
281 Ga0265327_10002915 3300031251 Bacteria 17131
282 Ga0265314_10000197 3300031711 Bacteria 90193
283 Ga0373939_0388521 3300035114 Unclassified 576
284 Ga0373941_0080155 3300035115 Bacteria 1101
285 Ga0373945_0221710 3300035116 Unclassified 791
286 Ga0373953_0143458 3300035117 Bacteria 1022
287 Ga0373946_0095464 3300035171 Bacteria 1325
288 Ga0373955_0679621 3300035172 Unclassified 632
289 Ga0373942_0113925 3300035207 Bacteria 839
290 Ga0373931_0721936 3300035691 Unclassified 659
291 Ga0373935_0033064 3300035692 Bacteria 3218
292 Ga0373935_0460097 3300035692 Bacteria 920
293 Ga0373927_0020907 3300035695 Unclassified 4289
294 Ga0373927_0370391 3300035695 Bacteria 944
295 Ga0373947_0010962 3300035725 Bacteria 5203
296 Ga0373947_0542616 3300035725 Unclassified 791
297 Ga0373947_0546451 3300035725 Unclassified 788
298 Ga0373937_0010351 3300036401 Bacteria 8143
299 Ga0373925_0048101 3300037068 Bacteria 3177
300 Ga0373925_0054164 3300037068 Bacteria 3000
301 Ga0373925_0240894 3300037068 Bacteria 1448
302 Ga0395900_0776983 3300037418 Bacteria 887
303 Ga0395898_0994738 3300037466 Bacteria 775
304 Ga0395901_0327006 3300038443 Unclassified 1586
305 Ga0436363_1305102 3300039450 Bacteria 5588
306 Ga0495580_0493811 3300046472 Bacteria 818
307 Ga0495584_0059531 3300046491 Unclassified 1921
308 Ga0495652_0093869 3300046529 Bacteria 2449
309 Ga0495598_0409207 3300046537 Bacteria 531
310 Ga0495634_0115274 3300046642 Unclassified 1725
311 Ga0495588_0587105 3300046674 Unclassified 584
312 Ga0495657_0391391 3300046675 Unclassified 819
313 Ga0495599_0198213 3300046678 Unclassified 1234
314 Ga0495658_0217139 3300046683 Bacteria 1196
315 Ga0495669_0086853 3300046684 Bacteria 1441
316 Ga0495669_0553795 3300046684 Unclassified 559
317 Ga0495600_0456354 3300046809 Unclassified 790
318 Ga0495674_0495414 3300047319 Bacteria 978
319 Ga0495675_0216402 3300047444 Unclassified 1161
320 Ga0495684_0072291 3300047471 Bacteria 2621
321 Ga0496100_0026830 3300048903 Bacteria 3535
322 Ga0496100_0286726 3300048903 Unclassified 1229
323 Ga0496101_0003554 3300048904 Bacteria 9723
324 Ga0496102_0067923 3300048905 Bacteria 3270
325 Ga0496102_1515609 3300048905 Unclassified 589
326 Ga0496103_0018870 3300048906 Bacteria 4141
327 Ga0496103_0762949 3300048906 Unclassified 611
328 Ga0496106_0046962 3300048909 Bacteria 3248
329 Ga0496106_0487180 3300048909 Unclassified 991
330 Ga0496107_0012485 3300048910 Bacteria 5928
331 Ga0496107_0266453 3300048910 Unclassified 1275
332 Ga0496107_0935629 3300048910 Unclassified 631
333 Ga0496108_0271788 3300048911 Unclassified 1475
334 Ga0496108_0331964 3300048911 Bacteria 1326
335 Ga0496108_0830175 3300048911 Bacteria 796
336 Ga0496108_0909400 3300048911 Bacteria 755
337 Ga0496109_0024071 3300048912 Bacteria 5410
338 Ga0496109_0744570 3300048912 Unclassified 918
339 Ga0496109_1826993 3300048912 Unclassified 541
