F423247

General Info

Members Datasets Scaffolds Average Seq Length
364 203 344 196

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100002688|Ga0068855_1000026887
Length 211
Sequence MTLGAITHYLITNWVELAGFITTALGIWLTTKRLLICWPVVFAADILYLIVFYRARLLSDSLLQVFFIAFTLYGWXXXXRGVREDGEVRVEPLGLRAFVVAIIAGIAGTFILGEIAKHLQAALPWLDAALASFSLVGSWWQARKHVANWWLWIIVNLAYIGEYIYKDLWITAVLYAGLVVLAILGLRDWRRAARSAQTAACTTLSSGSPAI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
3 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
4 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
5 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
6 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
7 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
8 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
9 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
10 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
11 2818991457 Xanthomonas translucens 569 Isolate Unclassified
12 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
13 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
14 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
15 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
16 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
17 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
18 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
19 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
92 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
135 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
177 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
180 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
181 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
191 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
199 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
200 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
201 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
202 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
203 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.51
Metatranscriptomes 0
Isolates 5.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.82
Bulb 0
Endosphere 3.57
Nodule 0.27
Rhizoplane 2.2
Rhizosphere 84.07
Stem 0
Stem Tuber 0
Unclassified 9.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3237251 2162886007 Bacteria 2092
2 SwRhRL2b_contig_405574 2162886007 Bacteria 2720
3 JGI24743J22301_10045710 3300001991 Unclassified 886
4 Ga0055536_1000154 3300003781 Bacteria 59301
5 Ga0055530_10000171 3300003791 Bacteria 59301
6 Ga0055540_1000214 3300003792 Bacteria 54779
7 Ga0065704_10072202 3300005289 Bacteria 8954
8 Ga0065704_10075902 3300005289 Bacteria 5363
9 Ga0065712_10101746 3300005290 Bacteria 2011
10 Ga0070658_10046972 3300005327 Bacteria 3494
11 Ga0070658_10074673 3300005327 Bacteria 2780
12 Ga0070658_10199734 3300005327 Bacteria 1687
13 Ga0070683_100002041 3300005329 Bacteria 15901
14 Ga0070683_100002260 3300005329 Bacteria 15260
15 Ga0070683_100019183 3300005329 Bacteria 6072
16 Ga0070683_100133078 3300005329 Bacteria 2353
17 Ga0070683_100599664 3300005329 Bacteria 1054
18 Ga0070670_100024775 3300005331 Bacteria 5161
19 Ga0070670_100079126 3300005331 Bacteria 2825
20 Ga0068869_100001577 3300005334 Bacteria 13554
21 Ga0070666_10092030 3300005335 Bacteria 2084
22 Ga0070680_100528864 3300005336 Bacteria 1010
23 Ga0070682_100001445 3300005337 Bacteria 13369
24 Ga0068868_100000066 3300005338 Bacteria 59945
25 Ga0068868_100084157 3300005338 Bacteria 2554
26 Ga0070661_100010869 3300005344 Bacteria 6340
27 Ga0070661_100026342 3300005344 Bacteria 4182
28 Ga0070661_100191749 3300005344 Bacteria 1559
29 Ga0070669_100426431 3300005353 Bacteria 1089
30 Ga0070671_100007733 3300005355 Bacteria 8586
31 Ga0070667_100009812 3300005367 Bacteria 7936
32 Ga0070714_100046267 3300005435 Bacteria 3690
33 Ga0070713_100142163 3300005436 Bacteria 2127
34 Ga0070713_100936767 3300005436 Unclassified 834
35 Ga0070685_10231720 3300005466 Bacteria 1215
36 Ga0070679_100047148 3300005530 Bacteria 4296
37 Ga0070684_100003753 3300005535 Bacteria 11466
38 Ga0070684_100007640 3300005535 Bacteria 8429
39 Ga0070684_100221275 3300005535 Bacteria 1727
40 Ga0070684_100254603 3300005535 Bacteria 1605
41 Ga0068853_100000222 3300005539 Bacteria 40206
42 Ga0068853_100058702 3300005539 Bacteria 3322
43 Ga0070693_100068411 3300005547 Bacteria 2084
44 Ga0070693_100529643 3300005547 Bacteria 840
45 Ga0070665_100005637 3300005548 Bacteria 12872
46 Ga0070665_100055769 3300005548 Unclassified 3963
47 Ga0068855_100000277 3300005563 Bacteria 63213
48 Ga0068855_100002688 3300005563 Bacteria 21925
49 Ga0068855_100022916 3300005563 Bacteria 7484
50 Ga0068855_100413161 3300005563 Bacteria 1477
51 Ga0070664_100555456 3300005564 Bacteria 1062
52 Ga0068857_100003191 3300005577 Bacteria 13595
53 Ga0068857_100012548 3300005577 Bacteria 7379
54 Ga0068854_100231423 3300005578 Unclassified 1467
55 Ga0068856_100000512 3300005614 Bacteria 42666
56 Ga0068856_100003529 3300005614 Bacteria 15773
57 Ga0068856_100009265 3300005614 Bacteria 9564
58 Ga0068856_100057243 3300005614 Bacteria 3848
59 Ga0068856_100173748 3300005614 Bacteria 2167
60 Ga0068856_100539666 3300005614 Bacteria 1187
61 Ga0068852_100000019 3300005616 Bacteria 129021
