F423230

General Info

Members Datasets Scaffolds Average Seq Length
364 208 728 223

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100279062|Ga0070708_1002790622
Length 237
Sequence MDHTLFYLINEKWTNPALDLFMAAISNIEIWKPLLILIVLIALILGGFKARACIFCTLLSLLIAEQVTGMLKSAFDRPRPKQVQRVRMVELQKTRPAFLTLFKTPQIRYSDQSDYKRSGPSFPSGHVTNNTVIAVCLTLFYRRRGWLYWMVDAAIGYSRIYLGAHWPSDVLATLFLATGETLLILGALELLWSWAAPKWAANIYERYPSLVANVGQASNLPSPDSPRRGGRNSRHIP

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
145 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
158 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
159 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
160 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
161 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.87
Rhizosphere 93.13
Stem 0
Stem Tuber 0
Unclassified 26.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100279062 3300005445 Unclassified 1572
2 JGI24035J26624_1004442 3300002126 Unclassified 1332
3 JGI25406J46586_10046172 3300003203 Unclassified 1494
4 Ga0065714_10128306 3300005288 Bacteria 1274
5 Ga0065704_10006345 3300005289 Bacteria 2583
6 Ga0065704_10179514 3300005289 Bacteria 1245
7 Ga0065715_10002089 3300005293 Bacteria 5832
8 Ga0065715_10004331 3300005293 Bacteria 4154
9 Ga0065707_10028947 3300005295 Bacteria 1102
10 Ga0070658_10210904 3300005327 Unclassified 1641
11 Ga0070658_10232932 3300005327 Bacteria 1560
12 Ga0070676_10050241 3300005328 Unclassified 2444
13 Ga0070676_10081597 3300005328 Bacteria 1963
14 Ga0070683_100009483 3300005329 Bacteria 8328
15 Ga0070683_100422639 3300005329 Bacteria 1271
16 Ga0070690_100035651 3300005330 Unclassified 3122
17 Ga0070690_100090454 3300005330 Bacteria 2015
18 Ga0070690_100107899 3300005330 Unclassified 1854
19 Ga0070670_100182752 3300005331 Unclassified 1821
20 Ga0070670_100275617 3300005331 Bacteria 1468
21 Ga0070666_10034057 3300005335 Unclassified 3375
22 Ga0070666_10037192 3300005335 Bacteria 3235
23 Ga0070666_10054996 3300005335 Bacteria 2685
24 Ga0070680_100253344 3300005336 Unclassified 1488
25 Ga0070682_100007059 3300005337 Bacteria 6320
26 Ga0068868_100208716 3300005338 Bacteria 1631
27 Ga0068868_100232739 3300005338 Bacteria 1546
28 Ga0068868_100319121 3300005338 Bacteria 1323
29 Ga0070660_100014644 3300005339 Bacteria 5657
30 Ga0070660_100288002 3300005339 Bacteria 1345
31 Ga0070689_100008718 3300005340 Bacteria 7157
32 Ga0070689_100105269 3300005340 Bacteria 2238
33 Ga0070689_100472914 3300005340 Bacteria 1070
34 Ga0070687_100065881 3300005343 Bacteria 1928
35 Ga0070687_100227417 3300005343 Bacteria 1146
36 Ga0070661_100079751 3300005344 Unclassified 2416
37 Ga0070661_100159509 3300005344 Bacteria 1708
38 Ga0070668_100124423 3300005347 Bacteria 2065
39 Ga0070668_100296584 3300005347 Unclassified 1355
40 Ga0070675_100025623 3300005354 Bacteria 4728
41 Ga0070675_100106103 3300005354 Bacteria 2371
42 Ga0070675_100392460 3300005354 Bacteria 1237
43 Ga0070671_100031176 3300005355 Unclassified 4403
44 Ga0070671_100071706 3300005355 Bacteria 2891
45 Ga0070671_100093994 3300005355 Unclassified 2512
46 Ga0070671_100383965 3300005355 Unclassified 1200
47 Ga0070671_100579865 3300005355 Unclassified 968
48 Ga0070674_100477591 3300005356 Bacteria 1034
49 Ga0070673_100007506 3300005364 Bacteria 7201
50 Ga0070673_100025322 3300005364 Bacteria 4365
51 Ga0070688_100014100 3300005365 Bacteria 4522
52 Ga0070688_100019452 3300005365 Bacteria 3934
53 Ga0070688_100062433 3300005365 Unclassified 2358
54 Ga0070688_100704020 3300005365 Unclassified 782
55 Ga0070659_100008055 3300005366 Bacteria 7682
56 Ga0070667_100022007 3300005367 Bacteria 5289
57 Ga0070667_100194146 3300005367 Bacteria 1799
58 Ga0070667_100432026 3300005367 Unclassified 1201
59 Ga0070667_100787352 3300005367 Bacteria 882
60 Ga0070709_10515101 3300005434 Bacteria 911
61 Ga0070713_100131217 3300005436 Bacteria 2210