340 Ga0496110_1143535 3300048913 Unclassified 687
341 Ga0496111_0635799 3300048914 Unclassified 779
342 Ga0496112_0075291 3300048915 Bacteria 3338
343 Ga0496112_0877143 3300048915 Unclassified 820
344 Ga0496112_1211911 3300048915 Bacteria 671
345 Ga0496113_0028877 3300048916 Bacteria 3995
346 Ga0496114_0159012 3300048917 Bacteria 1963
347 Ga0496115_0031454 3300048918 Bacteria 4183
348 Ga0496115_0043240 3300048918 Bacteria 3592
349 Ga0501034_0211266 3300049571 Bacteria 1896
350 Ga0501080_0027865 3300049742 Bacteria 5253
351 Ga0501080_0074674 3300049742 Unclassified 3154
352 Ga0501080_0080204 3300049742 Bacteria 3034
353 Ga0501080_0398135 3300049742 Bacteria 1239
354 Ga0501080_0805859 3300049742 Unclassified 823
355 nmdc:mga08y16_1018073_c1 3300050511 Unclassified 807
356 nmdc:mga0n895_133490_c1 3300050512 Bacteria 2508
357 nmdc:mga0n895_297569_c1 3300050512 Bacteria 1636
358 nmdc:mga0n895_627023_c1 3300050512 Bacteria 1076
359 nmdc:mga0rr50_38897_c1 3300050513 Bacteria 3446
360 nmdc:mga08x19_1250822_c1 3300050514 Unclassified 526
361 nmdc:mga08x19_461615_c1 3300050514 Bacteria 894
362 nmdc:mga0a205_791644_c1 3300050515 Bacteria 796
363 Ga0495601_0157077 3300053077 Unclassified 1485
364 Ga0501084_1449077 3300054114 Bacteria 575
365 Ga0075433_10527010
366 JGI24035J26624_1010585
367 JGI25406J46586_10068578
368 rootH2_10035167
369 rootL2_10115280
370 Ga0065704_10166175
371 Ga0065704_10710212
372 Ga0065712_10002575
373 Ga0065712_10210736
374 Ga0065715_10005624
375 Ga0065715_10164645
376 Ga0070658_11033014
377 Ga0070676_10017439
378 Ga0070676_10072112
379 Ga0070683_100509553
380 Ga0070690_100034239
381 Ga0070670_100006841
382 Ga0070670_100102335
383 Ga0070670_100133254
384 Ga0070677_10804000
385 Ga0070666_10055362
386 Ga0070666_10153043
387 Ga0068868_100016118
388 Ga0068868_100113085
389 Ga0068868_100745193
390 Ga0070660_101026128
391 Ga0070689_100840752
392 Ga0070687_100955891
393 Ga0070661_100645625
394 Ga0070668_100008317
395 Ga0070668_100053100
396 Ga0070668_100337329
397 Ga0070668_100394829
398 Ga0070669_100016893
399 Ga0070669_100041627
400 Ga0070669_100547942
401 Ga0070675_100021297
402 Ga0070675_100114403
403 Ga0070675_100140497
404 Ga0070671_100005953
405 Ga0070671_100010467
406 Ga0070671_100037401
407 Ga0070671_100922220
408 Ga0070671_101487093
409 Ga0070674_100052354
410 Ga0070674_100386025
411 Ga0070673_100042992
412 Ga0070673_100658653
413 Ga0070659_100339024
414 Ga0070667_100007357
415 Ga0070709_10100720
416 Ga0070709_10120137
417 Ga0070709_10558567
418 Ga0070714_100739516
419 Ga0070714_100895435
420 Ga0070713_100078269
421 Ga0070713_100392121
422 Ga0070710_10111236
423 Ga0070710_10118297
424 Ga0070711_100173683
425 Ga0070711_100327548
426 Ga0070705_100061044
427 Ga0070708_100173947
428 Ga0070708_100610380
429 Ga0070678_100078525
430 Ga0070678_100236054