62 Ga0068852_100000097 3300005616 Bacteria 59430
63 Ga0068852_100114751 3300005616 Bacteria 2455
64 Ga0068852_100122301 3300005616 Unclassified 2385
65 Ga0068852_100429192 3300005616 Unclassified 1305
66 Ga0068852_100471125 3300005616 Bacteria 1246
67 Ga0068852_100664226 3300005616 Unclassified 1050
68 Ga0068859_100023025 3300005617 Bacteria 6247
69 Ga0068864_100000625 3300005618 Bacteria 29830
70 Ga0068851_10007082 3300005834 Bacteria 5137
71 Ga0068851_10048948 3300005834 Bacteria 2143
72 Ga0068851_10060565 3300005834 Bacteria 1938
73 Ga0068851_10075055 3300005834 Unclassified 1756
74 Ga0068863_100001753 3300005841 Bacteria 21524
75 Ga0068858_100012165 3300005842 Bacteria 8114
76 Ga0068860_100000689 3300005843 Bacteria 38878
77 Ga0068862_100023070 3300005844 Bacteria 5212
78 Ga0075364_10442332 3300006051 Bacteria 888
79 Ga0097621_100000349 3300006237 Bacteria 31779
80 Ga0068871_100002325 3300006358 Bacteria 12946
81 Ga0097620_100023025 3300006931 Bacteria 6247
82 Ga0079104_1029024 3300006946 Bacteria 1398
83 Ga0105251_10000321 3300009011 Bacteria 48031
84 Ga0105251_10002159 3300009011 Bacteria 15778
85 Ga0105250_10032148 3300009092 Bacteria 2108
86 Ga0105240_10000372 3300009093 Bacteria 84325
87 Ga0105240_10000496 3300009093 Bacteria 72575
88 Ga0105240_10001856 3300009093 Bacteria 35314
89 Ga0105240_10064615 3300009093 Bacteria 4546
90 Ga0105240_10068360 3300009093 Unclassified 4400
91 Ga0105240_10085557 3300009093 Bacteria 3863
92 Ga0105240_10127298 3300009093 Bacteria 3059
93 Ga0105240_10311427 3300009093 Bacteria 1798
94 Ga0105245_10000486 3300009098 Bacteria 36378
95 Ga0105247_10002346 3300009101 Bacteria 12922
96 Ga0105243_10022374 3300009148 Bacteria 4804
97 Ga0105241_10000026 3300009174 Bacteria 132695
98 Ga0105241_10000121 3300009174 Bacteria 57041
99 Ga0105241_10009216 3300009174 Bacteria 7261
100 Ga0105241_10059096 3300009174 Unclassified 2947
101 Ga0105241_10186853 3300009174 Bacteria 1723
102 Ga0105248_10034015 3300009177 Bacteria 5697
103 Ga0105248_10081067 3300009177 Unclassified 3648
104 Ga0105237_10000590 3300009545 Bacteria 50564
105 Ga0105237_10041670 3300009545 Unclassified 4630
106 Ga0105237_10477611 3300009545 Bacteria 1253
107 Ga0105237_10482805 3300009545 Bacteria 1245
108 Ga0105237_10899893 3300009545 Unclassified 892
109 Ga0105238_10000197 3300009551 Bacteria 66637
110 Ga0105238_10000509 3300009551 Bacteria 40868
111 Ga0105238_10119680 3300009551 Unclassified 2613
112 Ga0105238_10276290 3300009551 Bacteria 1661
113 Ga0105249_10120013 3300009553 Bacteria 2498
114 Ga0105239_10001891 3300010375 Bacteria 27379
115 Ga0105239_10021514 3300010375 Bacteria 7110
116 Ga0105239_10052641 3300010375 Unclassified 4464
117 Ga0105246_10000006 3300011119 Bacteria 83887
118 Ga0105246_10001192 3300011119 Bacteria 15150
119 Ga0157373_10701603 3300013100 Bacteria 742
120 Ga0157371_10000333 3300013102 Bacteria 60809
121 Ga0157371_10065246 3300013102 Bacteria 2579
122 Ga0157370_10000005 3300013104 Bacteria 288514
123 Ga0157369_10000085 3300013105 Bacteria 129025
124 Ga0157369_10000430 3300013105 Bacteria 55736
125 Ga0157369_10016814 3300013105 Bacteria 8221
126 Ga0157369_10024598 3300013105 Bacteria 6696
127 Ga0157369_10026044 3300013105 Bacteria 6489
128 Ga0157369_10140829 3300013105 Unclassified 2552
129 Ga0157369_10463439 3300013105 Bacteria 1312
130 Ga0157374_10031721 3300013296 Bacteria 4805
131 Ga0157374_10182413 3300013296 Bacteria 2051
132 Ga0157374_10198663 3300013296 Bacteria 1963
133 Ga0157378_10004251 3300013297 Bacteria 12630
134 Ga0157378_10018090 3300013297 Bacteria 6188
135 Ga0157378_10425368 3300013297 Unclassified 1313
136 Ga0163162_10010079 3300013306 Bacteria 9185
137 Ga0163162_10080239 3300013306 Bacteria 3330
138 Ga0163162_10500306 3300013306 Bacteria 1346
139 Ga0157372_10000217 3300013307 Bacteria 63667
140 Ga0157372_10009734 3300013307 Bacteria 10222
141 Ga0157372_10017083 3300013307 Bacteria 7789
142 Ga0157372_10020181 3300013307 Bacteria 7185
143 Ga0157372_10082332 3300013307 Bacteria 3643
144 Ga0157372_10105164 3300013307 Bacteria 3229
145 Ga0157372_10163132 3300013307 Bacteria 2576
146 Ga0157372_10210743 3300013307 Bacteria 2252
147 Ga0157375_11225608 3300013308 Bacteria 881
148 Ga0163163_10001161 3300014325 Bacteria 22403
149 Ga0157377_10060827 3300014745 Bacteria 2157
150 Ga0157377_10210870 3300014745 Bacteria 1238
151 Ga0157379_10002312 3300014968 Bacteria 15882
152 Ga0157379_10224971 3300014968 Unclassified 1700
153 Ga0157376_10000296 3300014969 Bacteria 33604
154 Ga0157376_10012770 3300014969 Bacteria 6246
155 Ga0182006_1008227 3300015261 Bacteria 4732
156 Ga0163161_10000853 3300017792 Bacteria 23771
157 Ga0163161_10063024 3300017792 Bacteria 2701
158 Ga0213874_10100155 3300021377 Bacteria 962
159 Ga0209759_1007978 3300025256 Bacteria 3345
160 Ga0209129_1000392 3300025258 Bacteria 35184
161 Ga0209676_1000147 3300025292 Bacteria 172386
162 Ga0209758_1007929 3300025297 Bacteria 7044
163 Ga0209050_1000062 3300025298 Bacteria 316538
164 Ga0209051_1000409 3300025303 Bacteria 59325
165 Ga0207656_10004048 3300025321 Bacteria 5084
166 Ga0207696_1000016 3300025711 Bacteria 502467
167 Ga0207713_1000222 3300025735 Bacteria 76645
168 Ga0207713_1000884 3300025735 Bacteria 27297
169 Ga0207710_10000487 3300025900 Bacteria 25053
170 Ga0207680_10219124 3300025903 Bacteria 1304