62 Ga0070713_100171240 3300005436 Bacteria 1945
63 Ga0070713_100226771 3300005436 Bacteria 1697
64 Ga0070710_10010485 3300005437 Unclassified 4553
65 Ga0070701_10002991 3300005438 Bacteria 6612
66 Ga0070701_10096346 3300005438 Unclassified 1631
67 Ga0070711_100617746 3300005439 Unclassified 906
68 Ga0070705_100021288 3300005440 Bacteria 3446
69 Ga0070700_100036351 3300005441 Bacteria 2987
70 Ga0070694_100041821 3300005444 Bacteria 3059
71 Ga0070708_100023180 3300005445 Bacteria 5275
72 Ga0070708_100043729 3300005445 Bacteria 3936
73 Ga0070708_100342917 3300005445 Bacteria 1408
74 Ga0070678_100102126 3300005456 Unclassified 2225
75 Ga0070662_100173715 3300005457 Bacteria 1694
76 Ga0070662_100189913 3300005457 Bacteria 1624
77 Ga0070681_10018192 3300005458 Bacteria 7026
78 Ga0070685_10027493 3300005466 Unclassified 3144
79 Ga0070706_100006616 3300005467 Bacteria 10931
80 Ga0070706_100014075 3300005467 Bacteria 7391
81 Ga0070706_100170530 3300005467 Bacteria 2032
82 Ga0070706_100439823 3300005467 Bacteria 1214
83 Ga0070707_100043453 3300005468 Bacteria 4301
84 Ga0070707_100045807 3300005468 Unclassified 4185
85 Ga0070698_100213148 3300005471 Bacteria 1865
86 Ga0070699_100034494 3300005518 Unclassified 4373
87 Ga0070699_100051946 3300005518 Bacteria 3549
88 Ga0070679_100066098 3300005530 Bacteria 3604
89 Ga0070684_100001046 3300005535 Bacteria 19781
90 Ga0070684_100032532 3300005535 Bacteria 4445
91 Ga0070684_100045564 3300005535 Bacteria 3797
92 Ga0070697_100004361 3300005536 Bacteria 10855
93 Ga0070697_100005232 3300005536 Bacteria 9969
94 Ga0070697_100079704 3300005536 Bacteria 2696
95 Ga0070697_100103705 3300005536 Bacteria 2364
96 Ga0070697_100791673 3300005536 Unclassified 839
97 Ga0070686_100019571 3300005544 Unclassified 3992
98 Ga0070686_100021378 3300005544 Unclassified 3846
99 Ga0070695_100033134 3300005545 Bacteria 3232
100 Ga0070665_100005157 3300005548 Bacteria 13520
101 Ga0070665_100041404 3300005548 Bacteria 4630
102 Ga0070665_100152145 3300005548 Bacteria 2316
103 Ga0070704_100028743 3300005549 Bacteria 3703
104 Ga0070664_100107700 3300005564 Bacteria 2430
105 Ga0068857_100672931 3300005577 Bacteria 982
106 Ga0068856_100164609 3300005614 Unclassified 2229
107 Ga0070702_100442212 3300005615 Unclassified 941
108 Ga0068859_100025316 3300005617 Bacteria 5952
109 Ga0068864_100237718 3300005618 Bacteria 1687
110 Ga0068863_100045528 3300005841 Unclassified 4163
111 Ga0068863_100168426 3300005841 Unclassified 2101
112 Ga0068858_100026605 3300005842 Bacteria 5373
113 Ga0068858_100921240 3300005842 Unclassified 855
114 Ga0068860_100013198 3300005843 Bacteria 8107
115 Ga0068860_100294121 3300005843 Bacteria 1590
116 Ga0068860_100344958 3300005843 Bacteria 1465
117 Ga0081455_10015932 3300005937 Bacteria 7278
118 Ga0081455_10024270 3300005937 Bacteria 5620
119 Ga0081455_10101781 3300005937 Bacteria 2305
120 Ga0081455_10163584 3300005937 Bacteria 1703
121 Ga0081539_10002123 3300005985 Bacteria 29376
122 Ga0081539_10026458 3300005985 Unclassified 3702
123 Ga0070717_10028427 3300006028 Unclassified 4476
124 Ga0070717_10137842 3300006028 Unclassified 2102
125 Ga0070717_10161505 3300006028 Unclassified 1944
126 Ga0070715_10046192 3300006163 Unclassified 1850
127 Ga0070716_100055236 3300006173 Bacteria 2271
128 Ga0070716_100117858 3300006173 Bacteria 1657
129 Ga0070712_100080303 3300006175 Bacteria 2360
130 Ga0070712_100492389 3300006175 Bacteria 1026
131 Ga0070712_100598401 3300006175 Bacteria 933
132 Ga0097621_100039063 3300006237 Bacteria 3811
133 Ga0068871_100004007 3300006358 Bacteria 10189
134 Ga0068871_100769205 3300006358 Unclassified 886
135 Ga0075433_10875273 3300006852 Bacteria 784
136 Ga0075434_100035975 3300006871 Unclassified 4897
137 Ga0075434_100322585 3300006871 Unclassified 1565
138 Ga0068865_100296261 3300006881 Bacteria 1293
139 Ga0097620_100025316 3300006931 Bacteria 5952
140 Ga0099795_10059560 3300007788 Bacteria 1413