431 Ga0070678_101045642
432 Ga0070681_11434742
433 Ga0068867_100614885
434 Ga0070706_100003887
435 Ga0070706_100009594
436 Ga0070706_100044260
437 Ga0070706_100104818
438 Ga0070706_100181071
439 Ga0070706_100195762
440 Ga0070706_101300529
441 Ga0070707_100013568
442 Ga0070707_100021654
443 Ga0070707_100036095
444 Ga0070707_100173280
445 Ga0070707_100389414
446 Ga0070698_100070061
447 Ga0070698_100619585
448 Ga0070699_100063486
449 Ga0070699_100374262
450 Ga0070699_100447694
451 Ga0070697_100090992
452 Ga0070697_100118510
453 Ga0070697_100147643
454 Ga0070672_100096357
455 Ga0070672_100181624
456 Ga0070695_100299837
457 Ga0070695_100454717
458 Ga0070696_100035418
459 Ga0070665_100106610
460 Ga0070665_100110680
461 Ga0070665_100593871
462 Ga0070665_101508117
463 Ga0070704_100207004
464 Ga0070704_100342164
465 Ga0068855_100403017
466 Ga0068855_100519490
467 Ga0070664_100078267
468 Ga0068854_100545978
469 Ga0068856_100175845
470 Ga0068856_100917000
471 Ga0070702_100046381
472 Ga0068859_100180276
473 Ga0068859_101553695
474 Ga0068864_100491028
475 Ga0068866_10110575
476 Ga0068863_100150216
477 Ga0068863_100295306
478 Ga0068858_100220373
479 Ga0068860_100099834
480 Ga0068860_100501251
481 Ga0068862_100141594
482 Ga0081539_10022924
483 Ga0070717_10523645
484 Ga0070716_100048378
485 Ga0070716_100064374
486 Ga0070712_100008603
487 Ga0070712_100248743
488 Ga0097621_100012301
489 Ga0097621_100649865
490 Ga0068871_100029403
491 Ga0068871_100042299
492 Ga0068871_100498159
493 Ga0075428_100991272
494 Ga0075434_100433098
495 Ga0068865_100136718
496 Ga0068865_100153724
497 Ga0075436_101417378
498 Ga0097620_100180266
499 Ga0097620_101553694
500 Ga0075435_100125765
501 Ga0099795_10082837
502 Ga0105240_11060947
503 Ga0111539_10877311
504 Ga0105245_11526342
505 Ga0114129_10393332
506 Ga0114129_11831933
507 Ga0105249_12366836
508 Ga0105239_11123737
509 Ga0157371_10139302
510 Ga0157371_10316715
511 Ga0157369_11846211
512 Ga0157374_10055128
513 Ga0157374_10170852
514 Ga0157374_10284885
515 Ga0157374_10434269
516 Ga0157378_10030394
517 Ga0157378_10065871
518 Ga0157378_10098789
519 Ga0157378_10149832
520 Ga0157378_10293860
521 Ga0157378_10505944
522 Ga0157378_10549015
523 Ga0163162_10020409
524 Ga0163162_10029487
525 Ga0163162_10055199
526 Ga0163162_10813629
527 Ga0157372_10030381
528 Ga0157372_10129280
529 Ga0157372_11410124
530 Ga0157375_10009424
531 Ga0157375_10066902
532 Ga0157375_10087656
533 Ga0157375_10106556
534 Ga0157375_10382433
535 Ga0157375_10746867
536 Ga0163163_11398187
537 Ga0157380_12607839
538 Ga0157379_11010452
539 Ga0157376_10072998
540 Ga0157376_10507940
541 Ga0163161_10013937
542 Ga0163161_10499059
543 Ga0207673_1013936
544 Ga0207697_10005972
545 Ga0207697_10010699
546 Ga0207682_10153342
547 Ga0207692_10211572
548 Ga0207692_10319175
549 Ga0207688_10056634
550 Ga0207688_10126682