171 Ga0207705_10026733 3300025909 Bacteria 4113
172 Ga0207705_10036415 3300025909 Bacteria 3522
173 Ga0207654_10000054 3300025911 Bacteria 82347
174 Ga0207654_10000281 3300025911 Bacteria 30979
175 Ga0207654_10003128 3300025911 Bacteria 8380
176 Ga0207654_10109085 3300025911 Bacteria 1718
177 Ga0207707_10016561 3300025912 Bacteria 6428
178 Ga0207695_10000080 3300025913 Bacteria 287868
179 Ga0207695_10000113 3300025913 Bacteria 247240
180 Ga0207695_10000167 3300025913 Bacteria 194371
181 Ga0207695_10005013 3300025913 Bacteria 17778
182 Ga0207695_10037312 3300025913 Bacteria 5244
183 Ga0207695_10060369 3300025913 Bacteria 3925
184 Ga0207671_10000065 3300025914 Bacteria 166743
185 Ga0207671_10000123 3300025914 Bacteria 119385
186 Ga0207671_10000139 3300025914 Bacteria 111786
187 Ga0207671_10227416 3300025914 Bacteria 1463
188 Ga0207671_10414112 3300025914 Bacteria 1072
189 Ga0207649_10063255 3300025920 Unclassified 2335
190 Ga0207649_10657902 3300025920 Bacteria 810
191 Ga0207652_10109533 3300025921 Bacteria 2449
192 Ga0207681_10353290 3300025923 Bacteria 1177
193 Ga0207694_10000248 3300025924 Bacteria 51461
194 Ga0207694_10000855 3300025924 Bacteria 27098
195 Ga0207694_10012616 3300025924 Bacteria 6368
196 Ga0207694_10053280 3300025924 Bacteria 3137
197 Ga0207694_10166466 3300025924 Bacteria 1783
198 Ga0207650_10056727 3300025925 Bacteria 2911
199 Ga0207650_10063539 3300025925 Bacteria 2760
200 Ga0207687_10000978 3300025927 Bacteria 19404
201 Ga0207687_10061410 3300025927 Unclassified 2654
202 Ga0207687_10112060 3300025927 Bacteria 2027
203 Ga0207700_10154360 3300025928 Unclassified 1901
204 Ga0207664_10083411 3300025929 Bacteria 2605
205 Ga0207644_10004420 3300025931 Bacteria 9123
206 Ga0207709_10094141 3300025935 Bacteria 1966
207 Ga0207711_10060353 3300025941 Unclassified 3267
208 Ga0207711_10273081 3300025941 Bacteria 1556
209 Ga0207689_10000724 3300025942 Bacteria 31641
210 Ga0207661_10001283 3300025944 Bacteria 16799
211 Ga0207661_10018246 3300025944 Bacteria 5211
212 Ga0207661_10192435 3300025944 Bacteria 1789
213 Ga0207661_10966606 3300025944 Bacteria 784
214 Ga0207679_10024591 3300025945 Unclassified 4131
215 Ga0207667_10006194 3300025949 Bacteria 14522
216 Ga0207667_10007990 3300025949 Bacteria 12622
217 Ga0207667_10048192 3300025949 Bacteria 4506
218 Ga0207667_10153024 3300025949 Unclassified 2374
219 Ga0207667_10407028 3300025949 Bacteria 1385
220 Ga0207712_10110215 3300025961 Bacteria 2063
221 Ga0207640_10020377 3300025981 Bacteria 3937
222 Ga0207658_10003428 3300025986 Bacteria 11222
223 Ga0207677_10000143 3300026023 Bacteria 58337
224 Ga0207677_10085080 3300026023 Bacteria 2281
225 Ga0207703_10004820 3300026035 Bacteria 10980
226 Ga0207639_10000088 3300026041 Bacteria 78742
227 Ga0207639_10061122 3300026041 Bacteria 2908
228 Ga0207639_10319936 3300026041 Bacteria 1377
229 Ga0207702_10001334 3300026078 Bacteria 24682
230 Ga0207702_10002672 3300026078 Bacteria 16738
231 Ga0207702_10015520 3300026078 Bacteria 6306
232 Ga0207702_10109911 3300026078 Bacteria 2449
233 Ga0207702_10197544 3300026078 Unclassified 1862
234 Ga0207641_10011936 3300026088 Bacteria 7127
235 Ga0207676_10002595 3300026095 Bacteria 12891
236 Ga0207674_10000669 3300026116 Bacteria 44573
237 Ga0207674_10003068 3300026116 Bacteria 20665
238 Ga0207674_10307226 3300026116 Unclassified 1535
239 Ga0207698_10000003 3300026142 Bacteria 321303
240 Ga0207698_10000708 3300026142 Bacteria 19330
241 Ga0207698_10525140 3300026142 Bacteria 1156
242 Ga0265356_1010246 3300028017 Unclassified 1046
243 Ga0265357_1008033 3300028023 Unclassified 1030
244 Ga0268266_10068745 3300028379 Bacteria 3068
245 Ga0268266_10098647 3300028379 Bacteria 2571
246 Ga0268264_10000598 3300028381 Bacteria 43640
247 Ga0265323_10007390 3300028653 Bacteria 4569
248 Ga0265338_10004495 3300028800 Bacteria 18805
249 Ga0265338_10114279 3300028800 Bacteria 2167
250 Ga0265338_10307429 3300028800 Unclassified 1151
251 Ga0265324_10075921 3300029957 Bacteria 1144
252 Ga0265330_10002162 3300031235 Bacteria 10830
253 Ga0265330_10014322 3300031235 Bacteria 3681
254 Ga0265339_10000194 3300031249 Bacteria 50375
255 Ga0265339_10101482 3300031249 Bacteria 1497
256 Ga0265316_10000352 3300031344 Bacteria 51670
257 Ga0265316_10056454 3300031344 Bacteria 3066
258 Ga0265316_10058084 3300031344 Bacteria 3016
259 Ga0265316_10323321 3300031344 Bacteria 1120
260 Ga0307408_100000004 3300031548 Bacteria 572889
261 Ga0316575_10012827 3300031665 Bacteria 3124
262 Ga0265314_10009910 3300031711 Bacteria 7992
263 Ga0265314_10110795 3300031711 Unclassified 1745
264 Ga0265342_10001536 3300031712 Bacteria 21355
265 Ga0265342_10002441 3300031712 Bacteria 16049
266 Ga0265342_10082053 3300031712 Bacteria 1861
267 Ga0307405_10000897 3300031731 Bacteria 11819
268 Ga0373927_0272039 3300035695 Bacteria 1114
269 Ga0373937_0377362 3300036401 Unclassified 1345
270 Ga0373937_0438256 3300036401 Bacteria 1240
271 Ga0395899_0015555 3300037312 Bacteria 5801
272 Ga0395901_0010291 3300038443 Bacteria 9472
273 Ga0395901_0012867 3300038443 Bacteria 8485
274 Ga0436363_0913429 3300039450 Bacteria 974
275 Ga0451851_0085375 3300041507 Bacteria 755
276 Ga0439464_0035256 3300042439 Bacteria 1412
277 Ga0466963_0000494 3300044694 Bacteria 18341
278 Ga0466967_0029373 3300045976 Unclassified 4600
