F423122

General Info

Members Datasets Scaffolds Average Seq Length
363 215 726 136

Family's Representative Sequence

Representative Sequence 3300049590|Ga0501074_0311050|Ga0501074_0311050_343_741
Length 132
Sequence VAFDEKAFFNEKPENRPARYQCPRCKRTNDYSIRWMRRTKRKDRQPQGGEDRAKFDKLRDHLLRLDDEVTCKTCGKKFEVPSHHSLLFTDQLEGLPKDEDAEAAEAEAPPEQPIDRAKLPARFTRPTKGWRG

Samples

Sample ID Description Type Environment
1 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
131 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
132 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
175 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
189 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
190 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
191 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
197 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 3.86
Rhizosphere 95.04
Stem 0
Stem Tuber 0
Unclassified 36.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501074_0311050 3300049590 Bacteria 1119
2 MRS1b_contig_5347530 2162886011 Bacteria 1492
3 Ga0065712_10068188 3300005290 Bacteria 13327
4 Ga0065712_10076868 3300005290 Bacteria 3588
5 Ga0065712_10082472 3300005290 Bacteria 2913
6 Ga0065715_10280849 3300005293 Unclassified 1087
7 Ga0065715_10769455 3300005293 Bacteria 622
8 Ga0070683_100015627 3300005329 Bacteria 6673
9 Ga0070683_100298087 3300005329 Bacteria 1533
10 Ga0070683_100550441 3300005329 Bacteria 1103
11 Ga0070670_100018905 3300005331 Bacteria 5909
12 Ga0070670_100030155 3300005331 Bacteria 4671
13 Ga0070670_100042973 3300005331 Unclassified 3886
14 Ga0068869_100126786 3300005334 Bacteria 1958
15 Ga0070666_10117223 3300005335 Bacteria 1844
16 Ga0070661_100035167 3300005344 Bacteria 3637
17 Ga0070661_100096177 3300005344 Bacteria 2197
18 Ga0070661_100252150 3300005344 Bacteria 1362
19 Ga0070675_100629341 3300005354 Unclassified 974
20 Ga0070675_102232564 3300005354 Unclassified 504
21 Ga0070671_101647439 3300005355 Bacteria 569
22 Ga0070674_100030336 3300005356 Bacteria 3571
23 Ga0070674_100157326 3300005356 Bacteria 1721
24 Ga0070674_100976474 3300005356 Unclassified 742
25 Ga0070673_100232630 3300005364 Bacteria 1599
26 Ga0070673_101662248 3300005364 Bacteria 604
27 Ga0070688_100495880 3300005365 Unclassified 920
28 Ga0070659_100462738 3300005366 Bacteria 1077
29 Ga0070659_100511706 3300005366 Unclassified 1024
30 Ga0070659_101880071 3300005366 Unclassified 537
31 Ga0070667_100687487 3300005367 Bacteria 946
32 Ga0070713_100020345 3300005436 Bacteria 5087
33 Ga0070701_10303402 3300005438 Bacteria 982
34 Ga0070711_100291243 3300005439 Bacteria 1295
35 Ga0070694_100468042 3300005444 Unclassified 998
36 Ga0070694_101027510 3300005444 Unclassified 685
37 Ga0070663_100013589 3300005455 Bacteria 5196
38 Ga0070663_100880863 3300005455 Unclassified 772
39 Ga0070678_100131938 3300005456 Unclassified 1986
40 Ga0070678_100315623 3300005456 Unclassified 1333
41 Ga0070678_100486527 3300005456 Bacteria 1087
42 Ga0070662_100028999 3300005457 Bacteria 3858
43 Ga0070662_101410175 3300005457 Unclassified 600
44 Ga0070681_11070583 3300005458 Unclassified 727
45 Ga0068867_100727698 3300005459 Bacteria 878
46 Ga0070698_100447755 3300005471 Bacteria 1227
47 Ga0070699_100451346 3300005518 Bacteria 1166
48 Ga0070679_100087437 3300005530 Unclassified 3104
49 Ga0070684_100004242 3300005535 Bacteria 10860
50 Ga0070684_100358867 3300005535 Bacteria 1341
51 Ga0070684_100421119 3300005535 Unclassified 1233
52 Ga0070697_100743108 3300005536 Bacteria 867
53 Ga0068853_102450742 3300005539 Unclassified 505
54 Ga0070672_100162043 3300005543 Unclassified 1856