141 Ga0105250_10201050 3300009092 Unclassified 840
142 Ga0111539_10308501 3300009094 Unclassified 1841
143 Ga0105245_10101738 3300009098 Unclassified 2660
144 Ga0105245_10129059 3300009098 Bacteria 2370
145 Ga0105243_10377738 3300009148 Bacteria 1310
146 Ga0105241_10145413 3300009174 Unclassified 1934
147 Ga0105242_10003296 3300009176 Bacteria 12578
148 Ga0105242_10264999 3300009176 Unclassified 1554
149 Ga0105248_10277511 3300009177 Bacteria 1887
150 Ga0105248_10483081 3300009177 Unclassified 1396
151 Ga0105237_10434367 3300009545 Bacteria 1318
152 Ga0105249_10031604 3300009553 Bacteria 4788
153 Ga0105239_10060007 3300010375 Bacteria 4174
154 Ga0105239_10131891 3300010375 Bacteria 2780
155 Ga0105239_10519091 3300010375 Unclassified 1355
156 Ga0105246_10404241 3300011119 Unclassified 1135
157 Ga0157371_10316445 3300013102 Bacteria 1132
158 Ga0157371_10344328 3300013102 Bacteria 1084
159 Ga0157369_10043908 3300013105 Bacteria 4869
160 Ga0157374_10022444 3300013296 Bacteria 5631
161 Ga0157374_10058707 3300013296 Bacteria 3596
162 Ga0157374_10592519 3300013296 Unclassified 1118
163 Ga0157378_10028398 3300013297 Bacteria 4936
164 Ga0157378_10073693 3300013297 Bacteria 3070
165 Ga0157378_10136922 3300013297 Bacteria 2271
166 Ga0157378_10228689 3300013297 Bacteria 1771
167 Ga0157378_10490526 3300013297 Bacteria 1226
168 Ga0157378_10628158 3300013297 Bacteria 1088
169 Ga0157378_10732933 3300013297 Bacteria 1010
170 Ga0157378_11303015 3300013297 Unclassified 768
171 Ga0157372_10108642 3300013307 Bacteria 3175
172 Ga0157375_10002663 3300013308 Bacteria 15478
173 Ga0157375_10020894 3300013308 Bacteria 5992
174 Ga0157375_10075777 3300013308 Bacteria 3389
175 Ga0157375_10149367 3300013308 Bacteria 2470
176 Ga0157375_10298463 3300013308 Bacteria 1775
177 Ga0163163_10275748 3300014325 Bacteria 1733
178 Ga0163163_10280668 3300014325 Bacteria 1717
179 Ga0163163_10399558 3300014325 Bacteria 1432
180 Ga0157377_10040401 3300014745 Bacteria 2583
181 Ga0157377_10143592 3300014745 Bacteria 1469
182 Ga0157377_10478234 3300014745 Bacteria 866
183 Ga0157379_10034046 3300014968 Unclassified 4540
184 Ga0157376_10007289 3300014969 Bacteria 7878
185 Ga0157376_10216206 3300014969 Unclassified 1772
186 Ga0157376_10348830 3300014969 Bacteria 1416
187 Ga0207666_1001361 3300025271 Bacteria 2877
188 Ga0207673_1010091 3300025290 Bacteria 1211
189 Ga0207697_10001189 3300025315 Bacteria 14298
190 Ga0207697_10001640 3300025315 Bacteria 12108
191 Ga0207697_10010907 3300025315 Bacteria 3863
192 Ga0207697_10021901 3300025315 Unclassified 2619
193 Ga0207697_10093508 3300025315 Unclassified 1276
194 Ga0207653_10050612 3300025885 Bacteria 1382
195 Ga0207682_10045396 3300025893 Bacteria 1803
196 Ga0207692_10061637 3300025898 Bacteria 1944
197 Ga0207688_10266864 3300025901 Bacteria 1040
198 Ga0207680_10022440 3300025903 Unclassified 3433
199 Ga0207680_10119286 3300025903 Bacteria 1723
200 Ga0207685_10001815 3300025905 Unclassified 4657
201 Ga0207699_10215906 3300025906 Bacteria 1307
202 Ga0207645_10005840 3300025907 Bacteria 8873
203 Ga0207645_10027041 3300025907 Unclassified 3707
204 Ga0207684_10013962 3300025910 Bacteria 6939
205 Ga0207684_10014483 3300025910 Bacteria 6798
206 Ga0207684_10081104 3300025910 Unclassified 2761
207 Ga0207695_10879067 3300025913 Unclassified 776
208 Ga0207693_10063648 3300025915 Bacteria 2889
209 Ga0207693_10157875 3300025915 Unclassified 1784
210 Ga0207693_10190919 3300025915 Bacteria 1612
211 Ga0207693_10663636 3300025915 Bacteria 809
212 Ga0207663_10360827 3300025916 Bacteria 1102
213 Ga0207662_10150054 3300025918 Unclassified 1482
214 Ga0207657_10012282 3300025919 Bacteria 8461
215 Ga0207657_10331576 3300025919 Unclassified 1202
216 Ga0207657_10405508 3300025919 Unclassified 1072
217 Ga0207649_10088881 3300025920 Bacteria 2018
218 Ga0207652_10063642 3300025921 Bacteria 3190