279 Ga0495627_000039 3300046453 Bacteria 197253
280 Ga0495627_000078 3300046453 Bacteria 119920
281 Ga0495627_037945 3300046453 Bacteria 1492
282 Ga0495629_0017355 3300046459 Bacteria 5158
283 Ga0495629_0024210 3300046459 Bacteria 4323
284 Ga0495607_0017584 3300046501 Bacteria 4584
285 Ga0495583_0002316 3300046506 Bacteria 16594
286 Ga0495606_0000054 3300046507 Bacteria 200380
287 Ga0495610_0001902 3300046512 Bacteria 18014
288 Ga0495610_0078259 3300046512 Bacteria 1525
289 Ga0495620_0004313 3300046515 Bacteria 8039
290 Ga0495632_0029255 3300046519 Bacteria 2870
291 Ga0495643_0000081 3300046522 Bacteria 160004
292 Ga0495643_0022213 3300046522 Bacteria 3623
293 Ga0495648_0001153 3300046524 Bacteria 26712
294 Ga0495652_0048616 3300046529 Bacteria 3633
295 Ga0495652_0531857 3300046529 Bacteria 811
296 Ga0495654_0003891 3300046530 Bacteria 9027
297 Ga0495654_0092786 3300046530 Bacteria 1399
298 Ga0495587_0108134 3300046536 Bacteria 1599
299 Ga0495633_0008408 3300046558 Bacteria 5818
300 Ga0495611_0128548 3300046648 Bacteria 1182
301 Ga0495625_0025897 3300046660 Bacteria 4439
302 Ga0495625_0157388 3300046660 Bacteria 1524
303 Ga0495625_0441197 3300046660 Bacteria 806
304 Ga0495661_0000505 3300046665 Bacteria 40769
305 Ga0495613_0066602 3300046689 Unclassified 2630
306 Ga0495613_0081507 3300046689 Bacteria 2351
307 Ga0495671_0001437 3300046692 Bacteria 15995
308 Ga0495649_0000582 3300046694 Bacteria 30652
309 Ga0495649_0076345 3300046694 Bacteria 1793
310 Ga0495604_0118324 3300047317 Bacteria 1921
311 Ga0495683_0000086 3300047323 Bacteria 92967
312 Ga0495679_000316 3300047446 Bacteria 38517
313 Ga0495679_000618 3300047446 Bacteria 23992
314 Ga0495681_0015970 3300047470 Bacteria 4234
315 Ga0496105_0232622 3300048908 Bacteria 1497
316 Ga0496110_0750671 3300048913 Bacteria 879
317 Ga0496114_0211501 3300048917 Bacteria 1701
318 Ga0496115_0044591 3300048918 Unclassified 3538
319 Ga0496117_0000522 3300048920 Bacteria 63473
320 Ga0496117_0001048 3300048920 Bacteria 42168
321 Ga0496117_0125341 3300048920 Bacteria 1569
322 Ga0496118_0000246 3300048921 Bacteria 96199
323 Ga0496118_0091639 3300048921 Bacteria 2089
324 Ga0496118_0174125 3300048921 Bacteria 1310
325 Ga0496119_0000464 3300048922 Bacteria 55314
326 Ga0496120_0000587 3300048923 Bacteria 55315
327 Ga0496122_0000888 3300048925 Bacteria 55669
328 Ga0496123_0000687 3300048926 Bacteria 55771
329 Ga0496124_0000480 3300048927 Bacteria 68741
330 Ga0496124_0011604 3300048927 Bacteria 8793
331 Ga0496124_0041594 3300048927 Bacteria 3964
332 Ga0496124_0181427 3300048927 Bacteria 1619
333 Ga0496124_0446288 3300048927 Bacteria 883
334 Ga0496125_0000068 3300048928 Bacteria 247765
335 Ga0496125_0045981 3300048928 Bacteria 3667
336 Ga0496126_0009252 3300048929 Bacteria 10501
337 Ga0496126_0019570 3300048929 Bacteria 6663
338 Ga0495678_036781 3300049459 Bacteria 1995
339 Ga0501034_1134802 3300049571 Bacteria 662
340 Ga0495601_0148368 3300053077 Unclassified 1531
341 Ga0500644_0093138 3300053088 Bacteria 1132
342 Ga0500573_0065089 3300053140 Bacteria 2084
343 Ga0500634_0000085 3300053161 Bacteria 36085
344 Ga0500634_0000863 3300053161 Bacteria 10788

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_100936767 Ga0070713_1009367672 157
2 3300005539 Ga0068853_100058702 Ga0068853_1000587022 162
3 3300025914 Ga0207671_10227416 Ga0207671_102274162 162
4 3300026078 Ga0207702_10197544 Ga0207702_101975442 162
5 3300028023 Ga0265357_1008033 Ga0265357_10080332 162
6 3300005329 Ga0070683_100599664 Ga0070683_1005996642 163
7 3300028800 Ga0265338_10004495 Ga0265338_1000449515 167
8 3300029957 Ga0265324_10075921 Ga0265324_100759212 167
9 3300031711 Ga0265314_10009910 Ga0265314_100099107 167
10 3300046660 Ga0495625_0157388 Ga0495625_0157388_33_542 167
11 3300015261 Ga0182006_1008227 Ga0182006_10082274 172
12 3300031249 Ga0265339_10101482 Ga0265339_101014822 172
13 3300013105 Ga0157369_10026044 Ga0157369_100260442 173
14 3300037312 Ga0395899_0015555 Ga0395899_0015555_4394_4969 173
15 3300038443 Ga0395901_0010291 Ga0395901_0010291_5115_5690 173
16 3300038443 Ga0395901_0012867 Ga0395901_0012867_2649_3224 173
17 3300005336 Ga0070680_100528864 Ga0070680_1005288641 174
18 3300005337 Ga0070682_100001445 Ga0070682_1000014457 174
19 3300013102 Ga0157371_10065246 Ga0157371_100652462 174
20 3300031711 Ga0265314_10110795 Ga0265314_101107952 174
21 3300005329 Ga0070683_100002260 Ga0070683_10000226013 175
22 3300005535 Ga0070684_100003753 Ga0070684_1000037532 175
23 3300005616 Ga0068852_100471125 Ga0068852_1004711252 175
24 3300005834 Ga0068851_10007082 Ga0068851_100070823 175
25 3300025927 Ga0207687_10112060 Ga0207687_101120602 175
26 3300025944 Ga0207661_10018246 Ga0207661_100182462 175
27 3300026041 Ga0207639_10061122 Ga0207639_100611222 175
28 3300026041 Ga0207639_10319936 Ga0207639_103199362 175
29 3300035695 Ga0373927_0272039 Ga0373927_0272039_470_1102 175
30 3300036401 Ga0373937_0438256 Ga0373937_0438256_325_957 175
31 3300046459 Ga0495629_0024210 Ga0495629_0024210_388_1020 175
32 3300046529 Ga0495652_0048616 Ga0495652_0048616_1741_2373 175
33 3300046536 Ga0495587_0108134 Ga0495587_0108134_274_906 175
34 3300046689 Ga0495613_0081507 Ga0495613_0081507_724_1356 175
35 3300047317 Ga0495604_0118324 Ga0495604_0118324_1114_1746 175
