F423247
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 364 | 203 | 344 | 196 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100002688|Ga0068855_1000026887 |
| Length | 211 |
| Sequence | MTLGAITHYLITNWVELAGFITTALGIWLTTKRLLICWPVVFAADILYLIVFYRARLLSDSLLQVFFIAFTLYGWXXXXRGVREDGEVRVEPLGLRAFVVAIIAGIAGTFILGEIAKHLQAALPWLDAALASFSLVGSWWQARKHVANWWLWIIVNLAYIGEYIYKDLWITAVLYAGLVVLAILGLRDWRRAARSAQTAACTTLSSGSPAI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 3 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 4 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 5 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 6 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 7 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 8 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 9 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 10 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 11 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 12 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 13 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 14 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 15 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 16 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 17 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 18 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 19 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 92 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 93 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 135 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 136 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 139 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 144 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 145 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 146 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 148 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 149 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 150 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 152 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 153 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 154 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 155 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 156 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 157 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 158 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 183 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 184 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 185 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 186 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 187 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 188 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 189 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 190 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 191 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 192 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 193 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 194 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 195 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 199 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 200 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 201 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 202 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 203 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.51 |
| Metatranscriptomes | 0 |
| Isolates | 5.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.82 |
| Bulb | 0 |
| Endosphere | 3.57 |
| Nodule | 0.27 |
| Rhizoplane | 2.2 |
| Rhizosphere | 84.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3237251 | 2162886007 | Bacteria | 2092 |
| 2 | SwRhRL2b_contig_405574 | 2162886007 | Bacteria | 2720 |
| 3 | JGI24743J22301_10045710 | 3300001991 | Unclassified | 886 |
| 4 | Ga0055536_1000154 | 3300003781 | Bacteria | 59301 |
| 5 | Ga0055530_10000171 | 3300003791 | Bacteria | 59301 |
| 6 | Ga0055540_1000214 | 3300003792 | Bacteria | 54779 |
| 7 | Ga0065704_10072202 | 3300005289 | Bacteria | 8954 |
| 8 | Ga0065704_10075902 | 3300005289 | Bacteria | 5363 |
| 9 | Ga0065712_10101746 | 3300005290 | Bacteria | 2011 |
| 10 | Ga0070658_10046972 | 3300005327 | Bacteria | 3494 |
| 11 | Ga0070658_10074673 | 3300005327 | Bacteria | 2780 |
| 12 | Ga0070658_10199734 | 3300005327 | Bacteria | 1687 |
| 13 | Ga0070683_100002041 | 3300005329 | Bacteria | 15901 |
| 14 | Ga0070683_100002260 | 3300005329 | Bacteria | 15260 |
| 15 | Ga0070683_100019183 | 3300005329 | Bacteria | 6072 |
| 16 | Ga0070683_100133078 | 3300005329 | Bacteria | 2353 |
| 17 | Ga0070683_100599664 | 3300005329 | Bacteria | 1054 |
| 18 | Ga0070670_100024775 | 3300005331 | Bacteria | 5161 |
| 19 | Ga0070670_100079126 | 3300005331 | Bacteria | 2825 |
| 20 | Ga0068869_100001577 | 3300005334 | Bacteria | 13554 |
| 21 | Ga0070666_10092030 | 3300005335 | Bacteria | 2084 |
| 22 | Ga0070680_100528864 | 3300005336 | Bacteria | 1010 |
| 23 | Ga0070682_100001445 | 3300005337 | Bacteria | 13369 |
| 24 | Ga0068868_100000066 | 3300005338 | Bacteria | 59945 |
| 25 | Ga0068868_100084157 | 3300005338 | Bacteria | 2554 |
| 26 | Ga0070661_100010869 | 3300005344 | Bacteria | 6340 |
| 27 | Ga0070661_100026342 | 3300005344 | Bacteria | 4182 |
| 28 | Ga0070661_100191749 | 3300005344 | Bacteria | 1559 |
| 29 | Ga0070669_100426431 | 3300005353 | Bacteria | 1089 |
| 30 | Ga0070671_100007733 | 3300005355 | Bacteria | 8586 |
| 31 | Ga0070667_100009812 | 3300005367 | Bacteria | 7936 |
| 32 | Ga0070714_100046267 | 3300005435 | Bacteria | 3690 |
| 33 | Ga0070713_100142163 | 3300005436 | Bacteria | 2127 |
| 34 | Ga0070713_100936767 | 3300005436 | Unclassified | 834 |
| 35 | Ga0070685_10231720 | 3300005466 | Bacteria | 1215 |
| 36 | Ga0070679_100047148 | 3300005530 | Bacteria | 4296 |
| 37 | Ga0070684_100003753 | 3300005535 | Bacteria | 11466 |
| 38 | Ga0070684_100007640 | 3300005535 | Bacteria | 8429 |
| 39 | Ga0070684_100221275 | 3300005535 | Bacteria | 1727 |
| 40 | Ga0070684_100254603 | 3300005535 | Bacteria | 1605 |
| 41 | Ga0068853_100000222 | 3300005539 | Bacteria | 40206 |
| 42 | Ga0068853_100058702 | 3300005539 | Bacteria | 3322 |
| 43 | Ga0070693_100068411 | 3300005547 | Bacteria | 2084 |
| 44 | Ga0070693_100529643 | 3300005547 | Bacteria | 840 |
| 45 | Ga0070665_100005637 | 3300005548 | Bacteria | 12872 |
| 46 | Ga0070665_100055769 | 3300005548 | Unclassified | 3963 |