219 Ga0207646_10013082 3300025922 Bacteria 7947
220 Ga0207646_10051855 3300025922 Bacteria 3671
221 Ga0207646_10233079 3300025922 Bacteria 1663
222 Ga0207659_10012995 3300025926 Bacteria 5320
223 Ga0207659_10080874 3300025926 Bacteria 2401
224 Ga0207659_10083639 3300025926 Bacteria 2366
225 Ga0207659_10394679 3300025926 Bacteria 1156
226 Ga0207700_10137950 3300025928 Bacteria 2000
227 Ga0207700_10215940 3300025928 Bacteria 1623
228 Ga0207664_10032088 3300025929 Unclassified 4024
229 Ga0207664_10103742 3300025929 Bacteria 2353
230 Ga0207644_10280277 3300025931 Bacteria 1338
231 Ga0207644_10574179 3300025931 Bacteria 935
232 Ga0207690_10009883 3300025932 Bacteria 5666
233 Ga0207706_10054317 3300025933 Unclassified 3535
234 Ga0207706_10096443 3300025933 Bacteria 2600
235 Ga0207706_10104929 3300025933 Bacteria 2486
236 Ga0207686_10506902 3300025934 Bacteria 937
237 Ga0207670_10013271 3300025936 Unclassified 4850
238 Ga0207670_10076822 3300025936 Unclassified 2325
239 Ga0207669_10036448 3300025937 Bacteria 2811
240 Ga0207704_10173699 3300025938 Bacteria 1549
241 Ga0207665_10069599 3300025939 Bacteria 2400
242 Ga0207665_10111479 3300025939 Unclassified 1923
243 Ga0207665_10208125 3300025939 Unclassified 1428
244 Ga0207691_10045537 3300025940 Unclassified 4031
245 Ga0207711_10611314 3300025941 Bacteria 1017
246 Ga0207689_10077219 3300025942 Bacteria 2738
247 Ga0207679_10061899 3300025945 Bacteria 2787
248 Ga0207651_10085732 3300025960 Unclassified 2286
249 Ga0207712_10266834 3300025961 Bacteria 1391
250 Ga0207668_10079281 3300025972 Bacteria 2375
251 Ga0207668_10530645 3300025972 Bacteria 1017
252 Ga0207658_10036408 3300025986 Bacteria 3528
253 Ga0207658_10670975 3300025986 Bacteria 935
254 Ga0207677_10196423 3300026023 Bacteria 1600
255 Ga0207677_10206942 3300026023 Bacteria 1564
256 Ga0207677_10400338 3300026023 Bacteria 1164
257 Ga0207703_10013271 3300026035 Bacteria 6417
258 Ga0207703_10569175 3300026035 Bacteria 1070
259 Ga0207678_10005421 3300026067 Bacteria 11423
260 Ga0207708_10032557 3300026075 Unclassified 3958
261 Ga0207641_10116358 3300026088 Bacteria 2379
262 Ga0207641_10286734 3300026088 Unclassified 1551
263 Ga0207676_10094877 3300026095 Bacteria 2459
264 Ga0207674_10064739 3300026116 Unclassified 3687
265 Ga0207675_100234287 3300026118 Bacteria 1772
266 Ga0207683_10084172 3300026121 Bacteria 2827
267 Ga0207683_10116609 3300026121 Unclassified 2394
268 Ga0268264_10017180 3300028381 Bacteria 5925
269 Ga0268264_10081301 3300028381 Bacteria 2769
270 Ga0268264_10309800 3300028381 Bacteria 1489
271 Ga0373926_0127955 3300035083 Bacteria 961
272 Ga0373945_0126415 3300035116 Bacteria 1021
273 Ga0373954_0045260 3300035118 Unclassified 2056
274 Ga0373957_0064034 3300035120 Bacteria 1429
275 Ga0373957_0119082 3300035120 Bacteria 1068
276 Ga0373943_0096370 3300035170 Bacteria 1540
277 Ga0373946_0008229 3300035171 Bacteria 3828
278 Ga0373955_0151085 3300035172 Bacteria 1367
279 Ga0373935_0012584 3300035692 Bacteria 5091
280 Ga0373935_0116981 3300035692 Bacteria 1776
281 Ga0373927_0186249 3300035695 Bacteria 1362
282 Ga0373927_0320486 3300035695 Bacteria 1021
283 Ga0373933_0104832 3300035724 Bacteria 1758
284 Ga0373933_0152544 3300035724 Unclassified 1464
285 Ga0373947_0131994 3300035725 Bacteria 1595
286 Ga0373947_0189435 3300035725 Bacteria 1342
287 Ga0373947_0508621 3300035725 Unclassified 819
288 Ga0373937_0067938 3300036401 Bacteria 3285
289 Ga0373937_0165566 3300036401 Bacteria 2073
290 Ga0373937_0340600 3300036401 Bacteria 1420
291 Ga0373925_0329771 3300037068 Bacteria 1236
292 Ga0451802_1433438 3300041460 Unclassified 1702
293 Ga0439448_0147741 3300042005 Unclassified 815
294 Ga0439455_0011698 3300042012 Unclassified 1955
295 Ga0439455_0088847 3300042012 Bacteria 846
296 Ga0439460_0059930 3300042461 Bacteria 1160
297 Ga0439440_0005891 3300042993 Unclassified 2447
298 Ga0466967_0080803 3300045976 Unclassified 2935