55 Ga0070665_100747858 3300005548 Bacteria 991
56 Ga0068855_100141060 3300005563 Bacteria 2747
57 Ga0068855_100441350 3300005563 Unclassified 1421
58 Ga0068855_102056417 3300005563 Unclassified 576
59 Ga0070664_100001086 3300005564 Bacteria 21433
60 Ga0070664_100006762 3300005564 Bacteria 9248
61 Ga0070664_100893472 3300005564 Unclassified 833
62 Ga0068857_100037895 3300005577 Unclassified 4271
63 Ga0068856_100137996 3300005614 Bacteria 2445
64 Ga0068852_100909596 3300005616 Bacteria 897
65 Ga0068852_101513009 3300005616 Bacteria 693
66 Ga0068864_100159579 3300005618 Unclassified 2049
67 Ga0068861_101353873 3300005719 Unclassified 694
68 Ga0068863_100658292 3300005841 Unclassified 1039
69 Ga0068860_100084276 3300005843 Unclassified 3024
70 Ga0070717_10292658 3300006028 Bacteria 1446
71 Ga0070712_101441463 3300006175 Unclassified 601
72 Ga0075367_10003825 3300006178 Bacteria 7258
73 Ga0075367_10838645 3300006178 Bacteria 586
74 Ga0075366_10433619 3300006195 Bacteria 810
75 Ga0075428_100024193 3300006844 Bacteria 6718
76 Ga0075428_100024272 3300006844 Bacteria 6708
77 Ga0075428_100124251 3300006844 Unclassified 2809
78 Ga0075428_102747035 3300006844 Unclassified 501
79 Ga0075430_100008697 3300006846 Bacteria 8567
80 Ga0075430_100048411 3300006846 Unclassified 3589
81 Ga0075430_100053212 3300006846 Bacteria 3409
82 Ga0075430_100616646 3300006846 Bacteria 895
83 Ga0075431_100051681 3300006847 Bacteria 4238
84 Ga0075431_100060744 3300006847 Bacteria 3900
85 Ga0075431_100062178 3300006847 Bacteria 3853
86 Ga0075431_100134802 3300006847 Unclassified 2546
87 Ga0075431_100751054 3300006847 Bacteria 951
88 Ga0075431_101248404 3300006847 Unclassified 705
89 Ga0075433_10038102 3300006852 Bacteria 4150
90 Ga0075433_10134345 3300006852 Bacteria 2199
91 Ga0075434_100040493 3300006871 Bacteria 4613
92 Ga0075434_100265893 3300006871 Bacteria 1734
93 Ga0075434_102081901 3300006871 Unclassified 572
94 Ga0075429_100241650 3300006880 Bacteria 1582
95 Ga0075429_100362706 3300006880 Unclassified 1269
96 Ga0075429_100905654 3300006880 Unclassified 772
97 Ga0075429_101212675 3300006880 Unclassified 659
98 Ga0068865_100525565 3300006881 Unclassified 990
99 Ga0068865_100963857 3300006881 Unclassified 745
100 Ga0105240_10502685 3300009093 Bacteria 1348
101 Ga0105240_10621858 3300009093 Unclassified 1187
102 Ga0105240_10805062 3300009093 Bacteria 1017
103 Ga0111539_10091795 3300009094 Bacteria 3568
104 Ga0111539_10735932 3300009094 Unclassified 1148
105 Ga0105245_11355813 3300009098 Unclassified 761
106 Ga0114129_10009217 3300009147 Bacteria 14075
107 Ga0114129_10019399 3300009147 Bacteria 9683
108 Ga0114129_10023141 3300009147 Bacteria 8813
109 Ga0114129_10040984 3300009147 Bacteria 6526
110 Ga0114129_10137867 3300009147 Bacteria 3347
111 Ga0114129_10279839 3300009147 Bacteria 2229
112 Ga0114129_10842354 3300009147 Bacteria 1167
113 Ga0105241_10866922 3300009174 Bacteria 836
114 Ga0105241_11307988 3300009174 Unclassified 691
115 Ga0105248_10062398 3300009177 Bacteria 4185
116 Ga0105249_11381379 3300009553 Unclassified 776
117 Ga0105246_11340552 3300011119 Unclassified 665
118 Ga0157373_11280769 3300013100 Unclassified 554
119 Ga0157370_10456872 3300013104 Bacteria 1174
120 Ga0157370_10604170 3300013104 Bacteria 1004
121 Ga0157369_10302175 3300013105 Bacteria 1664
122 Ga0157369_11363607 3300013105 Unclassified 722
123 Ga0157372_10550643 3300013307 Bacteria 1345
124 Ga0157372_11633565 3300013307 Unclassified 742
125 Ga0163163_10002751 3300014325 Bacteria 14839
126 Ga0157380_10107923 3300014326 Unclassified 2332
127 Ga0157380_11036245 3300014326 Unclassified 856