| 47 | Ga0068855_100000277 | 3300005563 | Bacteria | 63213 |
| 48 | Ga0068855_100002688 | 3300005563 | Bacteria | 21925 |
| 49 | Ga0068855_100022916 | 3300005563 | Bacteria | 7484 |
| 50 | Ga0068855_100413161 | 3300005563 | Bacteria | 1477 |
| 51 | Ga0070664_100555456 | 3300005564 | Bacteria | 1062 |
| 52 | Ga0068857_100003191 | 3300005577 | Bacteria | 13595 |
| 53 | Ga0068857_100012548 | 3300005577 | Bacteria | 7379 |
| 54 | Ga0068854_100231423 | 3300005578 | Unclassified | 1467 |
| 55 | Ga0068856_100000512 | 3300005614 | Bacteria | 42666 |
| 56 | Ga0068856_100003529 | 3300005614 | Bacteria | 15773 |
| 57 | Ga0068856_100009265 | 3300005614 | Bacteria | 9564 |
| 58 | Ga0068856_100057243 | 3300005614 | Bacteria | 3848 |
| 59 | Ga0068856_100173748 | 3300005614 | Bacteria | 2167 |
| 60 | Ga0068856_100539666 | 3300005614 | Bacteria | 1187 |
| 61 | Ga0068852_100000019 | 3300005616 | Bacteria | 129021 |
| 62 | Ga0068852_100000097 | 3300005616 | Bacteria | 59430 |
| 63 | Ga0068852_100114751 | 3300005616 | Bacteria | 2455 |
| 64 | Ga0068852_100122301 | 3300005616 | Unclassified | 2385 |
| 65 | Ga0068852_100429192 | 3300005616 | Unclassified | 1305 |
| 66 | Ga0068852_100471125 | 3300005616 | Bacteria | 1246 |
| 67 | Ga0068852_100664226 | 3300005616 | Unclassified | 1050 |
| 68 | Ga0068859_100023025 | 3300005617 | Bacteria | 6247 |
| 69 | Ga0068864_100000625 | 3300005618 | Bacteria | 29830 |
| 70 | Ga0068851_10007082 | 3300005834 | Bacteria | 5137 |
| 71 | Ga0068851_10048948 | 3300005834 | Bacteria | 2143 |
| 72 | Ga0068851_10060565 | 3300005834 | Bacteria | 1938 |
| 73 | Ga0068851_10075055 | 3300005834 | Unclassified | 1756 |
| 74 | Ga0068863_100001753 | 3300005841 | Bacteria | 21524 |
| 75 | Ga0068858_100012165 | 3300005842 | Bacteria | 8114 |
| 76 | Ga0068860_100000689 | 3300005843 | Bacteria | 38878 |
| 77 | Ga0068862_100023070 | 3300005844 | Bacteria | 5212 |
| 78 | Ga0075364_10442332 | 3300006051 | Bacteria | 888 |
| 79 | Ga0097621_100000349 | 3300006237 | Bacteria | 31779 |
| 80 | Ga0068871_100002325 | 3300006358 | Bacteria | 12946 |
| 81 | Ga0097620_100023025 | 3300006931 | Bacteria | 6247 |
| 82 | Ga0079104_1029024 | 3300006946 | Bacteria | 1398 |
| 83 | Ga0105251_10000321 | 3300009011 | Bacteria | 48031 |
| 84 | Ga0105251_10002159 | 3300009011 | Bacteria | 15778 |
| 85 | Ga0105250_10032148 | 3300009092 | Bacteria | 2108 |
| 86 | Ga0105240_10000372 | 3300009093 | Bacteria | 84325 |
| 87 | Ga0105240_10000496 | 3300009093 | Bacteria | 72575 |
| 88 | Ga0105240_10001856 | 3300009093 | Bacteria | 35314 |
| 89 | Ga0105240_10064615 | 3300009093 | Bacteria | 4546 |
| 90 | Ga0105240_10068360 | 3300009093 | Unclassified | 4400 |
| 91 | Ga0105240_10085557 | 3300009093 | Bacteria | 3863 |
| 92 | Ga0105240_10127298 | 3300009093 | Bacteria | 3059 |
| 93 | Ga0105240_10311427 | 3300009093 | Bacteria | 1798 |
| 94 | Ga0105245_10000486 | 3300009098 | Bacteria | 36378 |
| 95 | Ga0105247_10002346 | 3300009101 | Bacteria | 12922 |
| 96 | Ga0105243_10022374 | 3300009148 | Bacteria | 4804 |
| 97 | Ga0105241_10000026 | 3300009174 | Bacteria | 132695 |
| 98 | Ga0105241_10000121 | 3300009174 | Bacteria | 57041 |
| 99 | Ga0105241_10009216 | 3300009174 | Bacteria | 7261 |
| 100 | Ga0105241_10059096 | 3300009174 | Unclassified | 2947 |
| 101 | Ga0105241_10186853 | 3300009174 | Bacteria | 1723 |
| 102 | Ga0105248_10034015 | 3300009177 | Bacteria | 5697 |
| 103 | Ga0105248_10081067 | 3300009177 | Unclassified | 3648 |
| 104 | Ga0105237_10000590 | 3300009545 | Bacteria | 50564 |
| 105 | Ga0105237_10041670 | 3300009545 | Unclassified | 4630 |
| 106 | Ga0105237_10477611 | 3300009545 | Bacteria | 1253 |
| 107 | Ga0105237_10482805 | 3300009545 | Bacteria | 1245 |
| 108 | Ga0105237_10899893 | 3300009545 | Unclassified | 892 |
| 109 | Ga0105238_10000197 | 3300009551 | Bacteria | 66637 |
| 110 | Ga0105238_10000509 | 3300009551 | Bacteria | 40868 |
| 111 | Ga0105238_10119680 | 3300009551 | Unclassified | 2613 |
| 112 | Ga0105238_10276290 | 3300009551 | Bacteria | 1661 |
| 113 | Ga0105249_10120013 | 3300009553 | Bacteria | 2498 |
| 114 | Ga0105239_10001891 | 3300010375 | Bacteria | 27379 |
| 115 | Ga0105239_10021514 | 3300010375 | Bacteria | 7110 |
| 116 | Ga0105239_10052641 | 3300010375 | Unclassified | 4464 |
| 117 | Ga0105246_10000006 | 3300011119 | Bacteria | 83887 |
| 118 | Ga0105246_10001192 | 3300011119 | Bacteria | 15150 |
| 119 | Ga0157373_10701603 | 3300013100 | Bacteria | 742 |
| 120 | Ga0157371_10000333 | 3300013102 | Bacteria | 60809 |
| 121 | Ga0157371_10065246 | 3300013102 | Bacteria | 2579 |
| 122 | Ga0157370_10000005 | 3300013104 | Bacteria | 288514 |
| 123 | Ga0157369_10000085 | 3300013105 | Bacteria | 129025 |
| 124 | Ga0157369_10000430 | 3300013105 | Bacteria | 55736 |
| 125 | Ga0157369_10016814 | 3300013105 | Bacteria | 8221 |
| 126 | Ga0157369_10024598 | 3300013105 | Bacteria | 6696 |
| 127 | Ga0157369_10026044 | 3300013105 | Bacteria | 6489 |
| 128 | Ga0157369_10140829 | 3300013105 | Unclassified | 2552 |
| 129 | Ga0157369_10463439 | 3300013105 | Bacteria | 1312 |
| 130 | Ga0157374_10031721 | 3300013296 | Bacteria | 4805 |
| 131 | Ga0157374_10182413 | 3300013296 | Bacteria | 2051 |
| 132 | Ga0157374_10198663 | 3300013296 | Bacteria | 1963 |
| 133 | Ga0157378_10004251 | 3300013297 | Bacteria | 12630 |
| 134 | Ga0157378_10018090 | 3300013297 | Bacteria | 6188 |
| 135 | Ga0157378_10425368 | 3300013297 | Unclassified | 1313 |
| 136 | Ga0163162_10010079 | 3300013306 | Bacteria | 9185 |
| 137 | Ga0163162_10080239 | 3300013306 | Bacteria | 3330 |
| 138 | Ga0163162_10500306 | 3300013306 | Bacteria | 1346 |
| 139 | Ga0157372_10000217 | 3300013307 | Bacteria | 63667 |
| 140 | Ga0157372_10009734 | 3300013307 | Bacteria | 10222 |
| 141 | Ga0157372_10017083 | 3300013307 | Bacteria | 7789 |
| 142 | Ga0157372_10020181 | 3300013307 | Bacteria | 7185 |
| 143 | Ga0157372_10082332 | 3300013307 | Bacteria | 3643 |
| 144 | Ga0157372_10105164 | 3300013307 | Bacteria | 3229 |
| 145 | Ga0157372_10163132 | 3300013307 | Bacteria | 2576 |
| 146 | Ga0157372_10210743 | 3300013307 | Bacteria | 2252 |
| 147 | Ga0157375_11225608 | 3300013308 | Bacteria | 881 |
| 148 | Ga0163163_10001161 | 3300014325 | Bacteria | 22403 |
| 149 | Ga0157377_10060827 | 3300014745 | Bacteria | 2157 |
| 150 | Ga0157377_10210870 | 3300014745 | Bacteria | 1238 |
| 151 | Ga0157379_10002312 | 3300014968 | Bacteria | 15882 |
| 152 | Ga0157379_10224971 | 3300014968 | Unclassified | 1700 |
| 153 | Ga0157376_10000296 | 3300014969 | Bacteria | 33604 |