299 Ga0495592_0001816 3300046454 Bacteria 14999
300 Ga0495592_0179096 3300046454 Bacteria 1445
301 Ga0495603_0253750 3300046455 Bacteria 1013
302 Ga0495641_0073857 3300046461 Bacteria 1530
303 Ga0495651_0106372 3300046462 Unclassified 2080
304 Ga0495651_0145517 3300046462 Bacteria 1714
305 Ga0495653_0292375 3300046463 Bacteria 1065
306 Ga0495618_0162989 3300046514 Bacteria 1421
307 Ga0495628_0014482 3300046516 Bacteria 6609
308 Ga0495630_0143199 3300046517 Bacteria 1817
309 Ga0495652_0084106 3300046529 Bacteria 2617
310 Ga0495652_0091021 3300046529 Bacteria 2495
311 Ga0495640_0146631 3300046533 Bacteria 1518
312 Ga0495587_0055432 3300046536 Bacteria 2334
313 Ga0495645_0022566 3300046543 Bacteria 4554
314 Ga0495645_0030731 3300046543 Unclassified 3914
315 Ga0495667_0228031 3300046559 Unclassified 1188
316 Ga0495635_0363085 3300046663 Bacteria 965
317 Ga0495599_0000848 3300046678 Bacteria 17189
318 Ga0495623_0055059 3300046679 Bacteria 2508
319 Ga0495646_0003270 3300046680 Bacteria 10086
320 Ga0495658_0136439 3300046683 Bacteria 1497
321 Ga0495669_0169920 3300046684 Bacteria 1037
322 Ga0495613_0548358 3300046689 Bacteria 774
323 Ga0495624_0340990 3300046690 Bacteria 902
324 Ga0495624_0482701 3300046690 Bacteria 742
325 Ga0495604_0056372 3300047317 Bacteria 3025
326 Ga0495674_0136845 3300047319 Bacteria 2060
327 Ga0495674_0335918 3300047319 Bacteria 1228
328 Ga0495680_0172435 3300047322 Unclassified 1566
329 Ga0495684_0007312 3300047471 Bacteria 8555
330 Ga0495684_0122641 3300047471 Bacteria 1956
331 Ga0495602_0197903 3300048088 Bacteria 1535
332 Ga0496100_0050911 3300048903 Bacteria 2686
333 Ga0496100_0094162 3300048903 Bacteria 2051
334 Ga0496102_0147833 3300048905 Bacteria 2206
335 Ga0496103_0215191 3300048906 Unclassified 1235
336 Ga0496104_0097216 3300048907 Bacteria 2818
337 Ga0496105_0433476 3300048908 Unclassified 1039
338 Ga0496106_0590145 3300048909 Bacteria 890
339 Ga0496108_0031062 3300048911 Bacteria 4429
340 Ga0496108_0082525 3300048911 Bacteria 2726
341 Ga0496109_0027796 3300048912 Bacteria 5055
342 Ga0496109_0153131 3300048912 Unclassified 2159
343 Ga0496109_0296397 3300048912 Bacteria 1525
344 Ga0496110_0110473 3300048913 Bacteria 2470
345 Ga0496110_0406756 3300048913 Unclassified 1241
346 Ga0496110_0797014 3300048913 Bacteria 849
347 Ga0496111_0034816 3300048914 Bacteria 3597
348 Ga0496112_0020988 3300048915 Bacteria 6203
349 Ga0496112_0054717 3300048915 Unclassified 3922
350 Ga0496112_0089328 3300048915 Bacteria 3049
351 Ga0496112_0147810 3300048915 Bacteria 2318
352 Ga0496112_0240711 3300048915 Unclassified 1762
353 Ga0496113_0106392 3300048916 Unclassified 2179
354 Ga0496113_0582596 3300048916 Bacteria 896
355 Ga0496115_0027095 3300048918 Unclassified 4479
356 nmdc:mga08y16_315744_c1 3300050511 Unclassified 1609
357 nmdc:mga08y16_390130_c1 3300050511 Bacteria 1426
358 nmdc:mga0n895_139249_c1 3300050512 Bacteria 2454
359 nmdc:mga0rr50_475859_c1 3300050513 Bacteria 1060
360 nmdc:mga0a205_177192_c1 3300050515 Bacteria 2027
361 Ga0495601_0003213 3300053077 Bacteria 9351
362 Ga0495595_0160753 3300053084 Bacteria 1108
363 Ga0495595_0214120 3300053084 Bacteria 961
364 Ga0495619_0228066 3300053085 Bacteria 1290
365 Ga0070708_100279062
366 JGI24035J26624_1004442
367 JGI25406J46586_10046172
368 Ga0065714_10128306
369 Ga0065704_10006345
370 Ga0065704_10179514
371 Ga0065715_10002089
372 Ga0065715_10004331
373 Ga0065707_10028947
374 Ga0070658_10210904
375 Ga0070658_10232932
376 Ga0070676_10050241
377 Ga0070676_10081597
378 Ga0070683_100009483
379 Ga0070683_100422639
380 Ga0070690_100035651
381 Ga0070690_100090454
382 Ga0070690_100107899
383 Ga0070670_100182752
384 Ga0070670_100275617
385 Ga0070666_10034057
386 Ga0070666_10037192
387 Ga0070666_10054996
388 Ga0070680_100253344
389 Ga0070682_100007059
390 Ga0068868_100208716
391 Ga0068868_100232739
392 Ga0068868_100319121
393 Ga0070660_100014644