36 3300013297 Ga0157378_10004251 Ga0157378_100042517 176
37 3300013307 Ga0157372_10163132 Ga0157372_101631322 176
38 3300028017 Ga0265356_1010246 Ga0265356_10102462 176
39 3300031344 Ga0265316_10058084 Ga0265316_100580842 176
40 3300031712 Ga0265342_10082053 Ga0265342_100820532 176
41 3300005466 Ga0070685_10231720 Ga0070685_102317201 177
42 3300014745 Ga0157377_10060827 Ga0157377_100608272 177
43 3300009011 Ga0105251_10002159 Ga0105251_100021596 178
44 3300005435 Ga0070714_100046267 Ga0070714_1000462674 181
45 3300025929 Ga0207664_10083411 Ga0207664_100834112 181
46 3300006946 Ga0079104_1029024 Ga0079104_10290242 182
47 3300009174 Ga0105241_10186853 Ga0105241_101868532 182
48 2162886007 SwRhRL2b_contig_405574 SwRhRL2b_0564.00005700 183
49 3300005289 Ga0065704_10075902 Ga0065704_100759025 183
50 3300005331 Ga0070670_100079126 Ga0070670_1000791261 183
51 3300005338 Ga0068868_100084157 Ga0068868_1000841572 183
52 3300005353 Ga0070669_100426431 Ga0070669_1004264312 183
53 3300009011 Ga0105251_10000321 Ga0105251_1000032115 183
54 3300009545 Ga0105237_10477611 Ga0105237_104776112 183
55 3300025735 Ga0207713_1000222 Ga0207713_100022236 183
56 3300025923 Ga0207681_10353290 Ga0207681_103532902 183
57 3300025925 Ga0207650_10056727 Ga0207650_100567271 183
58 3300026023 Ga0207677_10085080 Ga0207677_100850802 183
59 3300028800 Ga0265338_10307429 Ga0265338_103074292 183
60 3300044694 Ga0466963_0000494 Ga0466963_0000494_5549_6184 183
61 3300045976 Ga0466967_0029373 Ga0466967_0029373_3425_4060 183
62 3300048918 Ga0496115_0044591 Ga0496115_0044591_2353_2988 183
63 3300048920 Ga0496117_0001048 Ga0496117_0001048_41155_41736 183
64 3300048921 Ga0496118_0091639 Ga0496118_0091639_1264_1845 183
65 3300048922 Ga0496119_0000464 Ga0496119_0000464_41155_41736 183
66 3300048923 Ga0496120_0000587 Ga0496120_0000587_13580_14161 183
67 3300048925 Ga0496122_0000888 Ga0496122_0000888_41378_41959 183
68 3300048926 Ga0496123_0000687 Ga0496123_0000687_13712_14293 183
69 3300048927 Ga0496124_0000480 Ga0496124_0000480_30507_31088 183
70 3300048920 Ga0496117_0125341 Ga0496117_0125341_474_1049 184
71 3300048921 Ga0496118_0174125 Ga0496118_0174125_506_1081 184
72 iso_pu_bacteria 8034962539 8034964775 184
73 3300001991 JGI24743J22301_10045710 JGI24743J22301_100457101 185
74 3300005327 Ga0070658_10046972 Ga0070658_100469723 185
75 3300005329 Ga0070683_100002041 Ga0070683_1000020413 185
76 3300005329 Ga0070683_100133078 Ga0070683_1001330782 185
77 3300005331 Ga0070670_100024775 Ga0070670_1000247752 185
78 3300005334 Ga0068869_100001577 Ga0068869_1000015777 185
79 3300005335 Ga0070666_10092030 Ga0070666_100920302 185
80 3300005338 Ga0068868_100000066 Ga0068868_10000006621 185
81 3300005344 Ga0070661_100010869 Ga0070661_1000108693 185
82 3300005355 Ga0070671_100007733 Ga0070671_1000077336 185
83 3300005367 Ga0070667_100009812 Ga0070667_1000098123 185
84 3300005535 Ga0070684_100007640 Ga0070684_1000076403 185
85 3300005535 Ga0070684_100221275 Ga0070684_1002212752 185
86 3300005539 Ga0068853_100000222 Ga0068853_10000022232 185
87 3300005547 Ga0070693_100529643 Ga0070693_1005296431 185
88 3300005563 Ga0068855_100000277 Ga0068855_10000027720 185
89 3300005563 Ga0068855_100413161 Ga0068855_1004131612 185
90 3300005564 Ga0070664_100555456 Ga0070664_1005554562 185
91 3300005577 Ga0068857_100003191 Ga0068857_10000319113 185
92 3300005577 Ga0068857_100012548 Ga0068857_1000125487 185
93 3300005614 Ga0068856_100000512 Ga0068856_1000005124 185
94 3300005614 Ga0068856_100003529 Ga0068856_10000352913 185
95 3300005614 Ga0068856_100009265 Ga0068856_1000092652 185
96 3300005616 Ga0068852_100000097 Ga0068852_10000009736 185
97 3300005616 Ga0068852_100114751 Ga0068852_1001147512 185
98 3300005617 Ga0068859_100023025 Ga0068859_1000230255 185
99 3300005618 Ga0068864_100000625 Ga0068864_1000006258 185
100 3300005834 Ga0068851_10048948 Ga0068851_100489482 185
101 3300005834 Ga0068851_10060565 Ga0068851_100605652 185
102 3300005834 Ga0068851_10075055 Ga0068851_100750552 185
103 3300005841 Ga0068863_100001753 Ga0068863_1000017533 185
104 3300005842 Ga0068858_100012165 Ga0068858_1000121657 185
105 3300005843 Ga0068860_100000689 Ga0068860_1000006893 185
106 3300005844 Ga0068862_100023070 Ga0068862_1000230704 185
107 3300006237 Ga0097621_100000349 Ga0097621_10000034911 185
108 3300006358 Ga0068871_100002325 Ga0068871_1000023253 185
109 3300006931 Ga0097620_100023025 Ga0097620_1000230255 185
110 3300009093 Ga0105240_10000372 Ga0105240_1000037255 185
111 3300009093 Ga0105240_10064615 Ga0105240_100646152 185
112 3300009098 Ga0105245_10000486 Ga0105245_1000048622 185
113 3300009101 Ga0105247_10002346 Ga0105247_100023463 185
114 3300009174 Ga0105241_10000026 Ga0105241_1000002619 185
115 3300009174 Ga0105241_10009216 Ga0105241_100092164 185
116 3300009177 Ga0105248_10081067 Ga0105248_100810673 185
117 3300009545 Ga0105237_10000590 Ga0105237_100005903 185
118 3300009545 Ga0105237_10041670 Ga0105237_100416702 185
119 3300009545 Ga0105237_10482805 Ga0105237_104828051 185
120 3300009551 Ga0105238_10000197 Ga0105238_1000019720 185
121 3300009551 Ga0105238_10000509 Ga0105238_1000050921 185
122 3300009551 Ga0105238_10276290 Ga0105238_102762902 185
123 3300009553 Ga0105249_10120013 Ga0105249_101200132 185
124 3300010375 Ga0105239_10001891 Ga0105239_1000189121 185