| 154 | Ga0157376_10012770 | 3300014969 | Bacteria | 6246 |
| 155 | Ga0182006_1008227 | 3300015261 | Bacteria | 4732 |
| 156 | Ga0163161_10000853 | 3300017792 | Bacteria | 23771 |
| 157 | Ga0163161_10063024 | 3300017792 | Bacteria | 2701 |
| 158 | Ga0213874_10100155 | 3300021377 | Bacteria | 962 |
| 159 | Ga0209759_1007978 | 3300025256 | Bacteria | 3345 |
| 160 | Ga0209129_1000392 | 3300025258 | Bacteria | 35184 |
| 161 | Ga0209676_1000147 | 3300025292 | Bacteria | 172386 |
| 162 | Ga0209758_1007929 | 3300025297 | Bacteria | 7044 |
| 163 | Ga0209050_1000062 | 3300025298 | Bacteria | 316538 |
| 164 | Ga0209051_1000409 | 3300025303 | Bacteria | 59325 |
| 165 | Ga0207656_10004048 | 3300025321 | Bacteria | 5084 |
| 166 | Ga0207696_1000016 | 3300025711 | Bacteria | 502467 |
| 167 | Ga0207713_1000222 | 3300025735 | Bacteria | 76645 |
| 168 | Ga0207713_1000884 | 3300025735 | Bacteria | 27297 |
| 169 | Ga0207710_10000487 | 3300025900 | Bacteria | 25053 |
| 170 | Ga0207680_10219124 | 3300025903 | Bacteria | 1304 |
| 171 | Ga0207705_10026733 | 3300025909 | Bacteria | 4113 |
| 172 | Ga0207705_10036415 | 3300025909 | Bacteria | 3522 |
| 173 | Ga0207654_10000054 | 3300025911 | Bacteria | 82347 |
| 174 | Ga0207654_10000281 | 3300025911 | Bacteria | 30979 |
| 175 | Ga0207654_10003128 | 3300025911 | Bacteria | 8380 |
| 176 | Ga0207654_10109085 | 3300025911 | Bacteria | 1718 |
| 177 | Ga0207707_10016561 | 3300025912 | Bacteria | 6428 |
| 178 | Ga0207695_10000080 | 3300025913 | Bacteria | 287868 |
| 179 | Ga0207695_10000113 | 3300025913 | Bacteria | 247240 |
| 180 | Ga0207695_10000167 | 3300025913 | Bacteria | 194371 |
| 181 | Ga0207695_10005013 | 3300025913 | Bacteria | 17778 |
| 182 | Ga0207695_10037312 | 3300025913 | Bacteria | 5244 |
| 183 | Ga0207695_10060369 | 3300025913 | Bacteria | 3925 |
| 184 | Ga0207671_10000065 | 3300025914 | Bacteria | 166743 |
| 185 | Ga0207671_10000123 | 3300025914 | Bacteria | 119385 |
| 186 | Ga0207671_10000139 | 3300025914 | Bacteria | 111786 |
| 187 | Ga0207671_10227416 | 3300025914 | Bacteria | 1463 |
| 188 | Ga0207671_10414112 | 3300025914 | Bacteria | 1072 |
| 189 | Ga0207649_10063255 | 3300025920 | Unclassified | 2335 |
| 190 | Ga0207649_10657902 | 3300025920 | Bacteria | 810 |
| 191 | Ga0207652_10109533 | 3300025921 | Bacteria | 2449 |
| 192 | Ga0207681_10353290 | 3300025923 | Bacteria | 1177 |
| 193 | Ga0207694_10000248 | 3300025924 | Bacteria | 51461 |
| 194 | Ga0207694_10000855 | 3300025924 | Bacteria | 27098 |
| 195 | Ga0207694_10012616 | 3300025924 | Bacteria | 6368 |
| 196 | Ga0207694_10053280 | 3300025924 | Bacteria | 3137 |
| 197 | Ga0207694_10166466 | 3300025924 | Bacteria | 1783 |
| 198 | Ga0207650_10056727 | 3300025925 | Bacteria | 2911 |
| 199 | Ga0207650_10063539 | 3300025925 | Bacteria | 2760 |
| 200 | Ga0207687_10000978 | 3300025927 | Bacteria | 19404 |
| 201 | Ga0207687_10061410 | 3300025927 | Unclassified | 2654 |
| 202 | Ga0207687_10112060 | 3300025927 | Bacteria | 2027 |
| 203 | Ga0207700_10154360 | 3300025928 | Unclassified | 1901 |
| 204 | Ga0207664_10083411 | 3300025929 | Bacteria | 2605 |
| 205 | Ga0207644_10004420 | 3300025931 | Bacteria | 9123 |
| 206 | Ga0207709_10094141 | 3300025935 | Bacteria | 1966 |
| 207 | Ga0207711_10060353 | 3300025941 | Unclassified | 3267 |
| 208 | Ga0207711_10273081 | 3300025941 | Bacteria | 1556 |
| 209 | Ga0207689_10000724 | 3300025942 | Bacteria | 31641 |
| 210 | Ga0207661_10001283 | 3300025944 | Bacteria | 16799 |
| 211 | Ga0207661_10018246 | 3300025944 | Bacteria | 5211 |
| 212 | Ga0207661_10192435 | 3300025944 | Bacteria | 1789 |
| 213 | Ga0207661_10966606 | 3300025944 | Bacteria | 784 |
| 214 | Ga0207679_10024591 | 3300025945 | Unclassified | 4131 |
| 215 | Ga0207667_10006194 | 3300025949 | Bacteria | 14522 |
| 216 | Ga0207667_10007990 | 3300025949 | Bacteria | 12622 |
| 217 | Ga0207667_10048192 | 3300025949 | Bacteria | 4506 |
| 218 | Ga0207667_10153024 | 3300025949 | Unclassified | 2374 |
| 219 | Ga0207667_10407028 | 3300025949 | Bacteria | 1385 |
| 220 | Ga0207712_10110215 | 3300025961 | Bacteria | 2063 |
| 221 | Ga0207640_10020377 | 3300025981 | Bacteria | 3937 |
| 222 | Ga0207658_10003428 | 3300025986 | Bacteria | 11222 |
| 223 | Ga0207677_10000143 | 3300026023 | Bacteria | 58337 |
| 224 | Ga0207677_10085080 | 3300026023 | Bacteria | 2281 |
| 225 | Ga0207703_10004820 | 3300026035 | Bacteria | 10980 |
| 226 | Ga0207639_10000088 | 3300026041 | Bacteria | 78742 |
| 227 | Ga0207639_10061122 | 3300026041 | Bacteria | 2908 |
| 228 | Ga0207639_10319936 | 3300026041 | Bacteria | 1377 |
| 229 | Ga0207702_10001334 | 3300026078 | Bacteria | 24682 |
| 230 | Ga0207702_10002672 | 3300026078 | Bacteria | 16738 |
| 231 | Ga0207702_10015520 | 3300026078 | Bacteria | 6306 |
| 232 | Ga0207702_10109911 | 3300026078 | Bacteria | 2449 |
| 233 | Ga0207702_10197544 | 3300026078 | Unclassified | 1862 |
| 234 | Ga0207641_10011936 | 3300026088 | Bacteria | 7127 |
| 235 | Ga0207676_10002595 | 3300026095 | Bacteria | 12891 |
| 236 | Ga0207674_10000669 | 3300026116 | Bacteria | 44573 |
| 237 | Ga0207674_10003068 | 3300026116 | Bacteria | 20665 |
| 238 | Ga0207674_10307226 | 3300026116 | Unclassified | 1535 |
| 239 | Ga0207698_10000003 | 3300026142 | Bacteria | 321303 |
| 240 | Ga0207698_10000708 | 3300026142 | Bacteria | 19330 |
| 241 | Ga0207698_10525140 | 3300026142 | Bacteria | 1156 |
| 242 | Ga0265356_1010246 | 3300028017 | Unclassified | 1046 |
| 243 | Ga0265357_1008033 | 3300028023 | Unclassified | 1030 |
| 244 | Ga0268266_10068745 | 3300028379 | Bacteria | 3068 |
| 245 | Ga0268266_10098647 | 3300028379 | Bacteria | 2571 |
| 246 | Ga0268264_10000598 | 3300028381 | Bacteria | 43640 |
| 247 | Ga0265323_10007390 | 3300028653 | Bacteria | 4569 |
| 248 | Ga0265338_10004495 | 3300028800 | Bacteria | 18805 |
| 249 | Ga0265338_10114279 | 3300028800 | Bacteria | 2167 |
| 250 | Ga0265338_10307429 | 3300028800 | Unclassified | 1151 |
| 251 | Ga0265324_10075921 | 3300029957 | Bacteria | 1144 |
| 252 | Ga0265330_10002162 | 3300031235 | Bacteria | 10830 |
| 253 | Ga0265330_10014322 | 3300031235 | Bacteria | 3681 |
| 254 | Ga0265339_10000194 | 3300031249 | Bacteria | 50375 |
| 255 | Ga0265339_10101482 | 3300031249 | Bacteria | 1497 |
| 256 | Ga0265316_10000352 | 3300031344 | Bacteria | 51670 |
| 257 | Ga0265316_10056454 | 3300031344 | Bacteria | 3066 |
| 258 | Ga0265316_10058084 | 3300031344 | Bacteria | 3016 |
| 259 | Ga0265316_10323321 | 3300031344 | Bacteria | 1120 |
| 260 | Ga0307408_100000004 | 3300031548 | Bacteria | 572889 |