394 Ga0070660_100288002
395 Ga0070689_100008718
396 Ga0070689_100105269
397 Ga0070689_100472914
398 Ga0070687_100065881
399 Ga0070687_100227417
400 Ga0070661_100079751
401 Ga0070661_100159509
402 Ga0070668_100124423
403 Ga0070668_100296584
404 Ga0070675_100025623
405 Ga0070675_100106103
406 Ga0070675_100392460
407 Ga0070671_100031176
408 Ga0070671_100071706
409 Ga0070671_100093994
410 Ga0070671_100383965
411 Ga0070671_100579865
412 Ga0070674_100477591
413 Ga0070673_100007506
414 Ga0070673_100025322
415 Ga0070688_100014100
416 Ga0070688_100019452
417 Ga0070688_100062433
418 Ga0070688_100704020
419 Ga0070659_100008055
420 Ga0070667_100022007
421 Ga0070667_100194146
422 Ga0070667_100432026
423 Ga0070667_100787352
424 Ga0070709_10515101
425 Ga0070713_100131217
426 Ga0070713_100171240
427 Ga0070713_100226771
428 Ga0070710_10010485
429 Ga0070701_10002991
430 Ga0070701_10096346
431 Ga0070711_100617746
432 Ga0070705_100021288
433 Ga0070700_100036351
434 Ga0070694_100041821
435 Ga0070708_100023180
436 Ga0070708_100043729
437 Ga0070708_100342917
438 Ga0070678_100102126
439 Ga0070662_100173715
440 Ga0070662_100189913
441 Ga0070681_10018192
442 Ga0070685_10027493
443 Ga0070706_100006616
444 Ga0070706_100014075
445 Ga0070706_100170530
446 Ga0070706_100439823
447 Ga0070707_100043453
448 Ga0070707_100045807
449 Ga0070698_100213148
450 Ga0070699_100034494
451 Ga0070699_100051946
452 Ga0070679_100066098
453 Ga0070684_100001046
454 Ga0070684_100032532
455 Ga0070684_100045564
456 Ga0070697_100004361
457 Ga0070697_100005232
458 Ga0070697_100079704
459 Ga0070697_100103705
460 Ga0070697_100791673
461 Ga0070686_100019571
462 Ga0070686_100021378
463 Ga0070695_100033134
464 Ga0070665_100005157
465 Ga0070665_100041404
466 Ga0070665_100152145
467 Ga0070704_100028743
468 Ga0070664_100107700
469 Ga0068857_100672931
470 Ga0068856_100164609
471 Ga0070702_100442212
472 Ga0068859_100025316
473 Ga0068864_100237718
474 Ga0068863_100045528
475 Ga0068863_100168426
476 Ga0068858_100026605
477 Ga0068858_100921240
478 Ga0068860_100013198
479 Ga0068860_100294121
480 Ga0068860_100344958
481 Ga0081455_10015932
482 Ga0081455_10024270
483 Ga0081455_10101781
484 Ga0081455_10163584
485 Ga0081539_10002123
486 Ga0081539_10026458
487 Ga0070717_10028427
488 Ga0070717_10137842
489 Ga0070717_10161505
490 Ga0070715_10046192
491 Ga0070716_100055236
492 Ga0070716_100117858
493 Ga0070712_100080303
494 Ga0070712_100492389
495 Ga0070712_100598401
496 Ga0097621_100039063
497 Ga0068871_100004007
498 Ga0068871_100769205
499 Ga0075433_10875273
500 Ga0075434_100035975
501 Ga0075434_100322585
502 Ga0068865_100296261
503 Ga0097620_100025316
504 Ga0099795_10059560
505 Ga0105250_10201050
506 Ga0111539_10308501
507 Ga0105245_10101738
508 Ga0105245_10129059
509 Ga0105243_10377738
510 Ga0105241_10145413
511 Ga0105242_10003296
512 Ga0105242_10264999
513 Ga0105248_10277511
514 Ga0105248_10483081
515 Ga0105237_10434367
516 Ga0105249_10031604
517 Ga0105239_10060007
518 Ga0105239_10131891
519 Ga0105239_10519091
520 Ga0105246_10404241
521 Ga0157371_10316445
522 Ga0157371_10344328
523 Ga0157369_10043908
524 Ga0157374_10022444
525 Ga0157374_10058707
526 Ga0157374_10592519
527 Ga0157378_10028398
528 Ga0157378_10073693
529 Ga0157378_10136922
530 Ga0157378_10228689
531 Ga0157378_10490526
532 Ga0157378_10628158
533 Ga0157378_10732933
534 Ga0157378_11303015
535 Ga0157372_10108642
536 Ga0157375_10002663
537 Ga0157375_10020894
538 Ga0157375_10075777
539 Ga0157375_10149367
540 Ga0157375_10298463
541 Ga0163163_10275748
542 Ga0163163_10280668
543 Ga0163163_10399558
544 Ga0157377_10040401
545 Ga0157377_10143592
546 Ga0157377_10478234
547 Ga0157379_10034046
548 Ga0157376_10007289
549 Ga0157376_10216206
550 Ga0157376_10348830
551 Ga0207666_1001361
552 Ga0207673_1010091
553 Ga0207697_10001189
554 Ga0207697_10001640
555 Ga0207697_10010907
556 Ga0207697_10021901
557 Ga0207697_10093508