128 Ga0157380_12013164 3300014326 Bacteria 639
129 Ga0157379_10083653 3300014968 Bacteria 2860
130 Ga0224712_10173695 3300022467 Unclassified 968
131 Ga0207697_10011186 3300025315 Bacteria 3802
132 Ga0207680_10099510 3300025903 Bacteria 1866
133 Ga0207699_10042589 3300025906 Bacteria 2632
134 Ga0207654_10693097 3300025911 Bacteria 731
135 Ga0207707_10544179 3300025912 Bacteria 987
136 Ga0207695_10885087 3300025913 Unclassified 773
137 Ga0207660_10067067 3300025917 Unclassified 2598
138 Ga0207649_10006549 3300025920 Bacteria 6326
139 Ga0207649_10320421 3300025920 Bacteria 1139
140 Ga0207652_10083147 3300025921 Unclassified 2803
141 Ga0207646_11516377 3300025922 Unclassified 580
142 Ga0207681_10136519 3300025923 Bacteria 1821
143 Ga0207650_10011796 3300025925 Bacteria 6025
144 Ga0207650_10062513 3300025925 Unclassified 2782
145 Ga0207650_10465299 3300025925 Bacteria 1054
146 Ga0207659_10558176 3300025926 Unclassified 974
147 Ga0207700_10020437 3300025928 Bacteria 4498
148 Ga0207644_11187608 3300025931 Bacteria 641
149 Ga0207690_10203536 3300025932 Unclassified 1505
150 Ga0207706_10029652 3300025933 Bacteria 4883
151 Ga0207669_10023372 3300025937 Bacteria 3301
152 Ga0207669_10273870 3300025937 Bacteria 1269
153 Ga0207669_10633325 3300025937 Bacteria 873
154 Ga0207691_10234726 3300025940 Bacteria 1587
155 Ga0207691_10267754 3300025940 Bacteria 1472
156 Ga0207711_10036246 3300025941 Bacteria 4185
157 Ga0207711_10270266 3300025941 Bacteria 1564
158 Ga0207661_10006843 3300025944 Bacteria 8079
159 Ga0207661_10129320 3300025944 Bacteria 2161
160 Ga0207661_10615873 3300025944 Unclassified 997
161 Ga0207679_10024688 3300025945 Unclassified 4124
162 Ga0207679_10029328 3300025945 Bacteria 3829
163 Ga0207679_10226714 3300025945 Bacteria 1575
164 Ga0207679_10538956 3300025945 Bacteria 1046
165 Ga0207679_11077442 3300025945 Bacteria 737
166 Ga0207667_10117000 3300025949 Bacteria 2747
167 Ga0207667_10771040 3300025949 Unclassified 960
168 Ga0207667_11872631 3300025949 Unclassified 562
169 Ga0207651_10043328 3300025960 Bacteria 3003
170 Ga0207712_11351611 3300025961 Unclassified 637
171 Ga0207668_10122606 3300025972 Bacteria 1971
172 Ga0207640_11861057 3300025981 Unclassified 544
173 Ga0207658_10514803 3300025986 Bacteria 1067
174 Ga0207678_10044278 3300026067 Bacteria 3850
175 Ga0207702_10128610 3300026078 Bacteria 2277
176 Ga0207641_10132150 3300026088 Bacteria 2243
177 Ga0207676_10298757 3300026095 Unclassified 1469
178 Ga0207674_10049455 3300026116 Bacteria 4299
179 Ga0207683_10049003 3300026121 Bacteria 3697
180 Ga0207683_10428501 3300026121 Bacteria 1219
181 Ga0209983_1101755 3300027665 Unclassified 651
182 Ga0268266_10170513 3300028379 Bacteria 1975
183 Ga0268264_10457520 3300028381 Bacteria 1238
184 Ga0307408_100068915 3300031548 Unclassified 2606
185 Ga0307408_100202310 3300031548 Unclassified 1608
186 Ga0265313_10217483 3300031595 Bacteria 789
187 Ga0307413_10509314 3300031824 Unclassified 968
188 Ga0307413_10914078 3300031824 Bacteria 746
189 Ga0307410_11815266 3300031852 Unclassified 542
190 Ga0307406_10174458 3300031901 Unclassified 1559
191 Ga0307407_10096857 3300031903 Unclassified 1822
192 Ga0307412_10238183 3300031911 Unclassified 1406
193 Ga0307412_10507094 3300031911 Bacteria 1005
194 Ga0307409_100103083 3300031995 Unclassified 2372
195 Ga0307409_100141444 3300031995 Bacteria 2074
196 Ga0307416_100133190 3300032002 Unclassified 2242
197 Ga0307416_100184703 3300032002 Unclassified 1958
198 Ga0307416_101228592 3300032002 Bacteria 855
199 Ga0307411_10282170 3300032005 Unclassified 1322
200 Ga0307411_10791407 3300032005 Bacteria 834