| 261 | Ga0316575_10012827 | 3300031665 | Bacteria | 3124 |
| 262 | Ga0265314_10009910 | 3300031711 | Bacteria | 7992 |
| 263 | Ga0265314_10110795 | 3300031711 | Unclassified | 1745 |
| 264 | Ga0265342_10001536 | 3300031712 | Bacteria | 21355 |
| 265 | Ga0265342_10002441 | 3300031712 | Bacteria | 16049 |
| 266 | Ga0265342_10082053 | 3300031712 | Bacteria | 1861 |
| 267 | Ga0307405_10000897 | 3300031731 | Bacteria | 11819 |
| 268 | Ga0373927_0272039 | 3300035695 | Bacteria | 1114 |
| 269 | Ga0373937_0377362 | 3300036401 | Unclassified | 1345 |
| 270 | Ga0373937_0438256 | 3300036401 | Bacteria | 1240 |
| 271 | Ga0395899_0015555 | 3300037312 | Bacteria | 5801 |
| 272 | Ga0395901_0010291 | 3300038443 | Bacteria | 9472 |
| 273 | Ga0395901_0012867 | 3300038443 | Bacteria | 8485 |
| 274 | Ga0436363_0913429 | 3300039450 | Bacteria | 974 |
| 275 | Ga0451851_0085375 | 3300041507 | Bacteria | 755 |
| 276 | Ga0439464_0035256 | 3300042439 | Bacteria | 1412 |
| 277 | Ga0466963_0000494 | 3300044694 | Bacteria | 18341 |
| 278 | Ga0466967_0029373 | 3300045976 | Unclassified | 4600 |
| 279 | Ga0495627_000039 | 3300046453 | Bacteria | 197253 |
| 280 | Ga0495627_000078 | 3300046453 | Bacteria | 119920 |
| 281 | Ga0495627_037945 | 3300046453 | Bacteria | 1492 |
| 282 | Ga0495629_0017355 | 3300046459 | Bacteria | 5158 |
| 283 | Ga0495629_0024210 | 3300046459 | Bacteria | 4323 |
| 284 | Ga0495607_0017584 | 3300046501 | Bacteria | 4584 |
| 285 | Ga0495583_0002316 | 3300046506 | Bacteria | 16594 |
| 286 | Ga0495606_0000054 | 3300046507 | Bacteria | 200380 |
| 287 | Ga0495610_0001902 | 3300046512 | Bacteria | 18014 |
| 288 | Ga0495610_0078259 | 3300046512 | Bacteria | 1525 |
| 289 | Ga0495620_0004313 | 3300046515 | Bacteria | 8039 |
| 290 | Ga0495632_0029255 | 3300046519 | Bacteria | 2870 |
| 291 | Ga0495643_0000081 | 3300046522 | Bacteria | 160004 |
| 292 | Ga0495643_0022213 | 3300046522 | Bacteria | 3623 |
| 293 | Ga0495648_0001153 | 3300046524 | Bacteria | 26712 |
| 294 | Ga0495652_0048616 | 3300046529 | Bacteria | 3633 |
| 295 | Ga0495652_0531857 | 3300046529 | Bacteria | 811 |
| 296 | Ga0495654_0003891 | 3300046530 | Bacteria | 9027 |
| 297 | Ga0495654_0092786 | 3300046530 | Bacteria | 1399 |
| 298 | Ga0495587_0108134 | 3300046536 | Bacteria | 1599 |
| 299 | Ga0495633_0008408 | 3300046558 | Bacteria | 5818 |
| 300 | Ga0495611_0128548 | 3300046648 | Bacteria | 1182 |
| 301 | Ga0495625_0025897 | 3300046660 | Bacteria | 4439 |
| 302 | Ga0495625_0157388 | 3300046660 | Bacteria | 1524 |
| 303 | Ga0495625_0441197 | 3300046660 | Bacteria | 806 |
| 304 | Ga0495661_0000505 | 3300046665 | Bacteria | 40769 |
| 305 | Ga0495613_0066602 | 3300046689 | Unclassified | 2630 |
| 306 | Ga0495613_0081507 | 3300046689 | Bacteria | 2351 |
| 307 | Ga0495671_0001437 | 3300046692 | Bacteria | 15995 |
| 308 | Ga0495649_0000582 | 3300046694 | Bacteria | 30652 |
| 309 | Ga0495649_0076345 | 3300046694 | Bacteria | 1793 |
| 310 | Ga0495604_0118324 | 3300047317 | Bacteria | 1921 |
| 311 | Ga0495683_0000086 | 3300047323 | Bacteria | 92967 |
| 312 | Ga0495679_000316 | 3300047446 | Bacteria | 38517 |
| 313 | Ga0495679_000618 | 3300047446 | Bacteria | 23992 |
| 314 | Ga0495681_0015970 | 3300047470 | Bacteria | 4234 |
| 315 | Ga0496105_0232622 | 3300048908 | Bacteria | 1497 |
| 316 | Ga0496110_0750671 | 3300048913 | Bacteria | 879 |
| 317 | Ga0496114_0211501 | 3300048917 | Bacteria | 1701 |
| 318 | Ga0496115_0044591 | 3300048918 | Unclassified | 3538 |
| 319 | Ga0496117_0000522 | 3300048920 | Bacteria | 63473 |
| 320 | Ga0496117_0001048 | 3300048920 | Bacteria | 42168 |
| 321 | Ga0496117_0125341 | 3300048920 | Bacteria | 1569 |
| 322 | Ga0496118_0000246 | 3300048921 | Bacteria | 96199 |
| 323 | Ga0496118_0091639 | 3300048921 | Bacteria | 2089 |
| 324 | Ga0496118_0174125 | 3300048921 | Bacteria | 1310 |
| 325 | Ga0496119_0000464 | 3300048922 | Bacteria | 55314 |
| 326 | Ga0496120_0000587 | 3300048923 | Bacteria | 55315 |
| 327 | Ga0496122_0000888 | 3300048925 | Bacteria | 55669 |
| 328 | Ga0496123_0000687 | 3300048926 | Bacteria | 55771 |
| 329 | Ga0496124_0000480 | 3300048927 | Bacteria | 68741 |
| 330 | Ga0496124_0011604 | 3300048927 | Bacteria | 8793 |
| 331 | Ga0496124_0041594 | 3300048927 | Bacteria | 3964 |
| 332 | Ga0496124_0181427 | 3300048927 | Bacteria | 1619 |
| 333 | Ga0496124_0446288 | 3300048927 | Bacteria | 883 |
| 334 | Ga0496125_0000068 | 3300048928 | Bacteria | 247765 |
| 335 | Ga0496125_0045981 | 3300048928 | Bacteria | 3667 |
| 336 | Ga0496126_0009252 | 3300048929 | Bacteria | 10501 |
| 337 | Ga0496126_0019570 | 3300048929 | Bacteria | 6663 |
| 338 | Ga0495678_036781 | 3300049459 | Bacteria | 1995 |
| 339 | Ga0501034_1134802 | 3300049571 | Bacteria | 662 |
| 340 | Ga0495601_0148368 | 3300053077 | Unclassified | 1531 |
| 341 | Ga0500644_0093138 | 3300053088 | Bacteria | 1132 |
| 342 | Ga0500573_0065089 | 3300053140 | Bacteria | 2084 |
| 343 | Ga0500634_0000085 | 3300053161 | Bacteria | 36085 |
| 344 | Ga0500634_0000863 | 3300053161 | Bacteria | 10788 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005436 | Ga0070713_100936767 | Ga0070713_1009367672 | 157 |
| 2 | 3300005539 | Ga0068853_100058702 | Ga0068853_1000587022 | 162 |
| 3 | 3300025914 | Ga0207671_10227416 | Ga0207671_102274162 | 162 |
| 4 | 3300026078 | Ga0207702_10197544 | Ga0207702_101975442 | 162 |
| 5 | 3300028023 | Ga0265357_1008033 | Ga0265357_10080332 | 162 |
| 6 | 3300005329 | Ga0070683_100599664 | Ga0070683_1005996642 | 163 |
| 7 | 3300028800 | Ga0265338_10004495 | Ga0265338_1000449515 | 167 |
| 8 | 3300029957 | Ga0265324_10075921 | Ga0265324_100759212 | 167 |
| 9 | 3300031711 | Ga0265314_10009910 | Ga0265314_100099107 | 167 |
| 10 | 3300046660 | Ga0495625_0157388 | Ga0495625_0157388_33_542 | 167 |
| 11 | 3300015261 | Ga0182006_1008227 | Ga0182006_10082274 | 172 |
| 12 | 3300031249 | Ga0265339_10101482 | Ga0265339_101014822 | 172 |
| 13 | 3300013105 | Ga0157369_10026044 | Ga0157369_100260442 | 173 |
| 14 | 3300037312 | Ga0395899_0015555 | Ga0395899_0015555_4394_4969 | 173 |
| 15 | 3300038443 | Ga0395901_0010291 | Ga0395901_0010291_5115_5690 | 173 |
| 16 | 3300038443 | Ga0395901_0012867 | Ga0395901_0012867_2649_3224 | 173 |
| 17 | 3300005336 | Ga0070680_100528864 | Ga0070680_1005288641 | 174 |
| 18 | 3300005337 | Ga0070682_100001445 | Ga0070682_1000014457 | 174 |
| 19 | 3300013102 | Ga0157371_10065246 | Ga0157371_100652462 | 174 |
| 20 | 3300031711 | Ga0265314_10110795 | Ga0265314_101107952 | 174 |
| 21 | 3300005329 | Ga0070683_100002260 | Ga0070683_10000226013 | 175 |