558 Ga0207653_10050612
559 Ga0207682_10045396
560 Ga0207692_10061637
561 Ga0207688_10266864
562 Ga0207680_10022440
563 Ga0207680_10119286
564 Ga0207685_10001815
565 Ga0207699_10215906
566 Ga0207645_10005840
567 Ga0207645_10027041
568 Ga0207684_10013962
569 Ga0207684_10014483
570 Ga0207684_10081104
571 Ga0207695_10879067
572 Ga0207693_10063648
573 Ga0207693_10157875
574 Ga0207693_10190919
575 Ga0207693_10663636
576 Ga0207663_10360827
577 Ga0207662_10150054
578 Ga0207657_10012282
579 Ga0207657_10331576
580 Ga0207657_10405508
581 Ga0207649_10088881
582 Ga0207652_10063642
583 Ga0207646_10013082
584 Ga0207646_10051855
585 Ga0207646_10233079
586 Ga0207659_10012995
587 Ga0207659_10080874
588 Ga0207659_10083639
589 Ga0207659_10394679
590 Ga0207700_10137950
591 Ga0207700_10215940
592 Ga0207664_10032088
593 Ga0207664_10103742
594 Ga0207644_10280277
595 Ga0207644_10574179
596 Ga0207690_10009883
597 Ga0207706_10054317
598 Ga0207706_10096443
599 Ga0207706_10104929
600 Ga0207686_10506902
601 Ga0207670_10013271
602 Ga0207670_10076822
603 Ga0207669_10036448
604 Ga0207704_10173699
605 Ga0207665_10069599
606 Ga0207665_10111479
607 Ga0207665_10208125
608 Ga0207691_10045537
609 Ga0207711_10611314
610 Ga0207689_10077219
611 Ga0207679_10061899
612 Ga0207651_10085732
613 Ga0207712_10266834
614 Ga0207668_10079281
615 Ga0207668_10530645
616 Ga0207658_10036408
617 Ga0207658_10670975
618 Ga0207677_10196423
619 Ga0207677_10206942
620 Ga0207677_10400338
621 Ga0207703_10013271
622 Ga0207703_10569175
623 Ga0207678_10005421
624 Ga0207708_10032557
625 Ga0207641_10116358
626 Ga0207641_10286734
627 Ga0207676_10094877
628 Ga0207674_10064739
629 Ga0207675_100234287
630 Ga0207683_10084172
631 Ga0207683_10116609
632 Ga0268264_10017180
633 Ga0268264_10081301
634 Ga0268264_10309800
635 Ga0373926_0127955
636 Ga0373945_0126415
637 Ga0373954_0045260
638 Ga0373957_0064034
639 Ga0373957_0119082
640 Ga0373943_0096370
641 Ga0373946_0008229
642 Ga0373955_0151085
643 Ga0373935_0012584
644 Ga0373935_0116981
645 Ga0373927_0186249
646 Ga0373927_0320486
647 Ga0373933_0104832
648 Ga0373933_0152544
649 Ga0373947_0131994
650 Ga0373947_0189435
651 Ga0373947_0508621
652 Ga0373937_0067938
653 Ga0373937_0165566
654 Ga0373937_0340600
655 Ga0373925_0329771
656 Ga0451802_1433438
657 Ga0439448_0147741
658 Ga0439455_0011698
659 Ga0439455_0088847
660 Ga0439460_0059930
661 Ga0439440_0005891
662 Ga0466967_0080803
663 Ga0495592_0001816
664 Ga0495592_0179096
665 Ga0495603_0253750
666 Ga0495641_0073857
667 Ga0495651_0106372
668 Ga0495651_0145517
669 Ga0495653_0292375
670 Ga0495618_0162989
671 Ga0495628_0014482
672 Ga0495630_0143199
673 Ga0495652_0084106
674 Ga0495652_0091021
675 Ga0495640_0146631
676 Ga0495587_0055432
677 Ga0495645_0022566
678 Ga0495645_0030731
679 Ga0495667_0228031
680 Ga0495635_0363085
681 Ga0495599_0000848
682 Ga0495623_0055059
683 Ga0495646_0003270
684 Ga0495658_0136439
685 Ga0495669_0169920
686 Ga0495613_0548358
687 Ga0495624_0340990
688 Ga0495624_0482701
689 Ga0495604_0056372
690 Ga0495674_0136845
691 Ga0495674_0335918
692 Ga0495680_0172435
693 Ga0495684_0007312
694 Ga0495684_0122641
695 Ga0495602_0197903
696 Ga0496100_0050911
697 Ga0496100_0094162
698 Ga0496102_0147833
699 Ga0496103_0215191
700 Ga0496104_0097216
701 Ga0496105_0433476
702 Ga0496106_0590145
703 Ga0496108_0031062
704 Ga0496108_0082525
705 Ga0496109_0027796
706 Ga0496109_0153131
707 Ga0496109_0296397
708 Ga0496110_0110473
709 Ga0496110_0406756
710 Ga0496110_0797014
711 Ga0496111_0034816
712 Ga0496112_0020988
713 Ga0496112_0054717
714 Ga0496112_0089328
715 Ga0496112_0147810
716 Ga0496112_0240711
717 Ga0496113_0106392
718 Ga0496113_0582596
719 Ga0496115_0027095
720 nmdc:mga08y16_315744_c1
721 nmdc:mga08y16_390130_c1
722 nmdc:mga0n895_139249_c1
723 nmdc:mga0rr50_475859_c1
724 nmdc:mga0a205_177192_c1
725 Ga0495601_0003213
726 Ga0495595_0160753
727 Ga0495595_0214120
728 Ga0495619_0228066