201 Ga0307415_100099880 3300032126 Bacteria 2125
202 Ga0373945_0090953 3300035116 Unclassified 1181
203 Ga0373956_0208730 3300035119 Unclassified 926
204 Ga0373957_0053150 3300035120 Bacteria 1554
205 Ga0373957_0339757 3300035120 Unclassified 640
206 Ga0373943_0005046 3300035170 Bacteria 5954
207 Ga0373943_0268348 3300035170 Unclassified 962
208 Ga0373946_0010714 3300035171 Bacteria 3403
209 Ga0373955_0053954 3300035172 Bacteria 2196
210 Ga0373955_0183232 3300035172 Unclassified 1243
211 Ga0373924_0003722 3300035410 Bacteria 5268
212 Ga0373935_0008442 3300035692 Bacteria 6164
213 Ga0373927_0233114 3300035695 Bacteria 1210
214 Ga0373933_0170524 3300035724 Bacteria 1384
215 Ga0373933_0179882 3300035724 Unclassified 1349
216 Ga0373937_0055686 3300036401 Bacteria 3631
217 Ga0373937_0059771 3300036401 Bacteria 3503
218 Ga0373937_0262534 3300036401 Bacteria 1629
219 Ga0373937_0349782 3300036401 Unclassified 1400
220 Ga0373925_0008837 3300037068 Bacteria 7339
221 Ga0373925_0092078 3300037068 Bacteria 2319
222 Ga0439461_0228900 3300041410 Unclassified 509
223 Ga0451802_0780775 3300041460 Unclassified 994
224 Ga0439433_0019807 3300041999 Bacteria 1500
225 Ga0451577_0009110 3300042876 Bacteria 9579
226 Ga0451577_0133582 3300042876 Bacteria 2227
227 Ga0451577_0530657 3300042876 Unclassified 1069
228 Ga0453684_0092127 3300044712 Unclassified 3738
229 Ga0495603_0552948 3300046455 Unclassified 659
230 Ga0495629_0203723 3300046459 Bacteria 1368
231 Ga0495638_0265688 3300046460 Unclassified 939
232 Ga0495580_0314039 3300046472 Bacteria 1066
233 Ga0495662_0559462 3300046476 Bacteria 560
234 Ga0495664_0143858 3300046477 Bacteria 1446
235 Ga0495608_0010425 3300046511 Bacteria 6486
236 Ga0495608_0582138 3300046511 Unclassified 673
237 Ga0495618_0331123 3300046514 Unclassified 942
238 Ga0495618_0491503 3300046514 Bacteria 741
239 Ga0495628_0228227 3300046516 Bacteria 1396
240 Ga0495628_0247753 3300046516 Bacteria 1331
241 Ga0495630_0316122 3300046517 Unclassified 1194
242 Ga0495630_1208836 3300046517 Unclassified 571
243 Ga0495652_0046665 3300046529 Unclassified 3718
244 Ga0495640_0506526 3300046533 Bacteria 734
245 Ga0495586_0058929 3300046535 Bacteria 2086
246 Ga0495586_0232188 3300046535 Bacteria 1050
247 Ga0495645_0151251 3300046543 Unclassified 1612
248 Ga0495667_0023481 3300046559 Bacteria 4155
249 Ga0495667_0198300 3300046559 Bacteria 1285
250 Ga0495668_0198106 3300046616 Bacteria 1100
251 Ga0495634_0307752 3300046642 Bacteria 957
252 Ga0495599_0284879 3300046678 Bacteria 1000
253 Ga0495647_0034158 3300046681 Bacteria 1904
254 Ga0495647_0259752 3300046681 Bacteria 775
255 Ga0495658_0322939 3300046683 Bacteria 978
256 Ga0495669_0032642 3300046684 Unclassified 2290
257 Ga0495613_0007772 3300046689 Bacteria 7978
258 Ga0495613_0386894 3300046689 Bacteria 956
259 Ga0495600_0307118 3300046809 Unclassified 1000
260 Ga0495604_0583277 3300047317 Bacteria 718
261 Ga0495674_0041391 3300047319 Bacteria 4116
262 Ga0495674_0092817 3300047319 Bacteria 2577
263 Ga0495680_0918577 3300047322 Unclassified 564
264 Ga0495675_0649785 3300047444 Bacteria 594
265 Ga0495684_0001782 3300047471 Bacteria 17266
266 Ga0495684_0620744 3300047471 Bacteria 727
267 Ga0495602_0466326 3300048088 Unclassified 889
268 Ga0495614_0513636 3300048089 Bacteria 571
269 Ga0496104_0037896 3300048907 Bacteria 4508
270 Ga0496104_0543425 3300048907 Unclassified 1073
271 Ga0496105_0011184 3300048908 Bacteria 7079
272 Ga0496108_0007642 3300048911 Bacteria 8753
273 Ga0496109_0000593 3300048912 Bacteria 30294
274 Ga0496109_0906942 3300048912 Bacteria 819
275 Ga0496110_0006164 3300048913 Bacteria 9459