| 22 | 3300005535 | Ga0070684_100003753 | Ga0070684_1000037532 | 175 |
| 23 | 3300005616 | Ga0068852_100471125 | Ga0068852_1004711252 | 175 |
| 24 | 3300005834 | Ga0068851_10007082 | Ga0068851_100070823 | 175 |
| 25 | 3300025927 | Ga0207687_10112060 | Ga0207687_101120602 | 175 |
| 26 | 3300025944 | Ga0207661_10018246 | Ga0207661_100182462 | 175 |
| 27 | 3300026041 | Ga0207639_10061122 | Ga0207639_100611222 | 175 |
| 28 | 3300026041 | Ga0207639_10319936 | Ga0207639_103199362 | 175 |
| 29 | 3300035695 | Ga0373927_0272039 | Ga0373927_0272039_470_1102 | 175 |
| 30 | 3300036401 | Ga0373937_0438256 | Ga0373937_0438256_325_957 | 175 |
| 31 | 3300046459 | Ga0495629_0024210 | Ga0495629_0024210_388_1020 | 175 |
| 32 | 3300046529 | Ga0495652_0048616 | Ga0495652_0048616_1741_2373 | 175 |
| 33 | 3300046536 | Ga0495587_0108134 | Ga0495587_0108134_274_906 | 175 |
| 34 | 3300046689 | Ga0495613_0081507 | Ga0495613_0081507_724_1356 | 175 |
| 35 | 3300047317 | Ga0495604_0118324 | Ga0495604_0118324_1114_1746 | 175 |
| 36 | 3300013297 | Ga0157378_10004251 | Ga0157378_100042517 | 176 |
| 37 | 3300013307 | Ga0157372_10163132 | Ga0157372_101631322 | 176 |
| 38 | 3300028017 | Ga0265356_1010246 | Ga0265356_10102462 | 176 |
| 39 | 3300031344 | Ga0265316_10058084 | Ga0265316_100580842 | 176 |
| 40 | 3300031712 | Ga0265342_10082053 | Ga0265342_100820532 | 176 |
| 41 | 3300005466 | Ga0070685_10231720 | Ga0070685_102317201 | 177 |
| 42 | 3300014745 | Ga0157377_10060827 | Ga0157377_100608272 | 177 |
| 43 | 3300009011 | Ga0105251_10002159 | Ga0105251_100021596 | 178 |
| 44 | 3300005435 | Ga0070714_100046267 | Ga0070714_1000462674 | 181 |
| 45 | 3300025929 | Ga0207664_10083411 | Ga0207664_100834112 | 181 |
| 46 | 3300006946 | Ga0079104_1029024 | Ga0079104_10290242 | 182 |
| 47 | 3300009174 | Ga0105241_10186853 | Ga0105241_101868532 | 182 |
| 48 | 2162886007 | SwRhRL2b_contig_405574 | SwRhRL2b_0564.00005700 | 183 |
| 49 | 3300005289 | Ga0065704_10075902 | Ga0065704_100759025 | 183 |
| 50 | 3300005331 | Ga0070670_100079126 | Ga0070670_1000791261 | 183 |
| 51 | 3300005338 | Ga0068868_100084157 | Ga0068868_1000841572 | 183 |
| 52 | 3300005353 | Ga0070669_100426431 | Ga0070669_1004264312 | 183 |
| 53 | 3300009011 | Ga0105251_10000321 | Ga0105251_1000032115 | 183 |
| 54 | 3300009545 | Ga0105237_10477611 | Ga0105237_104776112 | 183 |
| 55 | 3300025735 | Ga0207713_1000222 | Ga0207713_100022236 | 183 |
| 56 | 3300025923 | Ga0207681_10353290 | Ga0207681_103532902 | 183 |
| 57 | 3300025925 | Ga0207650_10056727 | Ga0207650_100567271 | 183 |
| 58 | 3300026023 | Ga0207677_10085080 | Ga0207677_100850802 | 183 |
| 59 | 3300028800 | Ga0265338_10307429 | Ga0265338_103074292 | 183 |
| 60 | 3300044694 | Ga0466963_0000494 | Ga0466963_0000494_5549_6184 | 183 |
| 61 | 3300045976 | Ga0466967_0029373 | Ga0466967_0029373_3425_4060 | 183 |
| 62 | 3300048918 | Ga0496115_0044591 | Ga0496115_0044591_2353_2988 | 183 |
| 63 | 3300048920 | Ga0496117_0001048 | Ga0496117_0001048_41155_41736 | 183 |
| 64 | 3300048921 | Ga0496118_0091639 | Ga0496118_0091639_1264_1845 | 183 |
| 65 | 3300048922 | Ga0496119_0000464 | Ga0496119_0000464_41155_41736 | 183 |
| 66 | 3300048923 | Ga0496120_0000587 | Ga0496120_0000587_13580_14161 | 183 |
| 67 | 3300048925 | Ga0496122_0000888 | Ga0496122_0000888_41378_41959 | 183 |
| 68 | 3300048926 | Ga0496123_0000687 | Ga0496123_0000687_13712_14293 | 183 |
| 69 | 3300048927 | Ga0496124_0000480 | Ga0496124_0000480_30507_31088 | 183 |
| 70 | 3300048920 | Ga0496117_0125341 | Ga0496117_0125341_474_1049 | 184 |
| 71 | 3300048921 | Ga0496118_0174125 | Ga0496118_0174125_506_1081 | 184 |
| 72 | iso_pu_bacteria | 8034962539 | 8034964775 | 184 |
| 73 | 3300001991 | JGI24743J22301_10045710 | JGI24743J22301_100457101 | 185 |
| 74 | 3300005327 | Ga0070658_10046972 | Ga0070658_100469723 | 185 |
| 75 | 3300005329 | Ga0070683_100002041 | Ga0070683_1000020413 | 185 |
| 76 | 3300005329 | Ga0070683_100133078 | Ga0070683_1001330782 | 185 |
| 77 | 3300005331 | Ga0070670_100024775 | Ga0070670_1000247752 | 185 |
| 78 | 3300005334 | Ga0068869_100001577 | Ga0068869_1000015777 | 185 |
| 79 | 3300005335 | Ga0070666_10092030 | Ga0070666_100920302 | 185 |
| 80 | 3300005338 | Ga0068868_100000066 | Ga0068868_10000006621 | 185 |
| 81 | 3300005344 | Ga0070661_100010869 | Ga0070661_1000108693 | 185 |
| 82 | 3300005355 | Ga0070671_100007733 | Ga0070671_1000077336 | 185 |
| 83 | 3300005367 | Ga0070667_100009812 | Ga0070667_1000098123 | 185 |
| 84 | 3300005535 | Ga0070684_100007640 | Ga0070684_1000076403 | 185 |
| 85 | 3300005535 | Ga0070684_100221275 | Ga0070684_1002212752 | 185 |
| 86 | 3300005539 | Ga0068853_100000222 | Ga0068853_10000022232 | 185 |
| 87 | 3300005547 | Ga0070693_100529643 | Ga0070693_1005296431 | 185 |
| 88 | 3300005563 | Ga0068855_100000277 | Ga0068855_10000027720 | 185 |
| 89 | 3300005563 | Ga0068855_100413161 | Ga0068855_1004131612 | 185 |
| 90 | 3300005564 | Ga0070664_100555456 | Ga0070664_1005554562 | 185 |
| 91 | 3300005577 | Ga0068857_100003191 | Ga0068857_10000319113 | 185 |
| 92 | 3300005577 | Ga0068857_100012548 | Ga0068857_1000125487 | 185 |
| 93 | 3300005614 | Ga0068856_100000512 | Ga0068856_1000005124 | 185 |
| 94 | 3300005614 | Ga0068856_100003529 | Ga0068856_10000352913 | 185 |
| 95 | 3300005614 | Ga0068856_100009265 | Ga0068856_1000092652 | 185 |
| 96 | 3300005616 | Ga0068852_100000097 | Ga0068852_10000009736 | 185 |
| 97 | 3300005616 | Ga0068852_100114751 | Ga0068852_1001147512 | 185 |
| 98 | 3300005617 | Ga0068859_100023025 | Ga0068859_1000230255 | 185 |
| 99 | 3300005618 | Ga0068864_100000625 | Ga0068864_1000006258 | 185 |
| 100 | 3300005834 | Ga0068851_10048948 | Ga0068851_100489482 | 185 |
| 101 | 3300005834 | Ga0068851_10060565 | Ga0068851_100605652 | 185 |
| 102 | 3300005834 | Ga0068851_10075055 | Ga0068851_100750552 | 185 |
| 103 | 3300005841 | Ga0068863_100001753 | Ga0068863_1000017533 | 185 |
| 104 | 3300005842 | Ga0068858_100012165 | Ga0068858_1000121657 | 185 |
| 105 | 3300005843 | Ga0068860_100000689 | Ga0068860_1000006893 | 185 |
| 106 | 3300005844 | Ga0068862_100023070 | Ga0068862_1000230704 | 185 |
| 107 | 3300006237 | Ga0097621_100000349 | Ga0097621_10000034911 | 185 |
| 108 | 3300006358 | Ga0068871_100002325 | Ga0068871_1000023253 | 185 |
| 109 | 3300006931 | Ga0097620_100023025 | Ga0097620_1000230255 | 185 |
| 110 | 3300009093 | Ga0105240_10000372 | Ga0105240_1000037255 | 185 |
| 111 | 3300009093 | Ga0105240_10064615 | Ga0105240_100646152 | 185 |
| 112 | 3300009098 | Ga0105245_10000486 | Ga0105245_1000048622 | 185 |