551 Ga0207680_10056588
552 Ga0207699_10049313
553 Ga0207699_10097176
554 Ga0207699_10559572
555 Ga0207699_10582635
556 Ga0207645_10008104
557 Ga0207645_10080867
558 Ga0207645_10508856
559 Ga0207684_10002487
560 Ga0207684_10103146
561 Ga0207684_10105580
562 Ga0207684_10125838
563 Ga0207684_10217118
564 Ga0207693_10011975
565 Ga0207693_10044934
566 Ga0207693_10269868
567 Ga0207649_10368764
568 Ga0207646_10003906
569 Ga0207646_10041444
570 Ga0207646_10117424
571 Ga0207681_10029174
572 Ga0207681_10061286
573 Ga0207650_10029998
574 Ga0207650_10280674
575 Ga0207659_10024637
576 Ga0207659_10073299
577 Ga0207659_10077748
578 Ga0207659_10125261
579 Ga0207659_10887552
580 Ga0207700_10025689
581 Ga0207700_10490038
582 Ga0207644_10003514
583 Ga0207644_10028673
584 Ga0207644_10260551
585 Ga0207644_11432702
586 Ga0207690_10412034
587 Ga0207706_10107479
588 Ga0207670_10734917
589 Ga0207669_10057568
590 Ga0207669_10441078
591 Ga0207704_10139912
592 Ga0207665_10004292
593 Ga0207665_10020888
594 Ga0207665_10686342
595 Ga0207665_10841094
596 Ga0207691_10010382
597 Ga0207691_10055604
598 Ga0207691_10082058
599 Ga0207691_10237189
600 Ga0207661_11361057
601 Ga0207667_10570342
602 Ga0207651_10044404
603 Ga0207651_10221437
604 Ga0207651_10240439
605 Ga0207651_10574827
606 Ga0207651_11548097
607 Ga0207712_11021503
608 Ga0207668_10233165
609 Ga0207668_10298096
610 Ga0207668_10334028
611 Ga0207640_10678802
612 Ga0207658_10050595
613 Ga0207658_10170521
614 Ga0207658_10170901
615 Ga0207658_10215957
616 Ga0207658_10253834
617 Ga0207677_10093613
618 Ga0207677_10987921
619 Ga0207703_10544785
620 Ga0207678_10658679
621 Ga0207708_10725825
622 Ga0207702_10893632
623 Ga0207641_11188959
624 Ga0207641_11968271
625 Ga0207676_10567726
626 Ga0207683_10046023
627 Ga0207683_10146702
628 Ga0207683_10269907
629 Ga0207683_11560047
630 Ga0268266_10067763
631 Ga0268266_10156797
632 Ga0268266_10414156
633 Ga0268266_10443025
634 Ga0268266_10744078
635 Ga0268265_10062382
636 Ga0268264_10080767
637 Ga0268264_10392110
638 Ga0268264_11137375
639 Ga0265337_1024855
640 Ga0265338_10641437
641 Ga0265328_10019211
642 Ga0265328_10148446
643 Ga0265320_10000143
644 Ga0265329_10002367
645 Ga0265327_10002915
646 Ga0265314_10000197
647 Ga0373939_0388521
648 Ga0373941_0080155
649 Ga0373945_0221710
650 Ga0373953_0143458
651 Ga0373946_0095464
652 Ga0373955_0679621
653 Ga0373942_0113925
654 Ga0373931_0721936
655 Ga0373935_0033064
656 Ga0373935_0460097
657 Ga0373927_0020907
658 Ga0373927_0370391
659 Ga0373947_0010962
660 Ga0373947_0542616
661 Ga0373947_0546451
662 Ga0373937_0010351
663 Ga0373925_0048101
664 Ga0373925_0054164
665 Ga0373925_0240894
666 Ga0395900_0776983
667 Ga0395898_0994738
668 Ga0395901_0327006
669 Ga0436363_1305102
670 Ga0495580_0493811
671 Ga0495584_0059531
672 Ga0495652_0093869
673 Ga0495598_0409207
674 Ga0495634_0115274