125 3300010375 Ga0105239_10052641 Ga0105239_100526414 185
126 3300011119 Ga0105246_10001192 Ga0105246_100011927 185
127 3300013105 Ga0157369_10000430 Ga0157369_1000043034 185
128 3300013105 Ga0157369_10463439 Ga0157369_104634392 185
129 3300013297 Ga0157378_10018090 Ga0157378_100180903 185
130 3300013306 Ga0163162_10080239 Ga0163162_100802393 185
131 3300013307 Ga0157372_10009734 Ga0157372_100097342 185
132 3300013307 Ga0157372_10082332 Ga0157372_100823322 185
133 3300013307 Ga0157372_10210743 Ga0157372_102107432 185
134 3300014325 Ga0163163_10001161 Ga0163163_100011613 185
135 3300014745 Ga0157377_10210870 Ga0157377_102108702 185
136 3300014968 Ga0157379_10002312 Ga0157379_100023122 185
137 3300014968 Ga0157379_10224971 Ga0157379_102249713 185
138 3300014969 Ga0157376_10000296 Ga0157376_100002966 185
139 3300025321 Ga0207656_10004048 Ga0207656_100040483 185
140 3300025900 Ga0207710_10000487 Ga0207710_100004875 185
141 3300025903 Ga0207680_10219124 Ga0207680_102191242 185
142 3300025909 Ga0207705_10036415 Ga0207705_100364153 185
143 3300025911 Ga0207654_10000281 Ga0207654_1000028117 185
144 3300025911 Ga0207654_10003128 Ga0207654_100031285 185
145 3300025911 Ga0207654_10109085 Ga0207654_101090852 185
146 3300025913 Ga0207695_10000113 Ga0207695_10000113163 185
147 3300025913 Ga0207695_10005013 Ga0207695_100050134 185
148 3300025914 Ga0207671_10000065 Ga0207671_1000006579 185
149 3300025914 Ga0207671_10000123 Ga0207671_1000012393 185
150 3300025914 Ga0207671_10000139 Ga0207671_1000013954 185
151 3300025924 Ga0207694_10000248 Ga0207694_1000024834 185
152 3300025924 Ga0207694_10000855 Ga0207694_100008554 185
153 3300025924 Ga0207694_10166466 Ga0207694_101664662 185
154 3300025925 Ga0207650_10063539 Ga0207650_100635393 185
155 3300025927 Ga0207687_10000978 Ga0207687_100009786 185
156 3300025931 Ga0207644_10004420 Ga0207644_100044203 185
157 3300025941 Ga0207711_10273081 Ga0207711_102730812 185
158 3300025942 Ga0207689_10000724 Ga0207689_1000072424 185
159 3300025944 Ga0207661_10001283 Ga0207661_1000128315 185
160 3300025944 Ga0207661_10192435 Ga0207661_101924352 185
161 3300025945 Ga0207679_10024591 Ga0207679_100245914 185
162 3300025949 Ga0207667_10006194 Ga0207667_100061947 185
163 3300025949 Ga0207667_10407028 Ga0207667_104070282 185
164 3300025961 Ga0207712_10110215 Ga0207712_101102152 185
165 3300025986 Ga0207658_10003428 Ga0207658_100034283 185
166 3300026023 Ga0207677_10000143 Ga0207677_1000014329 185
167 3300026035 Ga0207703_10004820 Ga0207703_100048203 185
168 3300026041 Ga0207639_10000088 Ga0207639_1000008811 185
169 3300026078 Ga0207702_10001334 Ga0207702_100013349 185
170 3300026078 Ga0207702_10002672 Ga0207702_100026726 185
171 3300026078 Ga0207702_10015520 Ga0207702_100155203 185
172 3300026088 Ga0207641_10011936 Ga0207641_100119363 185
173 3300026095 Ga0207676_10002595 Ga0207676_100025957 185
174 3300026116 Ga0207674_10000669 Ga0207674_1000066918 185
175 3300026116 Ga0207674_10003068 Ga0207674_1000306817 185
176 3300026116 Ga0207674_10307226 Ga0207674_103072262 185
177 3300026142 Ga0207698_10000708 Ga0207698_100007089 185
178 3300028381 Ga0268264_10000598 Ga0268264_1000059826 185
179 3300031665 Ga0316575_10012827 Ga0316575_100128273 185
180 3300048908 Ga0496105_0232622 Ga0496105_0232622_31_666 185
181 3300048917 Ga0496114_0211501 Ga0496114_0211501_487_1122 185
182 iso_pu_bacteria 2600254954 2600444695 185
183 iso_pu_bacteria 2600255389 2602012012 185
184 iso_pu_bacteria 2823421272 2823423655 185
185 iso_pu_bacteria 2919501602 2919503408 185
186 iso_pu_bacteria 2926063275 2926066021 185
187 3300005548 Ga0070665_100055769 Ga0070665_1000557692 186
188 3300005616 Ga0068852_100122301 Ga0068852_1001223012 186
189 3300009093 Ga0105240_10068360 Ga0105240_100683603 186
190 3300013296 Ga0157374_10182413 Ga0157374_101824132 186
191 3300014969 Ga0157376_10012770 Ga0157376_100127703 186
192 3300025913 Ga0207695_10037312 Ga0207695_100373123 186
193 3300028379 Ga0268266_10098647 Ga0268266_100986473 186
194 3300031344 Ga0265316_10323321 Ga0265316_103233212 186
195 3300036401 Ga0373937_0377362 Ga0373937_0377362_295_930 186
196 3300046453 Ga0495627_037945 Ga0495627_037945_332_913 186
197 3300046459 Ga0495629_0017355 Ga0495629_0017355_2139_2774 186
198 3300046519 Ga0495632_0029255 Ga0495632_0029255_189_770 186
199 3300046558 Ga0495633_0008408 Ga0495633_0008408_2187_2768 186
200 3300046689 Ga0495613_0066602 Ga0495613_0066602_179_814 186
201 3300053077 Ga0495601_0148368 Ga0495601_0148368_332_967 186
202 3300053088 Ga0500644_0093138 Ga0500644_0093138_453_1034 186
203 3300053161 Ga0500634_0000863 Ga0500634_0000863_1804_2385 186
204 iso_pu_bacteria 2734482258 2735817377 186
205 iso_pu_bacteria 8021622325 8021625747 186
206 iso_pu_bacteria 8021648035 8021650321 186
207 3300005616 Ga0068852_100429192 Ga0068852_1004291922 187
208 3300046453 Ga0495627_000078 Ga0495627_000078_44628_45191 187
209 iso_pu_bacteria 2747842501 2748019439 187
210 3300005344 Ga0070661_100026342 Ga0070661_1000263422 188
211 3300005614 Ga0068856_100173748 Ga0068856_1001737482 188
212 3300009093 Ga0105240_10311427 Ga0105240_103114272 188
213 3300013307 Ga0157372_10105164 Ga0157372_101051642 188
214 3300013308 Ga0157375_11225608 Ga0157375_112256082 188
215 3300025914 Ga0207671_10414112 Ga0207671_104141122 188