| 113 | 3300009101 | Ga0105247_10002346 | Ga0105247_100023463 | 185 |
| 114 | 3300009174 | Ga0105241_10000026 | Ga0105241_1000002619 | 185 |
| 115 | 3300009174 | Ga0105241_10009216 | Ga0105241_100092164 | 185 |
| 116 | 3300009177 | Ga0105248_10081067 | Ga0105248_100810673 | 185 |
| 117 | 3300009545 | Ga0105237_10000590 | Ga0105237_100005903 | 185 |
| 118 | 3300009545 | Ga0105237_10041670 | Ga0105237_100416702 | 185 |
| 119 | 3300009545 | Ga0105237_10482805 | Ga0105237_104828051 | 185 |
| 120 | 3300009551 | Ga0105238_10000197 | Ga0105238_1000019720 | 185 |
| 121 | 3300009551 | Ga0105238_10000509 | Ga0105238_1000050921 | 185 |
| 122 | 3300009551 | Ga0105238_10276290 | Ga0105238_102762902 | 185 |
| 123 | 3300009553 | Ga0105249_10120013 | Ga0105249_101200132 | 185 |
| 124 | 3300010375 | Ga0105239_10001891 | Ga0105239_1000189121 | 185 |
| 125 | 3300010375 | Ga0105239_10052641 | Ga0105239_100526414 | 185 |
| 126 | 3300011119 | Ga0105246_10001192 | Ga0105246_100011927 | 185 |
| 127 | 3300013105 | Ga0157369_10000430 | Ga0157369_1000043034 | 185 |
| 128 | 3300013105 | Ga0157369_10463439 | Ga0157369_104634392 | 185 |
| 129 | 3300013297 | Ga0157378_10018090 | Ga0157378_100180903 | 185 |
| 130 | 3300013306 | Ga0163162_10080239 | Ga0163162_100802393 | 185 |
| 131 | 3300013307 | Ga0157372_10009734 | Ga0157372_100097342 | 185 |
| 132 | 3300013307 | Ga0157372_10082332 | Ga0157372_100823322 | 185 |
| 133 | 3300013307 | Ga0157372_10210743 | Ga0157372_102107432 | 185 |
| 134 | 3300014325 | Ga0163163_10001161 | Ga0163163_100011613 | 185 |
| 135 | 3300014745 | Ga0157377_10210870 | Ga0157377_102108702 | 185 |
| 136 | 3300014968 | Ga0157379_10002312 | Ga0157379_100023122 | 185 |
| 137 | 3300014968 | Ga0157379_10224971 | Ga0157379_102249713 | 185 |
| 138 | 3300014969 | Ga0157376_10000296 | Ga0157376_100002966 | 185 |
| 139 | 3300025321 | Ga0207656_10004048 | Ga0207656_100040483 | 185 |
| 140 | 3300025900 | Ga0207710_10000487 | Ga0207710_100004875 | 185 |
| 141 | 3300025903 | Ga0207680_10219124 | Ga0207680_102191242 | 185 |
| 142 | 3300025909 | Ga0207705_10036415 | Ga0207705_100364153 | 185 |
| 143 | 3300025911 | Ga0207654_10000281 | Ga0207654_1000028117 | 185 |
| 144 | 3300025911 | Ga0207654_10003128 | Ga0207654_100031285 | 185 |
| 145 | 3300025911 | Ga0207654_10109085 | Ga0207654_101090852 | 185 |
| 146 | 3300025913 | Ga0207695_10000113 | Ga0207695_10000113163 | 185 |
| 147 | 3300025913 | Ga0207695_10005013 | Ga0207695_100050134 | 185 |
| 148 | 3300025914 | Ga0207671_10000065 | Ga0207671_1000006579 | 185 |
| 149 | 3300025914 | Ga0207671_10000123 | Ga0207671_1000012393 | 185 |
| 150 | 3300025914 | Ga0207671_10000139 | Ga0207671_1000013954 | 185 |
| 151 | 3300025924 | Ga0207694_10000248 | Ga0207694_1000024834 | 185 |
| 152 | 3300025924 | Ga0207694_10000855 | Ga0207694_100008554 | 185 |
| 153 | 3300025924 | Ga0207694_10166466 | Ga0207694_101664662 | 185 |
| 154 | 3300025925 | Ga0207650_10063539 | Ga0207650_100635393 | 185 |
| 155 | 3300025927 | Ga0207687_10000978 | Ga0207687_100009786 | 185 |
| 156 | 3300025931 | Ga0207644_10004420 | Ga0207644_100044203 | 185 |
| 157 | 3300025941 | Ga0207711_10273081 | Ga0207711_102730812 | 185 |
| 158 | 3300025942 | Ga0207689_10000724 | Ga0207689_1000072424 | 185 |
| 159 | 3300025944 | Ga0207661_10001283 | Ga0207661_1000128315 | 185 |
| 160 | 3300025944 | Ga0207661_10192435 | Ga0207661_101924352 | 185 |
| 161 | 3300025945 | Ga0207679_10024591 | Ga0207679_100245914 | 185 |
| 162 | 3300025949 | Ga0207667_10006194 | Ga0207667_100061947 | 185 |
| 163 | 3300025949 | Ga0207667_10407028 | Ga0207667_104070282 | 185 |
| 164 | 3300025961 | Ga0207712_10110215 | Ga0207712_101102152 | 185 |
| 165 | 3300025986 | Ga0207658_10003428 | Ga0207658_100034283 | 185 |
| 166 | 3300026023 | Ga0207677_10000143 | Ga0207677_1000014329 | 185 |
| 167 | 3300026035 | Ga0207703_10004820 | Ga0207703_100048203 | 185 |
| 168 | 3300026041 | Ga0207639_10000088 | Ga0207639_1000008811 | 185 |
| 169 | 3300026078 | Ga0207702_10001334 | Ga0207702_100013349 | 185 |
| 170 | 3300026078 | Ga0207702_10002672 | Ga0207702_100026726 | 185 |
| 171 | 3300026078 | Ga0207702_10015520 | Ga0207702_100155203 | 185 |
| 172 | 3300026088 | Ga0207641_10011936 | Ga0207641_100119363 | 185 |
| 173 | 3300026095 | Ga0207676_10002595 | Ga0207676_100025957 | 185 |
| 174 | 3300026116 | Ga0207674_10000669 | Ga0207674_1000066918 | 185 |
| 175 | 3300026116 | Ga0207674_10003068 | Ga0207674_1000306817 | 185 |
| 176 | 3300026116 | Ga0207674_10307226 | Ga0207674_103072262 | 185 |
| 177 | 3300026142 | Ga0207698_10000708 | Ga0207698_100007089 | 185 |
| 178 | 3300028381 | Ga0268264_10000598 | Ga0268264_1000059826 | 185 |
| 179 | 3300031665 | Ga0316575_10012827 | Ga0316575_100128273 | 185 |
| 180 | 3300048908 | Ga0496105_0232622 | Ga0496105_0232622_31_666 | 185 |
| 181 | 3300048917 | Ga0496114_0211501 | Ga0496114_0211501_487_1122 | 185 |
| 182 | iso_pu_bacteria | 2600254954 | 2600444695 | 185 |
| 183 | iso_pu_bacteria | 2600255389 | 2602012012 | 185 |
| 184 | iso_pu_bacteria | 2823421272 | 2823423655 | 185 |
| 185 | iso_pu_bacteria | 2919501602 | 2919503408 | 185 |
| 186 | iso_pu_bacteria | 2926063275 | 2926066021 | 185 |
| 187 | 3300005548 | Ga0070665_100055769 | Ga0070665_1000557692 | 186 |
| 188 | 3300005616 | Ga0068852_100122301 | Ga0068852_1001223012 | 186 |
| 189 | 3300009093 | Ga0105240_10068360 | Ga0105240_100683603 | 186 |
| 190 | 3300013296 | Ga0157374_10182413 | Ga0157374_101824132 | 186 |
| 191 | 3300014969 | Ga0157376_10012770 | Ga0157376_100127703 | 186 |
| 192 | 3300025913 | Ga0207695_10037312 | Ga0207695_100373123 | 186 |
| 193 | 3300028379 | Ga0268266_10098647 | Ga0268266_100986473 | 186 |
| 194 | 3300031344 | Ga0265316_10323321 | Ga0265316_103233212 | 186 |
| 195 | 3300036401 | Ga0373937_0377362 | Ga0373937_0377362_295_930 | 186 |
| 196 | 3300046453 | Ga0495627_037945 | Ga0495627_037945_332_913 | 186 |
| 197 | 3300046459 | Ga0495629_0017355 | Ga0495629_0017355_2139_2774 | 186 |
| 198 | 3300046519 | Ga0495632_0029255 | Ga0495632_0029255_189_770 | 186 |
| 199 | 3300046558 | Ga0495633_0008408 | Ga0495633_0008408_2187_2768 | 186 |
| 200 | 3300046689 | Ga0495613_0066602 | Ga0495613_0066602_179_814 | 186 |
| 201 | 3300053077 | Ga0495601_0148368 | Ga0495601_0148368_332_967 | 186 |
| 202 | 3300053088 | Ga0500644_0093138 | Ga0500644_0093138_453_1034 | 186 |
| 203 | 3300053161 | Ga0500634_0000863 | Ga0500634_0000863_1804_2385 | 186 |
| 204 | iso_pu_bacteria | 2734482258 | 2735817377 | 186 |
| 205 | iso_pu_bacteria | 8021622325 | 8021625747 | 186 |