276 Ga0496110_0729597 3300048913 Bacteria 893
277 Ga0496111_0008103 3300048914 Bacteria 6939
278 Ga0496112_0002551 3300048915 Bacteria 14712
279 Ga0496113_0102084 3300048916 Unclassified 2224
280 Ga0496113_0109731 3300048916 Unclassified 2146
281 Ga0496114_0123355 3300048917 Unclassified 2230
282 Ga0501292_004397 3300049515 Bacteria 1928
283 Ga0501302_003141 3300049525 Bacteria 959
284 Ga0501036_0058821 3300049572 Bacteria 3257
285 Ga0501036_0338794 3300049572 Bacteria 1256
286 Ga0501041_1095334 3300049577 Unclassified 513
287 Ga0501042_0510705 3300049578 Bacteria 873
288 Ga0501043_0508608 3300049579 Unclassified 899
289 Ga0501046_0778314 3300049580 Unclassified 671
290 Ga0501048_0701084 3300049582 Unclassified 727
291 Ga0501071_0556428 3300049587 Unclassified 881
292 Ga0501072_0049857 3300049588 Bacteria 3296
293 Ga0501072_0176578 3300049588 Bacteria 1704
294 Ga0501072_0545781 3300049588 Bacteria 916
295 Ga0501073_0000430 3300049589 Bacteria 28781
296 Ga0501074_0278855 3300049590 Unclassified 1188
297 Ga0501074_0881478 3300049590 Unclassified 630
298 Ga0501075_0096393 3300049591 Bacteria 2245
299 Ga0501075_0105305 3300049591 Bacteria 2144
300 Ga0501075_0132966 3300049591 Bacteria 1895
301 Ga0501075_0549523 3300049591 Bacteria 881
302 Ga0501076_0040034 3300049592 Unclassified 3682
303 Ga0501076_0163517 3300049592 Bacteria 1814
304 Ga0501076_0385850 3300049592 Unclassified 1151
305 Ga0501076_0959441 3300049592 Bacteria 705
306 Ga0501076_0960269 3300049592 Bacteria 704
307 Ga0501077_0081149 3300049593 Bacteria 2054
308 Ga0501077_0449599 3300049593 Unclassified 825
309 Ga0501230_044119 3300049667 Unclassified 871
310 Ga0501235_027631 3300049669 Unclassified 1273
311 Ga0501255_063057 3300049684 Unclassified 592
312 Ga0501234_013229 3300049707 Unclassified 1294
313 Ga0501079_0161511 3300049741 Bacteria 1747
314 Ga0501080_0306312 3300049742 Bacteria 1440
315 Ga0501081_0512335 3300049743 Bacteria 895
316 Ga0501081_0719603 3300049743 Unclassified 750
317 Ga0501083_0275641 3300049744 Bacteria 1094
318 Ga0501268_156693 3300049765 Bacteria 529
319 Ga0501276_022488 3300049773 Bacteria 613
320 Ga0501035_1472711 3300049822 Bacteria 520
321 Ga0501045_0024393 3300049824 Unclassified 4342
322 Ga0501045_0077781 3300049824 Bacteria 2445
323 Ga0501045_0287906 3300049824 Bacteria 1223
324 Ga0501212_080895 3300049851 Unclassified 588
325 nmdc:mga03683_508077_c1 3300050489 Bacteria 584
326 nmdc:mga05p37_150049_c1 3300050507 Unclassified 2852
327 nmdc:mga05p37_17162_c1 3300050507 Bacteria 8733
328 nmdc:mga05p37_554961_c1 3300050507 Bacteria 1307
329 nmdc:mga05p37_65147_c1 3300050507 Bacteria 4484
330 nmdc:mga05p37_664881_c1 3300050507 Unclassified 1164
331 nmdc:mga09592_168312_c1 3300050508 Bacteria 1894
332 nmdc:mga09592_281630_c1 3300050508 Bacteria 1442
333 nmdc:mga09592_50492_c1 3300050508 Unclassified 3508
334 nmdc:mga0qj67_198119_c1 3300050509 Bacteria 1632
335 nmdc:mga0qj67_40937_c1 3300050509 Bacteria 3643
336 nmdc:mga0qj67_56695_c1 3300050509 Unclassified 3106
337 nmdc:mga0qj67_572531_c1 3300050509 Bacteria 905
338 nmdc:mga06r32_1004720_c1 3300050510 Bacteria 787
339 nmdc:mga06r32_146578_c1 3300050510 Unclassified 2338
340 nmdc:mga06r32_37005_c1 3300050510 Bacteria 4616
341 nmdc:mga06r32_381365_c1 3300050510 Bacteria 1393
342 nmdc:mga06r32_504115_c1 3300050510 Bacteria 1187
343 nmdc:mga06r32_858254_c1 3300050510 Unclassified 866
344 nmdc:mga08y16_488883_c1 3300050511 Bacteria 1252
345 nmdc:mga08y16_692959_c1 3300050511 Bacteria 1019
346 nmdc:mga0n895_2095795_c1 3300050512 Unclassified 522
347 nmdc:mga0n895_3274_c1 3300050512 Bacteria 12998