675 Ga0495588_0587105
676 Ga0495657_0391391
677 Ga0495599_0198213
678 Ga0495658_0217139
679 Ga0495669_0086853
680 Ga0495669_0553795
681 Ga0495600_0456354
682 Ga0495674_0495414
683 Ga0495675_0216402
684 Ga0495684_0072291
685 Ga0496100_0026830
686 Ga0496100_0286726
687 Ga0496101_0003554
688 Ga0496102_0067923
689 Ga0496102_1515609
690 Ga0496103_0018870
691 Ga0496103_0762949
692 Ga0496106_0046962
693 Ga0496106_0487180
694 Ga0496107_0012485
695 Ga0496107_0266453
696 Ga0496107_0935629
697 Ga0496108_0271788
698 Ga0496108_0331964
699 Ga0496108_0830175
700 Ga0496108_0909400
701 Ga0496109_0024071
702 Ga0496109_0744570
703 Ga0496109_1826993
704 Ga0496110_1143535
705 Ga0496111_0635799
706 Ga0496112_0075291
707 Ga0496112_0877143
708 Ga0496112_1211911
709 Ga0496113_0028877
710 Ga0496114_0159012
711 Ga0496115_0031454
712 Ga0496115_0043240
713 Ga0501034_0211266
714 Ga0501080_0027865
715 Ga0501080_0074674
716 Ga0501080_0080204
717 Ga0501080_0398135
718 Ga0501080_0805859
719 nmdc:mga08y16_1018073_c1
720 nmdc:mga0n895_133490_c1
721 nmdc:mga0n895_297569_c1
722 nmdc:mga0n895_627023_c1
723 nmdc:mga0rr50_38897_c1
724 nmdc:mga08x19_1250822_c1
725 nmdc:mga08x19_461615_c1
726 nmdc:mga0a205_791644_c1
727 Ga0495601_0157077
728 Ga0501084_1449077

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16798

DUF5069

Domain of unknown function (DUF5069)

22

159

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3omd-assembly2.cif.gz_B crystal structure of unknown function protein from leptospirillum rubarum 0.7827 4 140
3omd-assembly2.cif.gz_B crystal structure of unknown function protein from leptospirillum rubarum 0.7213 4 140
3m03-assembly3.cif.gz_C crystal structure of human orc6 fragment 0.2441 16 86
3m03-assembly3.cif.gz_C crystal structure of human orc6 fragment 0.2085 16 86
1v9v-assembly1.cif.gz_A solution structure of putative domain of human kiaa0561 protein 0.1845 11 107
ID Description Score Start End Superfamily
1wxpA01 Mainly Alpha;Orthogonal Bundle;Death Domain, Fas;Death Domain, Fas 0.3727 24 136 1.10.533.10
af_A0A0G2JZE1_234_329_1.10.533.10 Mainly Alpha;Orthogonal Bundle;Death Domain, Fas;Death Domain, Fas 0.37 46 140 1.10.533.10
af_K7U5J1_312_402_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.3671 22 94 1.10.10.10
1wxpA01 Mainly Alpha;Orthogonal Bundle;Death Domain, Fas;Death Domain, Fas 0.3434 24 136 1.10.533.10
5v3oC03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3313 22 82 1.20.58.1480
ID Description Score Start End GO Terms
AF-A0A2V6CWI2-F1-model_v4 DUF5069 domain-containing protein 0.9846 4 81
AF-A0A2V6CWI2-F1-model_v4 DUF5069 domain-containing protein 0.9723 4 81
AF-A0A2V5MVS0-F1-model_v4 DUF5069 domain-containing protein 0.9578 1 143
AF-A0A2V8QD25-F1-model_v4 DUF5069 domain-containing protein 0.9546 1 66
AF-A0A2V5MVS0-F1-model_v4 DUF5069 domain-containing protein 0.9512 1 143

Map