F423082

General Info

Members Datasets Scaffolds Average Seq Length
363 125 279 330

Family's Representative Sequence

Representative Sequence 3300046674|Ga0495588_0152305|Ga0495588_0152305_103_1179
Length 358
Sequence MQEVKILKTIAKGCVMKKRLLLALVVGAAALRAQARIEPPPLPAAAQVDGAEEAPTRIIVEGRRPGPGVWKVSKGDHVMWIFGVYSPLPKKMEWDDSRVERLVKGSQELLMPPAFSAGLSGFGGFLRGLTALPSLIGLENNPDDATLHDVLPADVYARWTVAKQKYFGSGENLERLRPILVAERLKEAAYDKNGLSGNNEIIGRIVEIAQKNKVKKTFTGVSFVIKDPRGLLKDIKGSQMEDLACFTTTLDNIESELPAMHMGANAWANGNIAEIKKLDLSDRDLVCKDAVAASPAMRKAAGIDNLIEGLRQSWMVAAEKALGDNTSTFAILQLQNILGPDGALAALQAKGYTVESPK

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221684 Massilia sp. Root133 Isolate Unclassified
3 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
37 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
38 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
39 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
40 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
41 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
42 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
43 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
44 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
45 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
46 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
47 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
48 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
49 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
50 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
51 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
52 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
53 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
54 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
55 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
56 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
57 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
60 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
61 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
62 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
63 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
64 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
65 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
66 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
67 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
68 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
69 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
70 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
71 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
72 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
73 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
74 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
75 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
76 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
77 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
78 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
79 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
80 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
81 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
82 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
83 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
84 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
88 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
89 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
90 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
91 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
92 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
95 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
96 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
97 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
98 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
101 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
102 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
103 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
106 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
109 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
110 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
120 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
121 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
122 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
125 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.07
Metatranscriptomes 0
Isolates 1.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.48
Nodule 0
Rhizoplane 6.06
Rhizosphere 84.3
Stem 0
Stem Tuber 0
Unclassified 7.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10080794 3300003322 Bacteria 1694
2 rootL2_10080795 3300003322 Bacteria 2960
3 Ga0055525_1000081 3300003759 Bacteria 161329
4 Ga0065165_1013380 3300005262 Bacteria 3267
5 Ga0070658_10058984 3300005327 Bacteria 3125
6 Ga0070658_10293110 3300005327 Bacteria 1387
7 Ga0070660_100122439 3300005339 Bacteria 2076
8 Ga0070661_100188031 3300005344 Bacteria 1574
9 Ga0070661_100275558 3300005344 Bacteria 1304
10 Ga0070659_100005967 3300005366 Bacteria 8783
11 Ga0068867_100190647 3300005459 Bacteria 1636
12 Ga0068855_100101082 3300005563 Bacteria 3319
13 Ga0068855_100257738 3300005563 Bacteria 1944
14 Ga0068855_100348822 3300005563 Bacteria 1631
15 Ga0070664_100217069 3300005564 Bacteria 1710
16 Ga0068852_100066333 3300005616 Bacteria 3151
17 Ga0068852_100118913 3300005616 Bacteria 2415
18 Ga0105245_10091621 3300009098 Bacteria 2798
19 Ga0105243_10023840 3300009148 Bacteria 4663
20 Ga0105241_10005256 3300009174 Bacteria 9560
21 Ga0105242_10002503 3300009176 Bacteria 14409
22 Ga0105242_10067586 3300009176 Bacteria 2955
23 Ga0105237_10284445 3300009545 Bacteria 1656
24 Ga0157369_10417321 3300013105 Bacteria 1391
25 Ga0157378_10105823 3300013297 Bacteria 2573
26 Ga0157372_10289838 3300013307 Bacteria 1904
27 Ga0157372_10519522 3300013307 Bacteria 1388
28 Ga0157372_10543960 3300013307 Bacteria 1354
29 Ga0209563_100015 3300025230 Bacteria 879901
30 Ga0209677_102417 3300025253 Bacteria 7055
31 Ga0209148_1000552 3300025254 Bacteria 35546
32 Ga0207705_10008407 3300025909 Bacteria 7538
33 Ga0207654_10072552 3300025911 Bacteria 2050
34 Ga0207657_10012458 3300025919 Bacteria 8395
35 Ga0207657_10151063 3300025919 Bacteria 1892
36 Ga0207657_10156673 3300025919 Bacteria 1852
37 Ga0207690_10010494 3300025932 Bacteria 5508
38 Ga0207690_10062257 3300025932 Bacteria 2539
39 Ga0207706_10123117 3300025933 Bacteria 2281
40 Ga0207706_10326778 3300025933 Bacteria 1334
41 Ga0207686_10003569 3300025934 Bacteria 8348
42 Ga0207686_10065814 3300025934 Bacteria 2313
43 Ga0207709_10013206 3300025935 Bacteria 4556
44 Ga0207679_10046503 3300025945 Bacteria 3146
45 Ga0207679_10116302 3300025945 Bacteria 2120
46 Ga0207667_10204604 3300025949 Bacteria 2025
47 Ga0207667_10297946 3300025949 Bacteria 1647
48 Ga0207698_10020012 3300026142 Bacteria 4597
49 Ga0395899_0004694 3300037312 Bacteria 10666
50 Ga0395899_0005079 3300037312 Bacteria 10238
51 Ga0395899_0012522 3300037312 Bacteria 6499
52 Ga0395899_0134615 3300037312 Bacteria 1762
53 Ga0395899_0138627 3300037312 Bacteria 1732
54 Ga0395899_0190182 3300037312 Bacteria 1436
55 Ga0395899_0192763 3300037312 Bacteria 1425
56 Ga0395899_0277814 3300037312 Bacteria 1140
57 Ga0395900_0000846 3300037418 Bacteria 40292
58 Ga0395900_0002448 3300037418 Bacteria 20451
59 Ga0395900_0003969 3300037418 Bacteria 15788
60 Ga0395900_0004116 3300037418 Bacteria 15485
61 Ga0395900_0015576 3300037418 Bacteria 7750
62 Ga0395900_0046123 3300037418 Bacteria 4488
63 Ga0395900_0069899 3300037418 Bacteria 3609
64 Ga0395900_0087666 3300037418 Bacteria 3198
65 Ga0395900_0179187 3300037418 Bacteria 2154
66 Ga0395900_0183164 3300037418 Bacteria 2127
67 Ga0395900_0188074 3300037418 Bacteria 2095
68 Ga0395900_0221555 3300037418 Bacteria 1906
69 Ga0395900_0247189 3300037418 Bacteria 1786
70 Ga0395900_0303306 3300037418 Bacteria 1582
71 Ga0395900_0330953 3300037418 Bacteria 1501
72 Ga0395900_0468508 3300037418 Bacteria 1213
73 Ga0395898_0004127 3300037466 Bacteria 15931
74 Ga0395898_0078299 3300037466 Bacteria 3190
75 Ga0395898_0246058 3300037466 Bacteria 1705
76 Ga0395898_0328952 3300037466 Bacteria 1457
77 Ga0395898_0357554 3300037466 Bacteria 1392
78 Ga0395898_0759862 3300037466 Bacteria 910
79 Ga0395905_0017830 3300037471 Bacteria 6745
80 Ga0395905_0064092 3300037471 Bacteria 3438
81 Ga0395905_0067750 3300037471 Bacteria 3343
82 Ga0395905_0082667 3300037471 Bacteria 3009
83 Ga0395905_0137812 3300037471 Bacteria 2296
84 Ga0395905_0153940 3300037471 Bacteria 2162
85 Ga0395905_0164817 3300037471 Bacteria 2082
86 Ga0395905_0276380 3300037471 Bacteria 1565
87 Ga0395905_0391954 3300037471 Bacteria 1283
88 Ga0395901_0000730 3300038443 Bacteria 37345
89 Ga0395901_0009380 3300038443 Bacteria 9927
90 Ga0395901_0124030 3300038443 Bacteria 2714
91 Ga0395901_0201293 3300038443 Bacteria 2087
92 Ga0395901_0228905 3300038443 Bacteria 1941
93 Ga0395901_0229322 3300038443 Bacteria 1939
94 Ga0395901_0342860 3300038443 Bacteria 1543
95 Ga0395901_0361238 3300038443 Bacteria 1497
96 Ga0395901_0388460 3300038443 Bacteria 1435
97 Ga0439448_0004665 3300042005 Bacteria 3877
98 Ga0439448_0007925 3300042005 Bacteria 3094
99 Ga0439448_0023968 3300042005 Bacteria 1907
100 Ga0439448_0032222 3300042005 Bacteria 1667
101 Ga0439450_005259 3300042008 Bacteria 2267
102 Ga0439455_0001275 3300042012 Bacteria 4135
103 Ga0439455_0019552 3300042012 Bacteria 1598
104 Ga0439455_0026776 3300042012 Bacteria 1409
105 Ga0439458_0003074 3300042157 Bacteria 3977
106 Ga0439458_0017000 3300042157 Bacteria 1658
107 Ga0439458_0021184 3300042157 Bacteria 1503
108 Ga0466969_0023946 3300044656 Bacteria 3142
109 Ga0466969_0141182 3300044656 Bacteria 1113
110 Ga0466965_0003915 3300044683 Bacteria 6586
111 Ga0466965_0028711 3300044683 Bacteria 2703
112 Ga0466965_0037045 3300044683 Bacteria 2394
113 Ga0466965_0058056 3300044683 Bacteria 1929
114 Ga0466966_0005084 3300044684 Bacteria 8643
115 Ga0466966_0055522 3300044684 Bacteria 2506
116 Ga0466966_0062974 3300044684 Bacteria 2337
117 Ga0466966_0067587 3300044684 Bacteria 2244
118 Ga0466966_0116423 3300044684 Bacteria 1645
119 Ga0466961_0023268 3300044693 Bacteria 3986
120 Ga0466961_0141768 3300044693 Bacteria 1504
121 Ga0466963_0083438 3300044694 Bacteria 2167
122 Ga0466964_0000139 3300044706 Bacteria 19214
123 Ga0466964_0000376 3300044706 Bacteria 13535
124 Ga0466964_0032411 3300044706 Bacteria 2076
125 Ga0466971_0039667 3300044719 Bacteria 2113
126 Ga0466968_0000137 3300044735 Bacteria 21714
127 Ga0466970_0067035 3300044765 Bacteria 1927
128 Ga0466970_0246854 3300044765 Bacteria 1000
129 Ga0466957_0000409 3300044842 Bacteria 21013
130 Ga0466957_0044671 3300044842 Bacteria 2685
131 Ga0466957_0075742 3300044842 Bacteria 2088
132 Ga0466957_0097581 3300044842 Bacteria 1848
133 Ga0466957_0128936 3300044842 Bacteria 1618
134 Ga0466960_0063112 3300044901 Bacteria 1823
135 Ga0466960_0266982 3300044901 Bacteria 955
136 Ga0466959_0022445 3300045049 Bacteria 4666
137 Ga0466959_0051912 3300045049 Bacteria 3004
138 Ga0466959_0146261 3300045049 Bacteria 1667
139 Ga0466958_0032281 3300045836 Bacteria 3115
140 Ga0466967_0034201 3300045976 Bacteria 4311
141 Ga0466967_0052801 3300045976 Bacteria 3570
142 Ga0466967_0213986 3300045976 Bacteria 1829
143 Ga0495617_000134 3300046452 Bacteria 49612
144 Ga0495590_0000436 3300046457 Bacteria 20760
145 Ga0495590_0012160 3300046457 Bacteria 3200
146 Ga0495653_0018988 3300046463 Bacteria 5578
147 Ga0495653_0066485 3300046463 Bacteria 2712
148 Ga0495582_0012847 3300046473 Bacteria 4613
149 Ga0495605_0000317 3300046474 Bacteria 50604
150 Ga0495605_0006603 3300046474 Bacteria 6645
151 Ga0495605_0064554 3300046474 Bacteria 1743
152 Ga0495584_0001131 3300046491 Bacteria 16524
153 Ga0495584_0006971 3300046491 Bacteria 5903
154 Ga0495584_0009125 3300046491 Bacteria 5121
155 Ga0495584_0029540 3300046491 Bacteria 2779
156 Ga0495584_0070055 3300046491 Bacteria 1762
157 Ga0495585_0001454 3300046492 Bacteria 18604
158 Ga0495594_0009835 3300046499 Bacteria 4954
159 Ga0495596_0006629 3300046500 Bacteria 5307
160 Ga0495596_0050122 3300046500 Bacteria 1636
161 Ga0495607_0000409 3300046501 Bacteria 43547
162 Ga0495607_0049294 3300046501 Bacteria 2456
163 Ga0495607_0075238 3300046501 Bacteria 1871
164 Ga0495606_0055124 3300046507 Bacteria 2572
165 Ga0495616_0009817 3300046513 Bacteria 5573
166 Ga0495616_0016192 3300046513 Bacteria 4130
167 Ga0495616_0020930 3300046513 Bacteria 3552
168 Ga0495616_0073072 3300046513 Bacteria 1655
169 Ga0495631_0006570 3300046518 Bacteria 5990
170 Ga0495632_0000260 3300046519 Bacteria 52561
171 Ga0495643_0004134 3300046522 Bacteria 10319
172 Ga0495643_0046064 3300046522 Bacteria 2366
173 Ga0495644_0010933 3300046523 Bacteria 3497
174 Ga0495648_0015196 3300046524 Bacteria 5605
175 Ga0495666_0045089 3300046526 Bacteria 2127
176 Ga0495666_0109910 3300046526 Bacteria 1295
177 Ga0495642_0000512 3300046528 Bacteria 19986
178 Ga0495642_0041183 3300046528 Bacteria 1878
179 Ga0495642_0082389 3300046528 Bacteria 1356
180 Ga0495642_0115764 3300046528 Bacteria 1148
181 Ga0495665_0001979 3300046531 Bacteria 11075
182 Ga0495665_0021878 3300046531 Bacteria 3439
183 Ga0495587_0080609 3300046536 Bacteria 1886
184 Ga0495609_0000028 3300046538 Bacteria 219908
185 Ga0495597_0052570 3300046542 Bacteria 1793
186 Ga0495597_0073131 3300046542 Bacteria 1474
187 Ga0495645_0020572 3300046543 Bacteria 4765
188 Ga0495633_0004946 3300046558 Bacteria 8325
189 Ga0495633_0070862 3300046558 Bacteria 1626
190 Ga0495656_0008891 3300046615 Bacteria 3603
191 Ga0495668_0023498 3300046616 Bacteria 3513
192 Ga0495668_0137311 3300046616 Bacteria 1338
193 Ga0495634_0008320 3300046642 Bacteria 7730
194 Ga0495611_0002249 3300046648 Bacteria 8959
195 Ga0495611_0110325 3300046648 Bacteria 1280
196 Ga0495625_0035464 3300046660 Bacteria 3677
197 Ga0495625_0053745 3300046660 Bacteria 2879
198 Ga0495661_0000950 3300046665 Bacteria 26304
199 Ga0495661_0001147 3300046665 Bacteria 23134
200 Ga0495661_0001197 3300046665 Bacteria 22521
201 Ga0495661_0002052 3300046665 Bacteria 15809
202 Ga0495661_0009377 3300046665 Bacteria 6718
203 Ga0495661_0012565 3300046665 Bacteria 5716
204 Ga0495661_0044789 3300046665 Bacteria 2709
205 Ga0495588_0000248 3300046674 Bacteria 45277
206 Ga0495588_0101568 3300046674 Bacteria 1511
207 Ga0495588_0152305 3300046674 Bacteria 1222
208 Ga0495623_0038003 3300046679 Bacteria 3078
209 Ga0495669_0000228 3300046684 Bacteria 33234
210 Ga0495669_0000492 3300046684 Bacteria 18180
211 Ga0495613_0099784 3300046689 Bacteria 2097
212 Ga0495670_0033025 3300046691 Bacteria 2574
213 Ga0495670_0148277 3300046691 Bacteria 1229
214 Ga0495649_0016992 3300046694 Bacteria 4117
215 Ga0495649_0036861 3300046694 Bacteria 2686
216 Ga0495589_0000113 3300046794 Bacteria 76949
217 Ga0495589_0000178 3300046794 Bacteria 56371
218 Ga0495589_0091453 3300046794 Bacteria 1477
219 Ga0495660_0000438 3300046810 Bacteria 34904
220 Ga0495660_0008305 3300046810 Bacteria 6079
221 Ga0495660_0024120 3300046810 Bacteria 3466
222 Ga0495660_0028043 3300046810 Bacteria 3183
223 Ga0495581_0003779 3300047315 Bacteria 8709
224 Ga0495581_0039533 3300047315 Bacteria 2731
225 Ga0495604_0041947 3300047317 Bacteria 3587
226 Ga0495672_0000471 3300047320 Bacteria 47689
227 Ga0495672_0006241 3300047320 Bacteria 9295
228 Ga0495672_0022883 3300047320 Bacteria 4054
229 Ga0495680_0125256 3300047322 Bacteria 1893
230 Ga0495683_0006838 3300047323 Bacteria 6199
231 Ga0495687_000054 3300047443 Bacteria 194607
232 Ga0495687_000730 3300047443 Bacteria 36230
233 Ga0495687_000759 3300047443 Bacteria 34915
234 Ga0495687_016807 3300047443 Bacteria 3669
235 Ga0495675_0000899 3300047444 Bacteria 18148
236 Ga0495675_0048810 3300047444 Bacteria 2692
237 Ga0495677_0000084 3300047445 Bacteria 48271
238 Ga0495677_0001949 3300047445 Bacteria 8247
239 Ga0495677_0044685 3300047445 Bacteria 1624
240 Ga0495677_0101686 3300047445 Bacteria 1088
241 Ga0495681_0005214 3300047470 Bacteria 8732
242 Ga0495686_0000285 3300047472 Bacteria 88880
243 Ga0495686_0040864 3300047472 Bacteria 2955
244 Ga0495686_0074684 3300047472 Bacteria 2080
245 Ga0495602_0002114 3300048088 Bacteria 20014
246 Ga0495614_0006988 3300048089 Bacteria 5040
247 Ga0495626_0000036 3300048091 Bacteria 180464
248 Ga0495626_0000044 3300048091 Bacteria 165533
249 Ga0495626_0011175 3300048091 Bacteria 4758
250 Ga0495626_0018709 3300048091 Bacteria 3471
251 Ga0495626_0072746 3300048091 Bacteria 1541
252 Ga0496101_0102128 3300048904 Bacteria 2148
253 Ga0496101_0310153 3300048904 Bacteria 1237
254 Ga0496102_0056675 3300048905 Bacteria 3575
255 Ga0496102_0113783 3300048905 Bacteria 2525
256 Ga0496102_0282296 3300048905 Bacteria 1565
257 Ga0496104_0150807 3300048907 Bacteria 2232
258 Ga0496106_0002370 3300048909 Bacteria 14026
259 Ga0496106_0033770 3300048909 Bacteria 3819
260 Ga0496107_0080511 3300048910 Bacteria 2375
261 Ga0496107_0094110 3300048910 Bacteria 2192
262 Ga0496107_0155221 3300048910 Bacteria 1694
263 Ga0496107_0193379 3300048910 Bacteria 1512
264 Ga0496109_0082816 3300048912 Bacteria 2958
265 Ga0496110_0294054 3300048913 Bacteria 1479
266 Ga0496110_0455265 3300048913 Bacteria 1166
267 Ga0496113_0001430 3300048916 Bacteria 13250
268 Ga0496113_0089142 3300048916 Bacteria 2374
269 Ga0496122_0007694 3300048925 Bacteria 11878
270 Ga0496122_0023462 3300048925 Bacteria 5437
271 Ga0496123_0008174 3300048926 Bacteria 9653
272 Ga0496124_0005587 3300048927 Bacteria 14076
273 Ga0496124_0008650 3300048927 Bacteria 10602
274 Ga0496124_0066024 3300048927 Bacteria 3015
275 Ga0496124_0083391 3300048927 Bacteria 2622
276 Ga0496124_0102056 3300048927 Bacteria 2322
277 Ga0496125_0044001 3300048928 Bacteria 3782
278 Ga0501035_0002092 3300049822 Bacteria 19864
279 Ga0466962_0113217 3300061719 Bacteria 1307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0277814 Ga0395899_0277814_11_841 269
2 3300037466 Ga0395898_0759862 Ga0395898_0759862_40_870 269
3 3300037418 Ga0395900_0330953 Ga0395900_0330953_598_1437 276
4 3300038443 Ga0395901_0388460 Ga0395901_0388460_65_904 276
5 3300048913 Ga0496110_0455265 Ga0496110_0455265_80_970 285
6 3300044765 Ga0466970_0246854 Ga0466970_0246854_76_936 286
7 3300048091 Ga0495626_0000044 Ga0495626_0000044_26615_27697 298
8 3300044901 Ga0466960_0266982 Ga0466960_0266982_27_941 302
9 3300037418 Ga0395900_0468508 Ga0395900_0468508_15_956 305
10 3300037466 Ga0395898_0328952 Ga0395898_0328952_59_1000 305
11 3300048907 Ga0496104_0150807 Ga0496104_0150807_1291_2220 305
12 3300037466 Ga0395898_0357554 Ga0395898_0357554_17_1000 306
13 3300046491 Ga0495584_0006971 Ga0495584_0006971_2034_3008 306
14 3300046528 Ga0495642_0082389 Ga0495642_0082389_365_1339 306
15 3300044683 Ga0466965_0028711 Ga0466965_0028711_1512_2525 307
16 3300048910 Ga0496107_0080511 Ga0496107_0080511_547_1542 307
17 3300046474 Ga0495605_0006603 Ga0495605_0006603_2896_3918 309
18 3300046491 Ga0495584_0009125 Ga0495584_0009125_1335_2357 309
19 3300046501 Ga0495607_0000409 Ga0495607_0000409_14100_15122 309
20 3300046513 Ga0495616_0016192 Ga0495616_0016192_2290_3312 309
21 3300046526 Ga0495666_0109910 Ga0495666_0109910_203_1237 309
22 3300046538 Ga0495609_0000028 Ga0495609_0000028_130481_131503 309
23 3300046615 Ga0495656_0008891 Ga0495656_0008891_2463_3497 309
24 3300046665 Ga0495661_0001197 Ga0495661_0001197_18382_19404 309
25 3300046794 Ga0495589_0000113 Ga0495589_0000113_46539_47561 309
26 3300047443 Ga0495687_000054 Ga0495687_000054_164524_165546 309
27 3300047445 Ga0495677_0000084 Ga0495677_0000084_28903_29925 309
28 3300048927 Ga0496124_0083391 Ga0496124_0083391_1541_2554 311
29 3300037312 Ga0395899_0134615 Ga0395899_0134615_547_1566 312
30 3300037418 Ga0395900_0069899 Ga0395900_0069899_2220_3221 312
31 3300037418 Ga0395900_0087666 Ga0395900_0087666_685_1704 312
32 3300046491 Ga0495584_0029540 Ga0495584_0029540_1253_2254 312
33 3300046492 Ga0495585_0001454 Ga0495585_0001454_13061_14044 312
34 3300046513 Ga0495616_0073072 Ga0495616_0073072_230_1180 312
35 3300046518 Ga0495631_0006570 Ga0495631_0006570_352_1335 312
36 3300046558 Ga0495633_0004946 Ga0495633_0004946_3984_4967 312
37 3300046616 Ga0495668_0023498 Ga0495668_0023498_44_1027 312
38 3300046648 Ga0495611_0002249 Ga0495611_0002249_6856_7839 312
39 3300046665 Ga0495661_0000950 Ga0495661_0000950_21180_22163 312
40 3300046665 Ga0495661_0012565 Ga0495661_0012565_2669_3685 312
41 3300046684 Ga0495669_0000492 Ga0495669_0000492_7080_8063 312
42 3300046691 Ga0495670_0033025 Ga0495670_0033025_1214_2197 312
43 3300047445 Ga0495677_0044685 Ga0495677_0044685_486_1469 312
44 3300047470 Ga0495681_0005214 Ga0495681_0005214_3753_4736 312
45 3300048905 Ga0496102_0056675 Ga0496102_0056675_1636_2655 313
46 3300048927 Ga0496124_0008650 Ga0496124_0008650_7099_8082 313
47 3300049822 Ga0501035_0002092 Ga0501035_0002092_14855_15898 313
48 3300025254 Ga0209148_1000552 Ga0209148_100055211 314
49 3300037312 Ga0395899_0190182 Ga0395899_0190182_358_1383 314
50 3300046528 Ga0495642_0000512 Ga0495642_0000512_6105_7103 314
51 3300046543 Ga0495645_0020572 Ga0495645_0020572_1608_2627 314
52 3300046660 Ga0495625_0053745 Ga0495625_0053745_1792_2781 314
53 3300048927 Ga0496124_0005587 Ga0496124_0005587_5198_6226 314
54 3300005366 Ga0070659_100005967 Ga0070659_1000059678 315
55 3300013105 Ga0157369_10417321 Ga0157369_104173211 315
56 3300025919 Ga0207657_10012458 Ga0207657_100124583 315
57 3300025932 Ga0207690_10010494 Ga0207690_100104942 315
58 3300025933 Ga0207706_10326778 Ga0207706_103267781 315
59 3300037312 Ga0395899_0005079 Ga0395899_0005079_1536_2555 315
60 3300037418 Ga0395900_0002448 Ga0395900_0002448_11719_12738 315
61 3300046463 Ga0495653_0018988 Ga0495653_0018988_208_1242 315
62 3300046531 Ga0495665_0021878 Ga0495665_0021878_408_1442 315
63 3300046536 Ga0495587_0080609 Ga0495587_0080609_309_1343 315
64 3300046665 Ga0495661_0002052 Ga0495661_0002052_8359_9387 315
65 3300047444 Ga0495675_0048810 Ga0495675_0048810_910_1944 315
66 3300047472 Ga0495686_0040864 Ga0495686_0040864_1038_2087 315
67 3300046474 Ga0495605_0064554 Ga0495605_0064554_400_1395 316
68 3300046491 Ga0495584_0070055 Ga0495584_0070055_662_1657 316
69 3300046519 Ga0495632_0000260 Ga0495632_0000260_3274_4290 316
70 3300046528 Ga0495642_0115764 Ga0495642_0115764_60_1055 316
71 3300046542 Ga0495597_0073131 Ga0495597_0073131_328_1332 316
72 3300046616 Ga0495668_0137311 Ga0495668_0137311_257_1255 316
73 3300046648 Ga0495611_0110325 Ga0495611_0110325_146_1141 316
74 3300046660 Ga0495625_0035464 Ga0495625_0035464_2160_3158 316
75 3300046694 Ga0495649_0016992 Ga0495649_0016992_416_1414 316
76 3300046794 Ga0495589_0091453 Ga0495589_0091453_35_1030 316
77 3300047320 Ga0495672_0022883 Ga0495672_0022883_2566_3561 316
78 3300048091 Ga0495626_0072746 Ga0495626_0072746_98_1096 316
79 3300037418 Ga0395900_0046123 Ga0395900_0046123_436_1413 317
80 3300042005 Ga0439448_0023968 Ga0439448_0023968_159_1163 317
81 3300042157 Ga0439458_0017000 Ga0439458_0017000_239_1216 317
82 3300044683 Ga0466965_0003915 Ga0466965_0003915_116_1093 317
83 3300045976 Ga0466967_0213986 Ga0466967_0213986_29_1006 317
84 3300046457 Ga0495590_0000436 Ga0495590_0000436_13794_14816 317
85 3300046474 Ga0495605_0006603 Ga0495605_0006603_3955_4977 317
86 3300046491 Ga0495584_0001131 Ga0495584_0001131_2551_3552 317
87 3300046491 Ga0495584_0009125 Ga0495584_0009125_276_1298 317
88 3300046501 Ga0495607_0000409 Ga0495607_0000409_15159_16181 317
89 3300046522 Ga0495643_0046064 Ga0495643_0046064_427_1404 317
90 3300046528 Ga0495642_0041183 Ga0495642_0041183_445_1467 317
91 3300046538 Ga0495609_0000028 Ga0495609_0000028_131540_132562 317
92 3300046665 Ga0495661_0001197 Ga0495661_0001197_19441_20463 317
93 3300046674 Ga0495588_0000248 Ga0495588_0000248_41316_42317 317
94 3300046794 Ga0495589_0000113 Ga0495589_0000113_47598_48620 317
95 3300046810 Ga0495660_0008305 Ga0495660_0008305_399_1376 317
96 3300047443 Ga0495687_000054 Ga0495687_000054_165583_166605 317
97 3300047443 Ga0495687_000759 Ga0495687_000759_22765_23766 317
98 3300047445 Ga0495677_0000084 Ga0495677_0000084_27844_28866 317
99 3300048091 Ga0495626_0011175 Ga0495626_0011175_2260_3282 317
100 3300048927 Ga0496124_0083391 Ga0496124_0083391_457_1512 317
101 3300003759 Ga0055525_1000081 Ga0055525_100008180 318
102 3300005616 Ga0068852_100066333 Ga0068852_1000663331 318
103 3300013307 Ga0157372_10543960 Ga0157372_105439601 318
104 3300025230 Ga0209563_100015 Ga0209563_100015708 318
105 3300025253 Ga0209677_102417 Ga0209677_1024174 318
106 3300026142 Ga0207698_10020012 Ga0207698_100200122 318
107 3300038443 Ga0395901_0342860 Ga0395901_0342860_157_1179 318
108 3300025254 Ga0209148_1000552 Ga0209148_100055210 319
109 3300037418 Ga0395900_0179187 Ga0395900_0179187_509_1540 319
110 3300037471 Ga0395905_0164817 Ga0395905_0164817_318_1349 319
111 3300037471 Ga0395905_0391954 Ga0395905_0391954_77_1084 319
112 3300038443 Ga0395901_0361238 Ga0395901_0361238_13_1020 319
113 3300044842 Ga0466957_0000409 Ga0466957_0000409_14008_15066 319
114 3300037312 Ga0395899_0004694 Ga0395899_0004694_3753_4802 320
115 3300037312 Ga0395899_0012522 Ga0395899_0012522_2253_3281 320
116 3300037418 Ga0395900_0004116 Ga0395900_0004116_7853_8902 320
117 3300037418 Ga0395900_0015576 Ga0395900_0015576_5430_6458 320
118 3300037418 Ga0395900_0188074 Ga0395900_0188074_580_1599 320
119 3300037466 Ga0395898_0004127 Ga0395898_0004127_7845_8894 320
120 3300037471 Ga0395905_0137812 Ga0395905_0137812_89_1120 320
121 3300037471 Ga0395905_0276380 Ga0395905_0276380_54_1103 320
122 3300038443 Ga0395901_0009380 Ga0395901_0009380_3451_4500 320
123 3300048088 Ga0495602_0002114 Ga0495602_0002114_6249_7271 320
124 3300049822 Ga0501035_0002092 Ga0501035_0002092_13795_14844 320
125 iso_pu_bacteria 2808606418 2809144001 320
126 3300005563 Ga0068855_100348822 Ga0068855_1003488221 321
127 3300025949 Ga0207667_10297946 Ga0207667_102979462 321
128 3300037418 Ga0395900_0003969 Ga0395900_0003969_5603_6640 321
129 3300037418 Ga0395900_0183164 Ga0395900_0183164_570_1607 321
130 3300037466 Ga0395898_0246058 Ga0395898_0246058_73_1110 321
131 3300037471 Ga0395905_0082667 Ga0395905_0082667_171_1208 321
132 3300038443 Ga0395901_0124030 Ga0395901_0124030_432_1469 321
133 3300042157 Ga0439458_0003074 Ga0439458_0003074_2354_3391 321
134 3300044684 Ga0466966_0055522 Ga0466966_0055522_1328_2404 321
135 3300044693 Ga0466961_0023268 Ga0466961_0023268_1672_2694 321
136 3300044694 Ga0466963_0083438 Ga0466963_0083438_116_1153 321
137 3300045049 Ga0466959_0022445 Ga0466959_0022445_869_1891 321
138 3300045836 Ga0466958_0032281 Ga0466958_0032281_212_1249 321
139 3300045976 Ga0466967_0034201 Ga0466967_0034201_435_1472 321
140 3300046500 Ga0495596_0050122 Ga0495596_0050122_513_1535 321
141 3300046542 Ga0495597_0052570 Ga0495597_0052570_484_1506 321
142 3300047472 Ga0495686_0000285 Ga0495686_0000285_14410_15411 321
143 3300048904 Ga0496101_0102128 Ga0496101_0102128_319_1347 321
144 3300048909 Ga0496106_0002370 Ga0496106_0002370_10846_11874 321
145 3300048909 Ga0496106_0033770 Ga0496106_0033770_2488_3525 321
146 3300048910 Ga0496107_0155221 Ga0496107_0155221_638_1666 321
147 3300048910 Ga0496107_0193379 Ga0496107_0193379_393_1430 321
148 iso_pu_bacteria 2643221556 2643800492 321
149 iso_pu_bacteria 2643221684 2644470401 321
150 iso_pu_bacteria 8047673197 8047678792 321
151 3300005327 Ga0070658_10058984 Ga0070658_100589841 322
152 3300005327 Ga0070658_10293110 Ga0070658_102931101 322
153 3300005563 Ga0068855_100257738 Ga0068855_1002577382 322
154 3300009174 Ga0105241_10005256 Ga0105241_100052566 322
155 3300013307 Ga0157372_10289838 Ga0157372_102898381 322
156 3300025909 Ga0207705_10008407 Ga0207705_100084073 322
157 3300025949 Ga0207667_10204604 Ga0207667_102046042 322
158 3300037312 Ga0395899_0012522 Ga0395899_0012522_1249_2256 322
159 3300037312 Ga0395899_0192763 Ga0395899_0192763_301_1308 322
160 3300037418 Ga0395900_0000846 Ga0395900_0000846_31682_32710 322
161 3300037418 Ga0395900_0015576 Ga0395900_0015576_6455_7462 322
162 3300037418 Ga0395900_0221555 Ga0395900_0221555_448_1455 322
163 3300037418 Ga0395900_0247189 Ga0395900_0247189_282_1289 322
164 3300037418 Ga0395900_0303306 Ga0395900_0303306_276_1283 322
165 3300037471 Ga0395905_0017830 Ga0395905_0017830_4843_5850 322
166 3300037471 Ga0395905_0153940 Ga0395905_0153940_179_1186 322
167 3300038443 Ga0395901_0000730 Ga0395901_0000730_29638_30666 322
168 3300042157 Ga0439458_0021184 Ga0439458_0021184_337_1377 322
169 3300044656 Ga0466969_0023946 Ga0466969_0023946_1891_2892 322
170 3300044656 Ga0466969_0023946 Ga0466969_0023946_852_1874 322
171 3300044693 Ga0466961_0023268 Ga0466961_0023268_2711_3712 322
172 3300044693 Ga0466961_0141768 Ga0466961_0141768_273_1301 322
173 3300044706 Ga0466964_0000376 Ga0466964_0000376_5441_6466 322
174 3300044719 Ga0466971_0039667 Ga0466971_0039667_174_1175 322
175 3300044735 Ga0466968_0000137 Ga0466968_0000137_15261_16286 322
176 3300044842 Ga0466957_0044671 Ga0466957_0044671_1327_2328 322
177 3300045049 Ga0466959_0022445 Ga0466959_0022445_1908_2909 322
178 3300046474 Ga0495605_0000317 Ga0495605_0000317_20196_21197 322
179 3300046513 Ga0495616_0009817 Ga0495616_0009817_3291_4316 322
180 3300046522 Ga0495643_0004134 Ga0495643_0004134_8069_9070 322
181 3300046524 Ga0495648_0015196 Ga0495648_0015196_4043_5071 322
182 3300046615 Ga0495656_0008891 Ga0495656_0008891_1451_2452 322
183 3300046665 Ga0495661_0001147 Ga0495661_0001147_11817_12845 322
184 3300046665 Ga0495661_0009377 Ga0495661_0009377_5440_6465 322
185 3300046794 Ga0495589_0000178 Ga0495589_0000178_30211_31212 322
186 3300046810 Ga0495660_0000438 Ga0495660_0000438_3486_4487 322
187 3300047320 Ga0495672_0006241 Ga0495672_0006241_1222_2223 322
188 3300047323 Ga0495683_0006838 Ga0495683_0006838_1845_2846 322
189 3300047443 Ga0495687_016807 Ga0495687_016807_1399_2400 322
190 3300047445 Ga0495677_0001949 Ga0495677_0001949_3633_4634 322
191 3300047472 Ga0495686_0074684 Ga0495686_0074684_357_1358 322
192 3300048091 Ga0495626_0000036 Ga0495626_0000036_21693_22694 322
193 3300048905 Ga0496102_0113783 Ga0496102_0113783_1305_2306 322
194 3300048905 Ga0496102_0282296 Ga0496102_0282296_434_1471 322
195 3300048909 Ga0496106_0002370 Ga0496106_0002370_11871_12878 322
196 3300048913 Ga0496110_0294054 Ga0496110_0294054_100_1101 322
197 3300048925 Ga0496122_0023462 Ga0496122_0023462_150_1151 322
198 3300048926 Ga0496123_0008174 Ga0496123_0008174_8177_9178 322
199 3300048927 Ga0496124_0005587 Ga0496124_0005587_3996_5072 322
200 3300048927 Ga0496124_0102056 Ga0496124_0102056_1173_2201 322
201 iso_pu_bacteria 2643221556 2643800491 322
202 iso_pu_bacteria 2643221684 2644470400 322
203 iso_pu_bacteria 8047673197 8047678791 322
204 3300037418 Ga0395900_0046123 Ga0395900_0046123_2461_3495 323
205 3300037471 Ga0395905_0067750 Ga0395905_0067750_75_1082 323
206 3300038443 Ga0395901_0000730 Ga0395901_0000730_30677_31708 323
207 3300042012 Ga0439455_0019552 Ga0439455_0019552_435_1463 323
208 3300044684 Ga0466966_0005084 Ga0466966_0005084_942_1964 323
209 3300048910 Ga0496107_0094110 Ga0496107_0094110_847_1866 323
210 3300048916 Ga0496113_0089142 Ga0496113_0089142_437_1465 323
211 3300048927 Ga0496124_0008650 Ga0496124_0008650_5977_7029 323
212 3300048927 Ga0496124_0066024 Ga0496124_0066024_1607_2635 323
213 3300003759 Ga0055525_1000081 Ga0055525_100008181 324
214 3300005327 Ga0070658_10058984 Ga0070658_100589842 324
215 3300005339 Ga0070660_100122439 Ga0070660_1001224392 324
216 3300005344 Ga0070661_100188031 Ga0070661_1001880311 324
217 3300005344 Ga0070661_100275558 Ga0070661_1002755582 324
218 3300005366 Ga0070659_100005967 Ga0070659_1000059677 324
219 3300005459 Ga0068867_100190647 Ga0068867_1001906471 324
220 3300005563 Ga0068855_100101082 Ga0068855_1001010822 324
221 3300005564 Ga0070664_100217069 Ga0070664_1002170691 324
222 3300005616 Ga0068852_100118913 Ga0068852_1001189132 324
223 3300009098 Ga0105245_10091621 Ga0105245_100916212 324
224 3300009148 Ga0105243_10023840 Ga0105243_100238403 324
225 3300009174 Ga0105241_10005256 Ga0105241_100052565 324
226 3300009176 Ga0105242_10002503 Ga0105242_100025034 324
227 3300009545 Ga0105237_10284445 Ga0105237_102844452 324
228 3300013297 Ga0157378_10105823 Ga0157378_101058232 324
229 3300013297 Ga0157378_10105823 Ga0157378_101058233 324
230 3300025230 Ga0209563_100015 Ga0209563_100015707 324
231 3300025253 Ga0209677_102417 Ga0209677_1024173 324
232 3300025909 Ga0207705_10008407 Ga0207705_100084074 324
233 3300025911 Ga0207654_10072552 Ga0207654_100725522 324
234 3300025919 Ga0207657_10012458 Ga0207657_100124584 324
235 3300025932 Ga0207690_10010494 Ga0207690_100104943 324
236 3300025932 Ga0207690_10062257 Ga0207690_100622572 324
237 3300025934 Ga0207686_10003569 Ga0207686_100035695 324
238 3300025935 Ga0207709_10013206 Ga0207709_100132063 324
239 3300025945 Ga0207679_10046503 Ga0207679_100465032 324
240 3300025945 Ga0207679_10116302 Ga0207679_101163023 324
241 3300026142 Ga0207698_10020012 Ga0207698_100200123 324
242 3300037312 Ga0395899_0005079 Ga0395899_0005079_307_1410 324
243 3300037312 Ga0395899_0138627 Ga0395899_0138627_143_1234 324
244 3300037418 Ga0395900_0002448 Ga0395900_0002448_10490_11593 324
245 3300037418 Ga0395900_0046123 Ga0395900_0046123_1454_2464 324
246 3300037466 Ga0395898_0078299 Ga0395898_0078299_1896_2933 324
247 3300038443 Ga0395901_0201293 Ga0395901_0201293_673_1776 324
248 3300038443 Ga0395901_0228905 Ga0395901_0228905_132_1223 324
249 3300042005 Ga0439448_0004665 Ga0439448_0004665_1002_2063 324
250 3300042005 Ga0439448_0007925 Ga0439448_0007925_789_1826 324
251 3300042008 Ga0439450_005259 Ga0439450_005259_444_1505 324
252 3300042012 Ga0439455_0001275 Ga0439455_0001275_640_1701 324
253 3300042012 Ga0439455_0026776 Ga0439455_0026776_297_1334 324
254 3300044656 Ga0466969_0141182 Ga0466969_0141182_69_1097 324
255 3300044683 Ga0466965_0037045 Ga0466965_0037045_258_1349 324
256 3300044684 Ga0466966_0062974 Ga0466966_0062974_629_1720 324
257 3300044706 Ga0466964_0000139 Ga0466964_0000139_738_1799 324
258 3300044706 Ga0466964_0032411 Ga0466964_0032411_159_1217 324
259 3300044842 Ga0466957_0075742 Ga0466957_0075742_346_1437 324
260 3300044842 Ga0466957_0097581 Ga0466957_0097581_450_1526 324
261 3300045049 Ga0466959_0051912 Ga0466959_0051912_593_1684 324
262 3300045976 Ga0466967_0052801 Ga0466967_0052801_88_1149 324
263 3300046452 Ga0495617_000134 Ga0495617_000134_29888_30910 324
264 3300046457 Ga0495590_0012160 Ga0495590_0012160_1394_2425 324
265 3300046463 Ga0495653_0066485 Ga0495653_0066485_403_1425 324
266 3300046473 Ga0495582_0012847 Ga0495582_0012847_229_1251 324
267 3300046499 Ga0495594_0009835 Ga0495594_0009835_1532_2554 324
268 3300046500 Ga0495596_0006629 Ga0495596_0006629_2795_3817 324
269 3300046523 Ga0495644_0010933 Ga0495644_0010933_1953_2975 324
270 3300046526 Ga0495666_0045089 Ga0495666_0045089_347_1366 324
271 3300046531 Ga0495665_0001979 Ga0495665_0001979_1098_2117 324
272 3300046558 Ga0495633_0070862 Ga0495633_0070862_454_1476 324
273 3300046642 Ga0495634_0008320 Ga0495634_0008320_2141_3160 324
274 3300046674 Ga0495588_0101568 Ga0495588_0101568_86_1105 324
275 3300046674 Ga0495588_0152305 Ga0495588_0152305_103_1179 324
276 3300046679 Ga0495623_0038003 Ga0495623_0038003_86_1105 324
277 3300046684 Ga0495669_0000228 Ga0495669_0000228_25508_26530 324
278 3300046689 Ga0495613_0099784 Ga0495613_0099784_750_1772 324
279 3300046691 Ga0495670_0148277 Ga0495670_0148277_31_1053 324
280 3300046810 Ga0495660_0024120 Ga0495660_0024120_2134_3165 324
281 3300047315 Ga0495581_0003779 Ga0495581_0003779_5406_6428 324
282 3300047315 Ga0495581_0039533 Ga0495581_0039533_334_1353 324
283 3300047317 Ga0495604_0041947 Ga0495604_0041947_904_1923 324
284 3300047320 Ga0495672_0000471 Ga0495672_0000471_26415_27434 324
285 3300047322 Ga0495680_0125256 Ga0495680_0125256_231_1250 324
286 3300047443 Ga0495687_000730 Ga0495687_000730_20492_21514 324
287 3300047444 Ga0495675_0000899 Ga0495675_0000899_6285_7304 324
288 3300047445 Ga0495677_0101686 Ga0495677_0101686_15_1037 324
289 3300047472 Ga0495686_0000285 Ga0495686_0000285_13340_14359 324
290 3300048089 Ga0495614_0006988 Ga0495614_0006988_3938_4960 324
291 3300048091 Ga0495626_0011175 Ga0495626_0011175_3319_4356 324
292 3300048091 Ga0495626_0018709 Ga0495626_0018709_1493_2515 324
293 3300048905 Ga0496102_0056675 Ga0496102_0056675_431_1510 324
294 3300048907 Ga0496104_0150807 Ga0496104_0150807_74_1165 324
295 3300048916 Ga0496113_0001430 Ga0496113_0001430_3845_4936 324
296 3300048925 Ga0496122_0007694 Ga0496122_0007694_10231_11322 324
297 3300048928 Ga0496125_0044001 Ga0496125_0044001_1986_3077 324
298 3300005563 Ga0068855_100101082 Ga0068855_1001010823 325
299 3300044683 Ga0466965_0058056 Ga0466965_0058056_837_1868 325
300 3300044684 Ga0466966_0116423 Ga0466966_0116423_519_1559 325
301 3300044706 Ga0466964_0000376 Ga0466964_0000376_6481_7512 325
302 3300044735 Ga0466968_0000137 Ga0466968_0000137_14215_15246 325
303 3300044765 Ga0466970_0067035 Ga0466970_0067035_421_1452 325
304 3300044842 Ga0466957_0128936 Ga0466957_0128936_36_1067 325
305 3300044901 Ga0466960_0063112 Ga0466960_0063112_547_1578 325
306 3300048912 Ga0496109_0082816 Ga0496109_0082816_183_1208 325
307 3300048916 Ga0496113_0001430 Ga0496113_0001430_5062_6087 325
308 3300048925 Ga0496122_0007694 Ga0496122_0007694_9080_10105 325
309 3300061719 Ga0466962_0113217 Ga0466962_0113217_176_1213 325
310 3300003322 rootL2_10080794 rootL2_100807942 326
311 3300003322 rootL2_10080795 rootL2_100807952 326
312 3300003322 rootL2_10080795 rootL2_100807953 326
313 3300005262 Ga0065165_1013380 Ga0065165_10133802 326
314 3300009148 Ga0105243_10023840 Ga0105243_100238404 326
315 3300009176 Ga0105242_10002503 Ga0105242_100025033 326
316 3300009176 Ga0105242_10067586 Ga0105242_100675862 326
317 3300013307 Ga0157372_10519522 Ga0157372_105195222 326
318 3300025919 Ga0207657_10151063 Ga0207657_101510632 326
319 3300025919 Ga0207657_10156673 Ga0207657_101566732 326
320 3300025933 Ga0207706_10123117 Ga0207706_101231172 326
321 3300025934 Ga0207686_10003569 Ga0207686_100035696 326
322 3300025934 Ga0207686_10065814 Ga0207686_100658142 326
323 3300025935 Ga0207709_10013206 Ga0207709_100132064 326
324 3300037418 Ga0395900_0003969 Ga0395900_0003969_4446_5486 326
325 3300037471 Ga0395905_0064092 Ga0395905_0064092_797_1837 326
326 3300037471 Ga0395905_0082667 Ga0395905_0082667_1323_2363 326
327 3300038443 Ga0395901_0124030 Ga0395901_0124030_1584_2624 326
328 3300038443 Ga0395901_0229322 Ga0395901_0229322_361_1368 326
329 3300042005 Ga0439448_0007925 Ga0439448_0007925_1943_2983 326
330 3300042005 Ga0439448_0032222 Ga0439448_0032222_158_1189 326
331 3300044684 Ga0466966_0067587 Ga0466966_0067587_292_1335 326
332 3300044842 Ga0466957_0044671 Ga0466957_0044671_273_1316 326
333 3300045049 Ga0466959_0146261 Ga0466959_0146261_537_1556 326
334 3300046474 Ga0495605_0000317 Ga0495605_0000317_19170_20177 326
335 3300046491 Ga0495584_0001131 Ga0495584_0001131_3587_4606 326
336 3300046501 Ga0495607_0049294 Ga0495607_0049294_505_1512 326
337 3300046501 Ga0495607_0075238 Ga0495607_0075238_351_1382 326
338 3300046507 Ga0495606_0055124 Ga0495606_0055124_852_1871 326
339 3300046513 Ga0495616_0009817 Ga0495616_0009817_4342_5370 326
340 3300046513 Ga0495616_0020930 Ga0495616_0020930_504_1532 326
341 3300046522 Ga0495643_0004134 Ga0495643_0004134_7043_8050 326
342 3300046543 Ga0495645_0020572 Ga0495645_0020572_542_1591 326
343 3300046665 Ga0495661_0044789 Ga0495661_0044789_925_1944 326
344 3300046674 Ga0495588_0000248 Ga0495588_0000248_42367_43395 326
345 3300046674 Ga0495588_0000248 Ga0495588_0000248_43414_44418 326
346 3300046694 Ga0495649_0036861 Ga0495649_0036861_660_1667 326
347 3300046794 Ga0495589_0000178 Ga0495589_0000178_31231_32238 326
348 3300046810 Ga0495660_0000438 Ga0495660_0000438_2460_3467 326
349 3300046810 Ga0495660_0028043 Ga0495660_0028043_730_1749 326
350 3300047320 Ga0495672_0006241 Ga0495672_0006241_2242_3249 326
351 3300047323 Ga0495683_0006838 Ga0495683_0006838_2865_3872 326
352 3300047443 Ga0495687_000759 Ga0495687_000759_21710_22729 326
353 3300047443 Ga0495687_016807 Ga0495687_016807_373_1380 326
354 3300047445 Ga0495677_0001949 Ga0495677_0001949_2607_3614 326
355 3300048091 Ga0495626_0000036 Ga0495626_0000036_22713_23720 326
356 3300048904 Ga0496101_0310153 Ga0496101_0310153_52_1071 326
357 3300048905 Ga0496102_0113783 Ga0496102_0113783_260_1294 326
358 3300048925 Ga0496122_0023462 Ga0496122_0023462_1167_2183 326
359 3300048925 Ga0496122_0023462 Ga0496122_0023462_2194_3225 326
360 3300048926 Ga0496123_0008174 Ga0496123_0008174_6103_7134 326
361 3300048926 Ga0496123_0008174 Ga0496123_0008174_7145_8161 326
362 3300048927 Ga0496124_0066024 Ga0496124_0066024_568_1593 326
363 3300048927 Ga0496124_0102056 Ga0496124_0102056_110_1156 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01963

TraB_PrgY_gumN

TraB/PrgY/gumN family

68

356

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ko4-assembly1.cif.gz_A crystal structure of gluconate kinase 0.5884 264 318
7lth-assembly1.cif.gz_C structure of the alpha-n-methyltransferase (sonm mutant y93f) and ripp precursor (sona) heteromeric complex (no cofactor) 0.491 275 318
8t1s-assembly1.cif.gz_A structure of the alpha-n-methyltransferase (sonm) and ripp precursor (sona with qsy deletion) heteromeric complex (bound to sah) 0.4909 275 318
4e4r-assembly1.cif.gz_A-2 eutd phosphotransacetylase from staphylococcus aureus 0.452 33 83
6vcm-assembly1.cif.gz_A crystal structure of e.coli rpph-dapf in complex with gtp, mg2+ and f- 0.4509 38 75
ID Description Score Start End Superfamily
af_Q9VUC7_431_613_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7395 273 301 3.40.50.300
af_Q4E2Q4_393_499_3.40.50.11860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Diphthamide synthesis DPH1/DPH2 domain 3 0.4245 67 105 3.40.50.11860
af_Q58181_4_127_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.421 275 318 3.40.1010.10
af_A0A0R0HLZ4_60_246_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.4153 26 83 3.40.50.1970
af_A0A0R0G5G0_335_437_3.40.50.11860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Diphthamide synthesis DPH1/DPH2 domain 3 0.4153 69 106 3.40.50.11860
ID Description Score Start End GO Terms
AF-A0A7Z2ZSJ6-F1-model_v4 TraB/GumN family protein 0.9336 24 326
AF-A0A7W8YF30-F1-model_v4 Uncharacterized protein 0.9117 124 325
AF-A0A5C7SKK3-F1-model_v4 deleted 0.9099 36 326
AF-A0A7G6A4E3-F1-model_v4 TraB/GumN family protein 0.9089 32 326
AF-A0A7G8Q1R3-F1-model_v4 TraB/GumN family protein 0.905 23 326

Feature Viewer

pLDDT pTM Quality
77.09 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map