348 nmdc:mga0a205_108825_c1 3300050515 Bacteria 2670
349 nmdc:mga0a205_67269_c1 3300050515 Bacteria 3461
350 Ga0495601_0021716 3300053077 Bacteria 3933
351 Ga0495601_0023945 3300053077 Unclassified 3756
352 Ga0495601_0046929 3300053077 Bacteria 2719
353 Ga0495601_0062075 3300053077 Bacteria 2373
354 Ga0495595_0041761 3300053084 Bacteria 2100
355 Ga0495619_0004381 3300053085 Bacteria 9003
356 Ga0495619_0048035 3300053085 Bacteria 2812
357 Ga0495619_0211013 3300053085 Unclassified 1345
358 Ga0501084_0038938 3300054114 Unclassified 3976
359 Ga0501084_0064401 3300054114 Unclassified 3068
360 Ga0501084_0339786 3300054114 Bacteria 1268
361 Ga0590071_070656 3300059421 Bacteria 860
362 Ga0501082_0883901 3300060353 Unclassified 782
363 Ga0530510_0088693 3300061734 Unclassified 2255
364 Ga0501074_0311050
365 MRS1b_contig_5347530
366 Ga0065712_10068188
367 Ga0065712_10076868
368 Ga0065712_10082472
369 Ga0065715_10280849
370 Ga0065715_10769455
371 Ga0070683_100015627
372 Ga0070683_100298087
373 Ga0070683_100550441
374 Ga0070670_100018905
375 Ga0070670_100030155
376 Ga0070670_100042973
377 Ga0068869_100126786
378 Ga0070666_10117223
379 Ga0070661_100035167
380 Ga0070661_100096177
381 Ga0070661_100252150
382 Ga0070675_100629341
383 Ga0070675_102232564
384 Ga0070671_101647439
385 Ga0070674_100030336
386 Ga0070674_100157326
387 Ga0070674_100976474
388 Ga0070673_100232630
389 Ga0070673_101662248
390 Ga0070688_100495880
391 Ga0070659_100462738
392 Ga0070659_100511706
393 Ga0070659_101880071
394 Ga0070667_100687487
395 Ga0070713_100020345
396 Ga0070701_10303402
397 Ga0070711_100291243
398 Ga0070694_100468042
399 Ga0070694_101027510
400 Ga0070663_100013589
401 Ga0070663_100880863
402 Ga0070678_100131938
403 Ga0070678_100315623
404 Ga0070678_100486527
405 Ga0070662_100028999
406 Ga0070662_101410175
407 Ga0070681_11070583
408 Ga0068867_100727698
409 Ga0070698_100447755
410 Ga0070699_100451346
411 Ga0070679_100087437
412 Ga0070684_100004242
413 Ga0070684_100358867
414 Ga0070684_100421119
415 Ga0070697_100743108
416 Ga0068853_102450742
417 Ga0070672_100162043
418 Ga0070665_100747858
419 Ga0068855_100141060
420 Ga0068855_100441350
421 Ga0068855_102056417
422 Ga0070664_100001086
423 Ga0070664_100006762
424 Ga0070664_100893472
425 Ga0068857_100037895
426 Ga0068856_100137996
427 Ga0068852_100909596
428 Ga0068852_101513009
429 Ga0068864_100159579
430 Ga0068861_101353873
431 Ga0068863_100658292
432 Ga0068860_100084276
433 Ga0070717_10292658
434 Ga0070712_101441463
435 Ga0075367_10003825
436 Ga0075367_10838645
437 Ga0075366_10433619
438 Ga0075428_100024193
439 Ga0075428_100024272
440 Ga0075428_100124251
441 Ga0075428_102747035
442 Ga0075430_100008697
443 Ga0075430_100048411
444 Ga0075430_100053212
445 Ga0075430_100616646
446 Ga0075431_100051681
447 Ga0075431_100060744
448 Ga0075431_100062178
449 Ga0075431_100134802
450 Ga0075431_100751054
451 Ga0075431_101248404
452 Ga0075433_10038102
453 Ga0075433_10134345
454 Ga0075434_100040493
455 Ga0075434_100265893
456 Ga0075434_102081901
457 Ga0075429_100241650
458 Ga0075429_100362706
459 Ga0075429_100905654
460 Ga0075429_101212675
461 Ga0068865_100525565
462 Ga0068865_100963857
463 Ga0105240_10502685
464 Ga0105240_10621858
465 Ga0105240_10805062
466 Ga0111539_10091795
467 Ga0111539_10735932
468 Ga0105245_11355813
469 Ga0114129_10009217
470 Ga0114129_10019399
471 Ga0114129_10023141
472 Ga0114129_10040984
473 Ga0114129_10137867
474 Ga0114129_10279839
475 Ga0114129_10842354
476 Ga0105241_10866922
477 Ga0105241_11307988
478 Ga0105248_10062398
479 Ga0105249_11381379
480 Ga0105246_11340552
481 Ga0157373_11280769