216 3300026078 Ga0207702_10109911 Ga0207702_101099112 188
217 3300026142 Ga0207698_10525140 Ga0207698_105251402 188
218 3300028653 Ga0265323_10007390 Ga0265323_100073904 188
219 3300031235 Ga0265330_10002162 Ga0265330_100021623 188
220 3300031235 Ga0265330_10014322 Ga0265330_100143224 188
221 3300031344 Ga0265316_10000352 Ga0265316_1000035230 188
222 3300031344 Ga0265316_10056454 Ga0265316_100564543 188
223 3300031712 Ga0265342_10002441 Ga0265342_100024412 188
224 3300046512 Ga0495610_0078259 Ga0495610_0078259_769_1335 188
225 3300046515 Ga0495620_0004313 Ga0495620_0004313_6283_6849 188
226 3300046524 Ga0495648_0001153 Ga0495648_0001153_1314_1880 188
227 3300046530 Ga0495654_0092786 Ga0495654_0092786_203_769 188
228 3300046665 Ga0495661_0000505 Ga0495661_0000505_24958_25524 188
229 3300047446 Ga0495679_000618 Ga0495679_000618_6362_6928 188
230 3300053161 Ga0500634_0000085 Ga0500634_0000085_25122_25688 188
231 3300005327 Ga0070658_10199734 Ga0070658_101997342 189
232 3300005329 Ga0070683_100019183 Ga0070683_1000191832 189
233 3300005344 Ga0070661_100191749 Ga0070661_1001917492 189
234 3300005436 Ga0070713_100142163 Ga0070713_1001421632 189
235 3300005535 Ga0070684_100254603 Ga0070684_1002546032 189
236 3300005563 Ga0068855_100022916 Ga0068855_1000229164 189
237 3300005578 Ga0068854_100231423 Ga0068854_1002314232 189
238 3300005614 Ga0068856_100057243 Ga0068856_1000572432 189
239 3300005614 Ga0068856_100539666 Ga0068856_1005396662 189
240 3300005616 Ga0068852_100664226 Ga0068852_1006642262 189
241 3300009093 Ga0105240_10085557 Ga0105240_100855573 189
242 3300009545 Ga0105237_10899893 Ga0105237_108998931 189
243 3300013105 Ga0157369_10016814 Ga0157369_100168143 189
244 3300013105 Ga0157369_10140829 Ga0157369_101408293 189
245 3300013307 Ga0157372_10017083 Ga0157372_100170833 189
246 3300013307 Ga0157372_10020181 Ga0157372_100201813 189
247 3300021377 Ga0213874_10100155 Ga0213874_101001552 189
248 3300025909 Ga0207705_10026733 Ga0207705_100267333 189
249 3300025913 Ga0207695_10060369 Ga0207695_100603693 189
250 3300025920 Ga0207649_10063255 Ga0207649_100632553 189
251 3300025924 Ga0207694_10053280 Ga0207694_100532802 189
252 3300025928 Ga0207700_10154360 Ga0207700_101543602 189
253 3300025944 Ga0207661_10966606 Ga0207661_109666061 189
254 3300025949 Ga0207667_10048192 Ga0207667_100481922 189
255 3300025949 Ga0207667_10153024 Ga0207667_101530243 189
256 3300025981 Ga0207640_10020377 Ga0207640_100203774 189
257 3300031548 Ga0307408_100000004 Ga0307408_100000004300 189
258 3300039450 Ga0436363_0913429 Ga0436363_0913429_73_642 189
259 3300042439 Ga0439464_0035256 Ga0439464_0035256_343_912 189
260 3300017792 Ga0163161_10063024 Ga0163161_100630243 190
261 3300025258 Ga0209129_1000392 Ga0209129_10003923 190
262 3300025297 Ga0209758_1007929 Ga0209758_10079292 190
263 3300006051 Ga0075364_10442332 Ga0075364_104423321 191
264 3300009093 Ga0105240_10127298 Ga0105240_101272982 191
265 3300031249 Ga0265339_10000194 Ga0265339_100001949 191
266 3300031712 Ga0265342_10001536 Ga0265342_1000153613 191
267 3300005327 Ga0070658_10074673 Ga0070658_100746731 192
268 3300005548 Ga0070665_100005637 Ga0070665_1000056373 192
269 3300009174 Ga0105241_10000121 Ga0105241_100001218 192
270 3300013105 Ga0157369_10024598 Ga0157369_100245984 192
271 3300025911 Ga0207654_10000054 Ga0207654_1000005452 192
272 3300028379 Ga0268266_10068745 Ga0268266_100687452 192
273 3300028800 Ga0265338_10114279 Ga0265338_101142793 192
274 3300046529 Ga0495652_0531857 Ga0495652_0531857_157_792 192
275 3300049571 Ga0501034_1134802 Ga0501034_1134802_61_639 192
276 iso_pu_bacteria 2599185288 2599883309 193
277 iso_pu_bacteria 2738541294 2738811450 193
278 iso_pu_bacteria 2738541309 2738898810 193
279 iso_pu_bacteria 2738543020 2739288508 193
280 iso_pu_bacteria 2738543021 2739293820 193
281 iso_pu_bacteria 2818991457 2819662551 193
282 iso_pu_bacteria 2928027323 2928028130 193
283 iso_pu_bacteria 2984555340 2984558459 193
284 iso_pu_bacteria 2993356040 2993358225 193
285 3300013306 Ga0163162_10500306 Ga0163162_105003062 194
286 3300046501 Ga0495607_0017584 Ga0495607_0017584_2803_3390 194
287 3300047323 Ga0495683_0000086 Ga0495683_0000086_29746_30330 194
288 3300049459 Ga0495678_036781 Ga0495678_036781_543_1127 194
289 iso_pu_bacteria 2984564862 2984567134 194
290 3300013102 Ga0157371_10000333 Ga0157371_1000033318 196
291 3300025912 Ga0207707_10016561 Ga0207707_100165612 196
292 3300046453 Ga0495627_000039 Ga0495627_000039_189029_189619 196
293 3300053140 Ga0500573_0065089 Ga0500573_0065089_772_1362 196
294 3300003781 Ga0055536_1000154 Ga0055536_100015427 197
295 3300003791 Ga0055530_10000171 Ga0055530_1000017127 197
296 3300003792 Ga0055540_1000214 Ga0055540_100021424 197
297 3300005290 Ga0065712_10101746 Ga0065712_101017462 197
298 3300005530 Ga0070679_100047148 Ga0070679_1000471483 197
299 3300005547 Ga0070693_100068411 Ga0070693_1000684112 197
300 3300005563 Ga0068855_100002688 Ga0068855_1000026887 197
301 3300005616 Ga0068852_100000019 Ga0068852_10000001985 197
302 3300009093 Ga0105240_10000496 Ga0105240_1000049662 197
303 3300009093 Ga0105240_10001856 Ga0105240_1000185634 197
304 3300009174 Ga0105241_10059096 Ga0105241_100590963 197
305 3300009177 Ga0105248_10034015 Ga0105248_100340153 197