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01569

PAP2

PAP2 superfamily

53

193

0.92

PF14378

PAP2_3

PAP2 superfamily

6

184

0.62

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qvw-assembly1.cif.gz_AAA r396w mutant of the vanadium-dependent bromoperoxidase from corallina pilulifera 0.8805 120 185
7qyy-assembly1.cif.gz_AAA vanadium-dependent bromoperoxidase from corallina pilulifera in complex with chloride 0.8671 120 185
1qhb-assembly1.cif.gz_A vanadium bromoperoxidase from red alga corallina officinalis 0.8663 120 185
5lpc-assembly1.cif.gz_A crystal structure of vanadium-dependent haloperoxidase from a. marina 0.8136 120 185
4cit-assembly1.cif.gz_A crystal structure of the first bacterial vanadium dependant iodoperoxidase 0.7815 124 185
ID Description Score Start End Superfamily
1qhbF00 Mainly Alpha;Orthogonal Bundle;Vanadium-containing Chloroperoxidase; domain 2;Vanadium-containing Chloroperoxidase, domain 2 0.8648 120 185 1.10.606.10
5lpcA00 Mainly Alpha;Orthogonal Bundle;Vanadium-containing Chloroperoxidase; domain 2;Vanadium-containing Chloroperoxidase, domain 2 0.8136 120 185 1.10.606.10
af_Q66H88_95_284_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.7103 2 183 1.20.144.10
2ipbA00 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.7047 111 185 1.20.144.10
af_A0A0N7KFG1_1_446_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.6939 91 197 1.20.144.10
ID Description Score Start End GO Terms
AF-A0A2V6JJZ6-F1-model_v4 Phosphatidic acid phosphatase type 2/haloperoxidase domain-containing protein 0.9523 1 210 GO:0008610
GO:0016020
GO:0016787
GO:1901137
AF-A0A2V6KJ01-F1-model_v4 Phosphatidic acid phosphatase type 2/haloperoxidase domain-containing protein 0.9401 1 214 GO:0008610
GO:0016020
GO:0016787
GO:1901137
AF-A0A7W1P3B0-F1-model_v4 Phosphatase PAP2 family protein 0.9337 25 209 GO:0008610
GO:0016020
GO:0016787
GO:1901137
AF-A0A2A2XYR5-F1-model_v4 Phosphatidic acid phosphatase type 2/haloperoxidase domain-containing protein 0.9312 1 210 GO:0008610
GO:0016020
GO:0016787
GO:1901137
AF-A0A2V6KJ01-F1-model_v4 Phosphatidic acid phosphatase type 2/haloperoxidase domain-containing protein 0.9276 1 214 GO:0008610
GO:0016020
GO:0016787
GO:1901137

Map