482 Ga0157370_10456872
483 Ga0157370_10604170
484 Ga0157369_10302175
485 Ga0157369_11363607
486 Ga0157372_10550643
487 Ga0157372_11633565
488 Ga0163163_10002751
489 Ga0157380_10107923
490 Ga0157380_11036245
491 Ga0157380_12013164
492 Ga0157379_10083653
493 Ga0224712_10173695
494 Ga0207697_10011186
495 Ga0207680_10099510
496 Ga0207699_10042589
497 Ga0207654_10693097
498 Ga0207707_10544179
499 Ga0207695_10885087
500 Ga0207660_10067067
501 Ga0207649_10006549
502 Ga0207649_10320421
503 Ga0207652_10083147
504 Ga0207646_11516377
505 Ga0207681_10136519
506 Ga0207650_10011796
507 Ga0207650_10062513
508 Ga0207650_10465299
509 Ga0207659_10558176
510 Ga0207700_10020437
511 Ga0207644_11187608
512 Ga0207690_10203536
513 Ga0207706_10029652
514 Ga0207669_10023372
515 Ga0207669_10273870
516 Ga0207669_10633325
517 Ga0207691_10234726
518 Ga0207691_10267754
519 Ga0207711_10036246
520 Ga0207711_10270266
521 Ga0207661_10006843
522 Ga0207661_10129320
523 Ga0207661_10615873
524 Ga0207679_10024688
525 Ga0207679_10029328
526 Ga0207679_10226714
527 Ga0207679_10538956
528 Ga0207679_11077442
529 Ga0207667_10117000
530 Ga0207667_10771040
531 Ga0207667_11872631
532 Ga0207651_10043328
533 Ga0207712_11351611
534 Ga0207668_10122606
535 Ga0207640_11861057
536 Ga0207658_10514803
537 Ga0207678_10044278
538 Ga0207702_10128610
539 Ga0207641_10132150
540 Ga0207676_10298757
541 Ga0207674_10049455
542 Ga0207683_10049003
543 Ga0207683_10428501
544 Ga0209983_1101755
545 Ga0268266_10170513
546 Ga0268264_10457520
547 Ga0307408_100068915
548 Ga0307408_100202310
549 Ga0265313_10217483
550 Ga0307413_10509314
551 Ga0307413_10914078
552 Ga0307410_11815266
553 Ga0307406_10174458
554 Ga0307407_10096857
555 Ga0307412_10238183
556 Ga0307412_10507094
557 Ga0307409_100103083
558 Ga0307409_100141444
559 Ga0307416_100133190
560 Ga0307416_100184703
561 Ga0307416_101228592
562 Ga0307411_10282170
563 Ga0307411_10791407
564 Ga0307415_100099880
565 Ga0373945_0090953
566 Ga0373956_0208730
567 Ga0373957_0053150
568 Ga0373957_0339757
569 Ga0373943_0005046
570 Ga0373943_0268348
571 Ga0373946_0010714
572 Ga0373955_0053954
573 Ga0373955_0183232
574 Ga0373924_0003722
575 Ga0373935_0008442
576 Ga0373927_0233114
577 Ga0373933_0170524
578 Ga0373933_0179882
579 Ga0373937_0055686
580 Ga0373937_0059771
581 Ga0373937_0262534
582 Ga0373937_0349782
583 Ga0373925_0008837
584 Ga0373925_0092078
585 Ga0439461_0228900
586 Ga0451802_0780775
587 Ga0439433_0019807
588 Ga0451577_0009110
589 Ga0451577_0133582
590 Ga0451577_0530657
591 Ga0453684_0092127
592 Ga0495603_0552948
593 Ga0495629_0203723
594 Ga0495638_0265688
595 Ga0495580_0314039
596 Ga0495662_0559462
597 Ga0495664_0143858
598 Ga0495608_0010425
599 Ga0495608_0582138
600 Ga0495618_0331123
601 Ga0495618_0491503
602 Ga0495628_0228227
603 Ga0495628_0247753
604 Ga0495630_0316122
605 Ga0495630_1208836
606 Ga0495652_0046665
607 Ga0495640_0506526
608 Ga0495586_0058929
609 Ga0495586_0232188
610 Ga0495645_0151251
611 Ga0495667_0023481
612 Ga0495667_0198300
613 Ga0495668_0198106
614 Ga0495634_0307752
615 Ga0495599_0284879
616 Ga0495647_0034158
617 Ga0495647_0259752
618 Ga0495658_0322939
619 Ga0495669_0032642
620 Ga0495613_0007772
621 Ga0495613_0386894
622 Ga0495600_0307118
623 Ga0495604_0583277
624 Ga0495674_0041391
625 Ga0495674_0092817
626 Ga0495680_0918577
627 Ga0495675_0649785
628 Ga0495684_0001782
629 Ga0495684_0620744
630 Ga0495602_0466326
631 Ga0495614_0513636
632 Ga0496104_0037896
633 Ga0496104_0543425
634 Ga0496105_0011184
635 Ga0496108_0007642
636 Ga0496109_0000593
637 Ga0496109_0906942
638 Ga0496110_0006164
639 Ga0496110_0729597
640 Ga0496111_0008103
641 Ga0496112_0002551