| 206 | iso_pu_bacteria | 8021648035 | 8021650321 | 186 |
| 207 | 3300005616 | Ga0068852_100429192 | Ga0068852_1004291922 | 187 |
| 208 | 3300046453 | Ga0495627_000078 | Ga0495627_000078_44628_45191 | 187 |
| 209 | iso_pu_bacteria | 2747842501 | 2748019439 | 187 |
| 210 | 3300005344 | Ga0070661_100026342 | Ga0070661_1000263422 | 188 |
| 211 | 3300005614 | Ga0068856_100173748 | Ga0068856_1001737482 | 188 |
| 212 | 3300009093 | Ga0105240_10311427 | Ga0105240_103114272 | 188 |
| 213 | 3300013307 | Ga0157372_10105164 | Ga0157372_101051642 | 188 |
| 214 | 3300013308 | Ga0157375_11225608 | Ga0157375_112256082 | 188 |
| 215 | 3300025914 | Ga0207671_10414112 | Ga0207671_104141122 | 188 |
| 216 | 3300026078 | Ga0207702_10109911 | Ga0207702_101099112 | 188 |
| 217 | 3300026142 | Ga0207698_10525140 | Ga0207698_105251402 | 188 |
| 218 | 3300028653 | Ga0265323_10007390 | Ga0265323_100073904 | 188 |
| 219 | 3300031235 | Ga0265330_10002162 | Ga0265330_100021623 | 188 |
| 220 | 3300031235 | Ga0265330_10014322 | Ga0265330_100143224 | 188 |
| 221 | 3300031344 | Ga0265316_10000352 | Ga0265316_1000035230 | 188 |
| 222 | 3300031344 | Ga0265316_10056454 | Ga0265316_100564543 | 188 |
| 223 | 3300031712 | Ga0265342_10002441 | Ga0265342_100024412 | 188 |
| 224 | 3300046512 | Ga0495610_0078259 | Ga0495610_0078259_769_1335 | 188 |
| 225 | 3300046515 | Ga0495620_0004313 | Ga0495620_0004313_6283_6849 | 188 |
| 226 | 3300046524 | Ga0495648_0001153 | Ga0495648_0001153_1314_1880 | 188 |
| 227 | 3300046530 | Ga0495654_0092786 | Ga0495654_0092786_203_769 | 188 |
| 228 | 3300046665 | Ga0495661_0000505 | Ga0495661_0000505_24958_25524 | 188 |
| 229 | 3300047446 | Ga0495679_000618 | Ga0495679_000618_6362_6928 | 188 |
| 230 | 3300053161 | Ga0500634_0000085 | Ga0500634_0000085_25122_25688 | 188 |
| 231 | 3300005327 | Ga0070658_10199734 | Ga0070658_101997342 | 189 |
| 232 | 3300005329 | Ga0070683_100019183 | Ga0070683_1000191832 | 189 |
| 233 | 3300005344 | Ga0070661_100191749 | Ga0070661_1001917492 | 189 |
| 234 | 3300005436 | Ga0070713_100142163 | Ga0070713_1001421632 | 189 |
| 235 | 3300005535 | Ga0070684_100254603 | Ga0070684_1002546032 | 189 |
| 236 | 3300005563 | Ga0068855_100022916 | Ga0068855_1000229164 | 189 |
| 237 | 3300005578 | Ga0068854_100231423 | Ga0068854_1002314232 | 189 |
| 238 | 3300005614 | Ga0068856_100057243 | Ga0068856_1000572432 | 189 |
| 239 | 3300005614 | Ga0068856_100539666 | Ga0068856_1005396662 | 189 |
| 240 | 3300005616 | Ga0068852_100664226 | Ga0068852_1006642262 | 189 |
| 241 | 3300009093 | Ga0105240_10085557 | Ga0105240_100855573 | 189 |
| 242 | 3300009545 | Ga0105237_10899893 | Ga0105237_108998931 | 189 |
| 243 | 3300013105 | Ga0157369_10016814 | Ga0157369_100168143 | 189 |
| 244 | 3300013105 | Ga0157369_10140829 | Ga0157369_101408293 | 189 |
| 245 | 3300013307 | Ga0157372_10017083 | Ga0157372_100170833 | 189 |
| 246 | 3300013307 | Ga0157372_10020181 | Ga0157372_100201813 | 189 |
| 247 | 3300021377 | Ga0213874_10100155 | Ga0213874_101001552 | 189 |
| 248 | 3300025909 | Ga0207705_10026733 | Ga0207705_100267333 | 189 |
| 249 | 3300025913 | Ga0207695_10060369 | Ga0207695_100603693 | 189 |
| 250 | 3300025920 | Ga0207649_10063255 | Ga0207649_100632553 | 189 |
| 251 | 3300025924 | Ga0207694_10053280 | Ga0207694_100532802 | 189 |
| 252 | 3300025928 | Ga0207700_10154360 | Ga0207700_101543602 | 189 |
| 253 | 3300025944 | Ga0207661_10966606 | Ga0207661_109666061 | 189 |
| 254 | 3300025949 | Ga0207667_10048192 | Ga0207667_100481922 | 189 |
| 255 | 3300025949 | Ga0207667_10153024 | Ga0207667_101530243 | 189 |
| 256 | 3300025981 | Ga0207640_10020377 | Ga0207640_100203774 | 189 |
| 257 | 3300031548 | Ga0307408_100000004 | Ga0307408_100000004300 | 189 |
| 258 | 3300039450 | Ga0436363_0913429 | Ga0436363_0913429_73_642 | 189 |
| 259 | 3300042439 | Ga0439464_0035256 | Ga0439464_0035256_343_912 | 189 |
| 260 | 3300017792 | Ga0163161_10063024 | Ga0163161_100630243 | 190 |
| 261 | 3300025258 | Ga0209129_1000392 | Ga0209129_10003923 | 190 |
| 262 | 3300025297 | Ga0209758_1007929 | Ga0209758_10079292 | 190 |
| 263 | 3300006051 | Ga0075364_10442332 | Ga0075364_104423321 | 191 |
| 264 | 3300009093 | Ga0105240_10127298 | Ga0105240_101272982 | 191 |
| 265 | 3300031249 | Ga0265339_10000194 | Ga0265339_100001949 | 191 |
| 266 | 3300031712 | Ga0265342_10001536 | Ga0265342_1000153613 | 191 |
| 267 | 3300005327 | Ga0070658_10074673 | Ga0070658_100746731 | 192 |
| 268 | 3300005548 | Ga0070665_100005637 | Ga0070665_1000056373 | 192 |
| 269 | 3300009174 | Ga0105241_10000121 | Ga0105241_100001218 | 192 |
| 270 | 3300013105 | Ga0157369_10024598 | Ga0157369_100245984 | 192 |
| 271 | 3300025911 | Ga0207654_10000054 | Ga0207654_1000005452 | 192 |
| 272 | 3300028379 | Ga0268266_10068745 | Ga0268266_100687452 | 192 |
| 273 | 3300028800 | Ga0265338_10114279 | Ga0265338_101142793 | 192 |
| 274 | 3300046529 | Ga0495652_0531857 | Ga0495652_0531857_157_792 | 192 |
| 275 | 3300049571 | Ga0501034_1134802 | Ga0501034_1134802_61_639 | 192 |
| 276 | iso_pu_bacteria | 2599185288 | 2599883309 | 193 |
| 277 | iso_pu_bacteria | 2738541294 | 2738811450 | 193 |
| 278 | iso_pu_bacteria | 2738541309 | 2738898810 | 193 |
| 279 | iso_pu_bacteria | 2738543020 | 2739288508 | 193 |
| 280 | iso_pu_bacteria | 2738543021 | 2739293820 | 193 |
| 281 | iso_pu_bacteria | 2818991457 | 2819662551 | 193 |
| 282 | iso_pu_bacteria | 2928027323 | 2928028130 | 193 |
| 283 | iso_pu_bacteria | 2984555340 | 2984558459 | 193 |
| 284 | iso_pu_bacteria | 2993356040 | 2993358225 | 193 |
| 285 | 3300013306 | Ga0163162_10500306 | Ga0163162_105003062 | 194 |
| 286 | 3300046501 | Ga0495607_0017584 | Ga0495607_0017584_2803_3390 | 194 |
| 287 | 3300047323 | Ga0495683_0000086 | Ga0495683_0000086_29746_30330 | 194 |
| 288 | 3300049459 | Ga0495678_036781 | Ga0495678_036781_543_1127 | 194 |
| 289 | iso_pu_bacteria | 2984564862 | 2984567134 | 194 |
| 290 | 3300013102 | Ga0157371_10000333 | Ga0157371_1000033318 | 196 |
| 291 | 3300025912 | Ga0207707_10016561 | Ga0207707_100165612 | 196 |
| 292 | 3300046453 | Ga0495627_000039 | Ga0495627_000039_189029_189619 | 196 |
| 293 | 3300053140 | Ga0500573_0065089 | Ga0500573_0065089_772_1362 | 196 |
| 294 | 3300003781 | Ga0055536_1000154 | Ga0055536_100015427 | 197 |
| 295 | 3300003791 | Ga0055530_10000171 | Ga0055530_1000017127 | 197 |
| 296 | 3300003792 | Ga0055540_1000214 | Ga0055540_100021424 | 197 |
| 297 | 3300005290 | Ga0065712_10101746 | Ga0065712_101017462 | 197 |
| 298 | 3300005530 | Ga0070679_100047148 | Ga0070679_1000471483 | 197 |