306 3300009551 Ga0105238_10119680 Ga0105238_101196803 197
307 3300010375 Ga0105239_10021514 Ga0105239_100215144 197
308 3300011119 Ga0105246_10000006 Ga0105246_1000000622 197
309 3300013100 Ga0157373_10701603 Ga0157373_107016031 197
310 3300013104 Ga0157370_10000005 Ga0157370_10000005231 197
311 3300013105 Ga0157369_10000085 Ga0157369_1000008584 197
312 3300013296 Ga0157374_10031721 Ga0157374_100317214 197
313 3300013296 Ga0157374_10198663 Ga0157374_101986632 197
314 3300013297 Ga0157378_10425368 Ga0157378_104253682 197
315 3300013306 Ga0163162_10010079 Ga0163162_100100796 197
316 3300013307 Ga0157372_10000217 Ga0157372_1000021753 197
317 3300017792 Ga0163161_10000853 Ga0163161_100008536 197
318 3300025256 Ga0209759_1007978 Ga0209759_10079781 197
319 3300025292 Ga0209676_1000147 Ga0209676_1000147109 197
320 3300025298 Ga0209050_1000062 Ga0209050_1000062247 197
321 3300025303 Ga0209051_1000409 Ga0209051_100040928 197
322 3300025735 Ga0207713_1000884 Ga0207713_10008846 197
323 3300025913 Ga0207695_10000080 Ga0207695_10000080205 197
324 3300025913 Ga0207695_10000167 Ga0207695_10000167103 197
325 3300025920 Ga0207649_10657902 Ga0207649_106579022 197
326 3300025921 Ga0207652_10109533 Ga0207652_101095332 197
327 3300025924 Ga0207694_10012616 Ga0207694_100126164 197
328 3300025927 Ga0207687_10061410 Ga0207687_100614102 197
329 3300025941 Ga0207711_10060353 Ga0207711_100603533 197
330 3300025949 Ga0207667_10007990 Ga0207667_100079908 197
331 3300026142 Ga0207698_10000003 Ga0207698_10000003230 197
332 3300031731 Ga0307405_10000897 Ga0307405_100008976 197
333 3300041507 Ga0451851_0085375 Ga0451851_0085375_10_603 197
334 3300046506 Ga0495583_0002316 Ga0495583_0002316_14233_14826 197
335 3300046507 Ga0495606_0000054 Ga0495606_0000054_184975_185574 197
336 3300046512 Ga0495610_0001902 Ga0495610_0001902_5632_6225 197
337 3300046522 Ga0495643_0000081 Ga0495643_0000081_85109_85708 197
338 3300046522 Ga0495643_0022213 Ga0495643_0022213_1357_1956 197
339 3300046530 Ga0495654_0003891 Ga0495654_0003891_1543_2136 197
340 3300046648 Ga0495611_0128548 Ga0495611_0128548_513_1106 197
341 3300046660 Ga0495625_0025897 Ga0495625_0025897_1150_1743 197
342 3300046660 Ga0495625_0441197 Ga0495625_0441197_23_622 197
343 3300046692 Ga0495671_0001437 Ga0495671_0001437_6555_7154 197
344 3300046694 Ga0495649_0000582 Ga0495649_0000582_23069_23668 197
345 3300046694 Ga0495649_0076345 Ga0495649_0076345_177_776 197
346 3300047446 Ga0495679_000316 Ga0495679_000316_31423_32016 197
347 3300047470 Ga0495681_0015970 Ga0495681_0015970_1567_2166 197
348 3300048927 Ga0496124_0011604 Ga0496124_0011604_2477_3070 197
349 3300048928 Ga0496125_0045981 Ga0496125_0045981_598_1191 197
350 3300048929 Ga0496126_0019570 Ga0496126_0019570_371_964 197
351 2162886007 SwRhRL2b_contig_3237251 SwRhRL2b_0457.00004210 198
352 3300005289 Ga0065704_10072202 Ga0065704_100722026 198
353 3300009092 Ga0105250_10032148 Ga0105250_100321481 198
354 3300009148 Ga0105243_10022374 Ga0105243_100223744 198
355 3300025711 Ga0207696_1000016 Ga0207696_1000016173 198
356 3300025935 Ga0207709_10094141 Ga0207709_100941412 198
357 3300048913 Ga0496110_0750671 Ga0496110_0750671_56_652 198
358 3300048920 Ga0496117_0000522 Ga0496117_0000522_34202_34798 198
359 3300048921 Ga0496118_0000246 Ga0496118_0000246_34046_34642 198
360 3300048927 Ga0496124_0041594 Ga0496124_0041594_1963_2559 198
361 3300048927 Ga0496124_0181427 Ga0496124_0181427_1007_1603 198
362 3300048927 Ga0496124_0446288 Ga0496124_0446288_170_766 198
363 3300048928 Ga0496125_0000068 Ga0496125_0000068_217137_217733 198
364 3300048929 Ga0496126_0009252 Ga0496126_0009252_1559_2155 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04973

NMN_transporter

Nicotinamide mononucleotide transporter

13

191

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qtn-assembly1.cif.gz_B crystal structure of the vitamin b3 transporter pnuc 0.8029 4 181
4qtn-assembly1.cif.gz_B crystal structure of the vitamin b3 transporter pnuc 0.7268 4 181
2gez-assembly1.cif.gz_A crystal structure of potassium-independent plant asparaginase 0.5618 70 129
6w2q-assembly1.cif.gz_A junction 34, dhr53-dhr4 0.5398 4 133
8e12-assembly1.cif.gz_C homotrimeric variant of tctrp9, bgl14 0.5033 52 180
ID Description Score Start End Superfamily
af_A0A0R0F5V1_132_225_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5799 92 193 1.20.1280.290
af_A0A0R0F5V1_132_225_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5633 92 193 1.20.1280.290
af_A0A1X7RBT7_30_120_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5587 89 182 1.20.1280.290
af_O44620_4_91_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5585 88 182 1.20.1280.290
af_Q550E0_234_487_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5571 80 194 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A511BVH4-F1-model_v4 Nicotinamide riboside transporter PnuC 0.986 1 186 GO:0005886
GO:0034257
AF-A0A850PCL3-F1-model_v4 Nicotinamide riboside transporter PnuC 0.9836 1 184 GO:0005886
GO:0034257
AF-A0A4Y6UK11-F1-model_v4 Nicotinamide riboside transporter PnuC 0.9805 1 187 GO:0005886
GO:0034257
AF-A0A6P1QFZ4-F1-model_v4 deleted 0.9801 1 182
AF-A0A1B4BXJ4-F1-model_v4 deleted 0.9776 1 189

Feature Viewer

pLDDT pTM Quality
88.13 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map