642 Ga0496113_0102084
643 Ga0496113_0109731
644 Ga0496114_0123355
645 Ga0501292_004397
646 Ga0501302_003141
647 Ga0501036_0058821
648 Ga0501036_0338794
649 Ga0501041_1095334
650 Ga0501042_0510705
651 Ga0501043_0508608
652 Ga0501046_0778314
653 Ga0501048_0701084
654 Ga0501071_0556428
655 Ga0501072_0049857
656 Ga0501072_0176578
657 Ga0501072_0545781
658 Ga0501073_0000430
659 Ga0501074_0278855
660 Ga0501074_0881478
661 Ga0501075_0096393
662 Ga0501075_0105305
663 Ga0501075_0132966
664 Ga0501075_0549523
665 Ga0501076_0040034
666 Ga0501076_0163517
667 Ga0501076_0385850
668 Ga0501076_0959441
669 Ga0501076_0960269
670 Ga0501077_0081149
671 Ga0501077_0449599
672 Ga0501230_044119
673 Ga0501235_027631
674 Ga0501255_063057
675 Ga0501234_013229
676 Ga0501079_0161511
677 Ga0501080_0306312
678 Ga0501081_0512335
679 Ga0501081_0719603
680 Ga0501083_0275641
681 Ga0501268_156693
682 Ga0501276_022488
683 Ga0501035_1472711
684 Ga0501045_0024393
685 Ga0501045_0077781
686 Ga0501045_0287906
687 Ga0501212_080895
688 nmdc:mga03683_508077_c1
689 nmdc:mga05p37_150049_c1
690 nmdc:mga05p37_17162_c1
691 nmdc:mga05p37_554961_c1
692 nmdc:mga05p37_65147_c1
693 nmdc:mga05p37_664881_c1
694 nmdc:mga09592_168312_c1
695 nmdc:mga09592_281630_c1
696 nmdc:mga09592_50492_c1
697 nmdc:mga0qj67_198119_c1
698 nmdc:mga0qj67_40937_c1
699 nmdc:mga0qj67_56695_c1
700 nmdc:mga0qj67_572531_c1
701 nmdc:mga06r32_1004720_c1
702 nmdc:mga06r32_146578_c1
703 nmdc:mga06r32_37005_c1
704 nmdc:mga06r32_381365_c1
705 nmdc:mga06r32_504115_c1
706 nmdc:mga06r32_858254_c1
707 nmdc:mga08y16_488883_c1
708 nmdc:mga08y16_692959_c1
709 nmdc:mga0n895_2095795_c1
710 nmdc:mga0n895_3274_c1
711 nmdc:mga0a205_108825_c1
712 nmdc:mga0a205_67269_c1
713 Ga0495601_0021716
714 Ga0495601_0023945
715 Ga0495601_0046929
716 Ga0495601_0062075
717 Ga0495595_0041761
718 Ga0495619_0004381
719 Ga0495619_0048035
720 Ga0495619_0211013
721 Ga0501084_0038938
722 Ga0501084_0064401
723 Ga0501084_0339786
724 Ga0590071_070656
725 Ga0501082_0883901
726 Ga0530510_0088693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rpp-assembly1.cif.gz_A crystal structure of pabcdc21-1 intein 0.5559 8 39
8fuv-assembly1.cif.gz_F pseudomonas phage e217 extended sheath and tail tube 0.5451 11 49
6t0u-assembly1.cif.gz_B bat influenza a polymerase product dissociation complex using 44-mer vrna template with intact oligo(u) sequence 0.5432 8 40
8oh4-assembly1.cif.gz_I subtomogram averaging structure of cofilactin filament inside microtubule lumen of drosophila s2 cell protrusion. 0.5294 8 57
4p2j-assembly1.cif.gz_A crystal structure of the mouse snx19 px domain with bound sulphate ion 0.4991 9 65
ID Description Score Start End Superfamily
6d04A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.6373 10 46 3.40.630.10
af_K7VF03_145_262_3.30.430.20 Alpha Beta;2-Layer Sandwich;Killer Toxin P4; Chain A;Gnk2 domain, C-X8-C-X2-C motif 0.6208 9 40 3.30.430.20
af_Q59K70_9_357_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.5597 8 48 3.40.50.1820
af_Q59008_1_255_3.60.70.12 Alpha Beta;4-Layer Sandwich;L-amino peptidase D-ALA esterase/amidase;L-amino peptidase D-ALA esterase/amidase 0.558 11 41 3.60.70.12
af_Q86AT9_168_273_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.5558 13 42 3.30.450.20
ID Description Score Start End GO Terms
AF-A0A7Y8HIS7-F1-model_v4 Uncharacterized protein 0.9595 3 89
AF-A0A7Y8HIS7-F1-model_v4 Uncharacterized protein 0.9188 3 89
AF-A0A2V8R5U6-F1-model_v4 Uncharacterized protein 0.9139 3 89
AF-A0A2V8R5U6-F1-model_v4 Uncharacterized protein 0.8949 3 89
AF-A0A2V8IGI9-F1-model_v4 Uncharacterized protein 0.8916 3 75

Map