| 299 | 3300005547 | Ga0070693_100068411 | Ga0070693_1000684112 | 197 |
| 300 | 3300005563 | Ga0068855_100002688 | Ga0068855_1000026887 | 197 |
| 301 | 3300005616 | Ga0068852_100000019 | Ga0068852_10000001985 | 197 |
| 302 | 3300009093 | Ga0105240_10000496 | Ga0105240_1000049662 | 197 |
| 303 | 3300009093 | Ga0105240_10001856 | Ga0105240_1000185634 | 197 |
| 304 | 3300009174 | Ga0105241_10059096 | Ga0105241_100590963 | 197 |
| 305 | 3300009177 | Ga0105248_10034015 | Ga0105248_100340153 | 197 |
| 306 | 3300009551 | Ga0105238_10119680 | Ga0105238_101196803 | 197 |
| 307 | 3300010375 | Ga0105239_10021514 | Ga0105239_100215144 | 197 |
| 308 | 3300011119 | Ga0105246_10000006 | Ga0105246_1000000622 | 197 |
| 309 | 3300013100 | Ga0157373_10701603 | Ga0157373_107016031 | 197 |
| 310 | 3300013104 | Ga0157370_10000005 | Ga0157370_10000005231 | 197 |
| 311 | 3300013105 | Ga0157369_10000085 | Ga0157369_1000008584 | 197 |
| 312 | 3300013296 | Ga0157374_10031721 | Ga0157374_100317214 | 197 |
| 313 | 3300013296 | Ga0157374_10198663 | Ga0157374_101986632 | 197 |
| 314 | 3300013297 | Ga0157378_10425368 | Ga0157378_104253682 | 197 |
| 315 | 3300013306 | Ga0163162_10010079 | Ga0163162_100100796 | 197 |
| 316 | 3300013307 | Ga0157372_10000217 | Ga0157372_1000021753 | 197 |
| 317 | 3300017792 | Ga0163161_10000853 | Ga0163161_100008536 | 197 |
| 318 | 3300025256 | Ga0209759_1007978 | Ga0209759_10079781 | 197 |
| 319 | 3300025292 | Ga0209676_1000147 | Ga0209676_1000147109 | 197 |
| 320 | 3300025298 | Ga0209050_1000062 | Ga0209050_1000062247 | 197 |
| 321 | 3300025303 | Ga0209051_1000409 | Ga0209051_100040928 | 197 |
| 322 | 3300025735 | Ga0207713_1000884 | Ga0207713_10008846 | 197 |
| 323 | 3300025913 | Ga0207695_10000080 | Ga0207695_10000080205 | 197 |
| 324 | 3300025913 | Ga0207695_10000167 | Ga0207695_10000167103 | 197 |
| 325 | 3300025920 | Ga0207649_10657902 | Ga0207649_106579022 | 197 |
| 326 | 3300025921 | Ga0207652_10109533 | Ga0207652_101095332 | 197 |
| 327 | 3300025924 | Ga0207694_10012616 | Ga0207694_100126164 | 197 |
| 328 | 3300025927 | Ga0207687_10061410 | Ga0207687_100614102 | 197 |
| 329 | 3300025941 | Ga0207711_10060353 | Ga0207711_100603533 | 197 |
| 330 | 3300025949 | Ga0207667_10007990 | Ga0207667_100079908 | 197 |
| 331 | 3300026142 | Ga0207698_10000003 | Ga0207698_10000003230 | 197 |
| 332 | 3300031731 | Ga0307405_10000897 | Ga0307405_100008976 | 197 |
| 333 | 3300041507 | Ga0451851_0085375 | Ga0451851_0085375_10_603 | 197 |
| 334 | 3300046506 | Ga0495583_0002316 | Ga0495583_0002316_14233_14826 | 197 |
| 335 | 3300046507 | Ga0495606_0000054 | Ga0495606_0000054_184975_185574 | 197 |
| 336 | 3300046512 | Ga0495610_0001902 | Ga0495610_0001902_5632_6225 | 197 |
| 337 | 3300046522 | Ga0495643_0000081 | Ga0495643_0000081_85109_85708 | 197 |
| 338 | 3300046522 | Ga0495643_0022213 | Ga0495643_0022213_1357_1956 | 197 |
| 339 | 3300046530 | Ga0495654_0003891 | Ga0495654_0003891_1543_2136 | 197 |
| 340 | 3300046648 | Ga0495611_0128548 | Ga0495611_0128548_513_1106 | 197 |
| 341 | 3300046660 | Ga0495625_0025897 | Ga0495625_0025897_1150_1743 | 197 |
| 342 | 3300046660 | Ga0495625_0441197 | Ga0495625_0441197_23_622 | 197 |
| 343 | 3300046692 | Ga0495671_0001437 | Ga0495671_0001437_6555_7154 | 197 |
| 344 | 3300046694 | Ga0495649_0000582 | Ga0495649_0000582_23069_23668 | 197 |
| 345 | 3300046694 | Ga0495649_0076345 | Ga0495649_0076345_177_776 | 197 |
| 346 | 3300047446 | Ga0495679_000316 | Ga0495679_000316_31423_32016 | 197 |
| 347 | 3300047470 | Ga0495681_0015970 | Ga0495681_0015970_1567_2166 | 197 |
| 348 | 3300048927 | Ga0496124_0011604 | Ga0496124_0011604_2477_3070 | 197 |
| 349 | 3300048928 | Ga0496125_0045981 | Ga0496125_0045981_598_1191 | 197 |
| 350 | 3300048929 | Ga0496126_0019570 | Ga0496126_0019570_371_964 | 197 |
| 351 | 2162886007 | SwRhRL2b_contig_3237251 | SwRhRL2b_0457.00004210 | 198 |
| 352 | 3300005289 | Ga0065704_10072202 | Ga0065704_100722026 | 198 |
| 353 | 3300009092 | Ga0105250_10032148 | Ga0105250_100321481 | 198 |
| 354 | 3300009148 | Ga0105243_10022374 | Ga0105243_100223744 | 198 |
| 355 | 3300025711 | Ga0207696_1000016 | Ga0207696_1000016173 | 198 |
| 356 | 3300025935 | Ga0207709_10094141 | Ga0207709_100941412 | 198 |
| 357 | 3300048913 | Ga0496110_0750671 | Ga0496110_0750671_56_652 | 198 |
| 358 | 3300048920 | Ga0496117_0000522 | Ga0496117_0000522_34202_34798 | 198 |
| 359 | 3300048921 | Ga0496118_0000246 | Ga0496118_0000246_34046_34642 | 198 |
| 360 | 3300048927 | Ga0496124_0041594 | Ga0496124_0041594_1963_2559 | 198 |
| 361 | 3300048927 | Ga0496124_0181427 | Ga0496124_0181427_1007_1603 | 198 |
| 362 | 3300048927 | Ga0496124_0446288 | Ga0496124_0446288_170_766 | 198 |
| 363 | 3300048928 | Ga0496125_0000068 | Ga0496125_0000068_217137_217733 | 198 |
| 364 | 3300048929 | Ga0496126_0009252 | Ga0496126_0009252_1559_2155 | 198 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qtn-assembly1.cif.gz_B | crystal structure of the vitamin b3 transporter pnuc | 0.8029 | 4 | 181 |
| 4qtn-assembly1.cif.gz_B | crystal structure of the vitamin b3 transporter pnuc | 0.7268 | 4 | 181 |
| 2gez-assembly1.cif.gz_A | crystal structure of potassium-independent plant asparaginase | 0.5618 | 70 | 129 |
| 6w2q-assembly1.cif.gz_A | junction 34, dhr53-dhr4 | 0.5398 | 4 | 133 |
| 8e12-assembly1.cif.gz_C | homotrimeric variant of tctrp9, bgl14 | 0.5033 | 52 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0F5V1_132_225_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.5799 | 92 | 193 | 1.20.1280.290 |
| af_A0A0R0F5V1_132_225_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.5633 | 92 | 193 | 1.20.1280.290 |
| af_A0A1X7RBT7_30_120_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.5587 | 89 | 182 | 1.20.1280.290 |
| af_O44620_4_91_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.5585 | 88 | 182 | 1.20.1280.290 |
| af_Q550E0_234_487_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.5571 | 80 | 194 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A511BVH4-F1-model_v4 | Nicotinamide riboside transporter PnuC | 0.986 | 1 | 186 |
GO:0005886
GO:0034257 |
| AF-A0A850PCL3-F1-model_v4 | Nicotinamide riboside transporter PnuC | 0.9836 | 1 | 184 |
GO:0005886
GO:0034257 |
| AF-A0A4Y6UK11-F1-model_v4 | Nicotinamide riboside transporter PnuC | 0.9805 | 1 | 187 |
GO:0005886
GO:0034257 |
| AF-A0A6P1QFZ4-F1-model_v4 | deleted | 0.9801 | 1 | 182 |
|
| AF-A0A1B4BXJ4-F1-model_v4 | deleted | 0.9776 | 1 | 189 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar