F423062
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 363 | 164 | 726 | 94 |
Family's Representative Sequence
| Representative Sequence | 3300044901|Ga0466960_0747336|Ga0466960_0747336_185_520 |
| Length | 111 |
| Sequence | LTERVFATCAEHARIERMGRASAVADLLHEAAETHHVVYRIVDGDDPDWASWYADWLLTLSELPQLLGSTPVRSHLVHTLVELDRAYTTESREECWEDWYAERLLAEFASV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 30 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 31 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 32 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 33 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 46 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 48 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 70 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 71 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 72 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 73 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 74 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 75 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 76 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 77 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 78 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 79 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 80 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 81 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 82 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 83 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 84 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 85 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 86 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 87 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 88 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 89 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 90 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 91 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 92 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 93 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 94 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 95 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 96 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 97 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 98 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 99 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 100 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 136 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 138 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 139 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 140 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 141 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 142 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 143 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 146 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 147 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 148 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 149 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 150 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 151 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 164 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 12.67 |
| Rhizosphere | 86.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466960_0747336 | 3300044901 | Unclassified | 589 |
| 2 | Ga0070683_100234475 | 3300005329 | Bacteria | 1745 |
| 3 | Ga0070682_100337728 | 3300005337 | Unclassified | 1119 |
| 4 | Ga0070689_101589463 | 3300005340 | Unclassified | 593 |
| 5 | Ga0070671_100305838 | 3300005355 | Bacteria | 1354 |
| 6 | Ga0070709_11463421 | 3300005434 | Bacteria | 554 |
| 7 | Ga0070714_100004497 | 3300005435 | Bacteria | 10510 |
| 8 | Ga0070714_100092820 | 3300005435 | Unclassified | 2646 |
| 9 | Ga0070714_100379932 | 3300005435 | Bacteria | 1332 |
| 10 | Ga0070714_100836609 | 3300005435 | Bacteria | 892 |
| 11 | Ga0070713_100196816 | 3300005436 | Unclassified | 1818 |
| 12 | Ga0070713_100541347 | 3300005436 | Bacteria | 1102 |
| 13 | Ga0070710_10019873 | 3300005437 | Bacteria | 3478 |
| 14 | Ga0070711_100042961 | 3300005439 | Unclassified | 3059 |
| 15 | Ga0070711_100111280 | 3300005439 | Bacteria | 2010 |
| 16 | Ga0070711_101878536 | 3300005439 | Bacteria | 526 |
| 17 | Ga0070694_100210623 | 3300005444 | Unclassified | 1453 |
| 18 | Ga0070678_100509351 | 3300005456 | Bacteria | 1063 |
| 19 | Ga0070681_10103778 | 3300005458 | Bacteria | 2786 |
| 20 | Ga0070681_10397335 | 3300005458 | Unclassified | 1290 |
| 21 | Ga0070681_10482271 | 3300005458 | Bacteria | 1153 |
| 22 | Ga0070706_100001156 | 3300005467 | Bacteria | 28388 |
| 23 | Ga0070706_101144620 | 3300005467 | Bacteria | 716 |
| 24 | Ga0070707_100062202 | 3300005468 | Bacteria | 3581 |
| 25 | Ga0070698_100031068 | 3300005471 | Bacteria | 5538 |
| 26 | Ga0070698_100559049 | 3300005471 | Bacteria | 1084 |
| 27 | Ga0070698_101676601 | 3300005471 | Unclassified | 588 |
| 28 | Ga0070679_100228462 | 3300005530 | Bacteria | 1821 |
| 29 | Ga0070679_100797142 | 3300005530 | Bacteria | 888 |
| 30 | Ga0070684_100922219 | 3300005535 | Bacteria | 819 |
| 31 | Ga0070684_101125606 | 3300005535 | Bacteria | 738 |
| 32 | Ga0070697_100145602 | 3300005536 | Unclassified | 1994 |
| 33 | Ga0070697_100710144 | 3300005536 | Bacteria | 887 |
| 34 | Ga0070697_100897879 | 3300005536 | Unclassified | 786 |
| 35 | Ga0070672_100437862 | 3300005543 | Bacteria | 1125 |
| 36 | Ga0070686_100129019 | 3300005544 | Bacteria | 1746 |
| 37 | Ga0070695_100000074 | 3300005545 | Bacteria | 40508 |
| 38 | Ga0070695_100452853 | 3300005545 | Bacteria | 984 |
| 39 | Ga0070696_101293420 | 3300005546 | Bacteria | 619 |
| 40 | Ga0068855_100059609 | 3300005563 | Bacteria | 4465 |
| 41 | Ga0068856_100033683 | 3300005614 | Bacteria | 5016 |
| 42 | Ga0068856_100058093 | 3300005614 | Bacteria | 3820 |
| 43 | Ga0070717_10017341 | 3300006028 | Bacteria | 5602 |
| 44 | Ga0070716_100704845 | 3300006173 | Bacteria | 772 |
| 45 | Ga0070712_100003371 | 3300006175 | Bacteria | 9824 |
| 46 | Ga0070712_100435208 | 3300006175 | Bacteria | 1089 |
| 47 | Ga0075433_10097424 | 3300006852 | Bacteria | 2603 |
| 48 | Ga0075434_100133425 | 3300006871 | Unclassified | 2502 |
| 49 | Ga0075434_100257661 | 3300006871 | Unclassified | 1763 |
| 50 | Ga0075436_100251222 | 3300006914 | Unclassified | 1259 |
| 51 | Ga0075436_100323529 | 3300006914 | Bacteria | 1108 |
| 52 | Ga0075435_100187182 | 3300007076 | Bacteria | 1751 |
| 53 | Ga0075435_100783196 | 3300007076 | Bacteria | 830 |
| 54 | Ga0111539_10263084 | 3300009094 | Unclassified | 2008 |
| 55 | Ga0111539_13494046 | 3300009094 | Unclassified | 504 |
| 56 | Ga0105245_10000001 | 3300009098 | Bacteria | 939270 |
| 57 | Ga0105245_10923911 | 3300009098 | Bacteria | 915 |
| 58 | Ga0114129_10228483 | 3300009147 | Bacteria | 2507 |
| 59 | Ga0114129_10354135 | 3300009147 | Bacteria | 1944 |
| 60 | Ga0105241_10948932 | 3300009174 | Bacteria | 802 |
| 61 | Ga0105241_11270989 | 3300009174 | Unclassified | 700 |
| 62 | Ga0105242_12448950 | 3300009176 | Unclassified | 570 |
| 63 | Ga0105248_10163944 | 3300009177 | Bacteria | 2506 |
| 64 | Ga0105248_10259599 | 3300009177 | Bacteria | 1956 |
| 65 | Ga0105237_10037397 | 3300009545 | Bacteria | 4906 |
| 66 | Ga0105237_12633914 | 3300009545 | Unclassified | 514 |
| 67 | Ga0157370_10103146 | 3300013104 | Bacteria | 2670 |
| 68 | Ga0157370_10103448 | 3300013104 | Bacteria | 2666 |
| 69 | Ga0157370_11029186 | 3300013104 | Unclassified | 745 |
| 70 | Ga0157369_10036665 | 3300013105 | Bacteria | 5371 |
| 71 | Ga0157369_10481047 | 3300013105 | Bacteria | 1285 |
| 72 | Ga0157369_10942258 | 3300013105 | Unclassified | 885 |
| 73 | Ga0163162_10428057 | 3300013306 | Bacteria | 1455 |
| 74 | Ga0157372_10009801 | 3300013307 | Bacteria | 10188 |
| 75 | Ga0157375_10118400 | 3300013308 | Bacteria | 2755 |
| 76 | Ga0182008_10004812 | 3300014497 | Bacteria | 7808 |
| 77 | Ga0182008_10052897 | 3300014497 | Bacteria | 2012 |
| 78 | Ga0157376_11309044 | 3300014969 | Bacteria | 755 |
| 79 | Ga0157376_11919824 | 3300014969 | Unclassified | 629 |
| 80 | Ga0182007_10190222 | 3300015262 | Bacteria | 713 |
| 81 | Ga0207699_10287546 | 3300025906 | Bacteria | 1144 |
| 82 | Ga0207684_10000016 | 3300025910 | Bacteria | 409263 |
| 83 | Ga0207684_10025905 | 3300025910 | Unclassified | 4999 |
| 84 | Ga0207684_10836009 | 3300025910 | Bacteria | 777 |
| 85 | Ga0207684_11553075 | 3300025910 | Bacteria | 537 |
| 86 | Ga0207707_10138236 | 3300025912 | Bacteria | 2130 |
| 87 | Ga0207707_10393674 | 3300025912 | Bacteria | 1190 |
| 88 | Ga0207695_10465756 | 3300025913 | Unclassified | 1147 |
| 89 | Ga0207671_10152683 | 3300025914 | Bacteria | 1785 |
| 90 | Ga0207693_10006220 | 3300025915 | Bacteria | 9905 |
| 91 | Ga0207693_10277730 | 3300025915 | Bacteria | 1313 |
| 92 | Ga0207663_10034663 | 3300025916 | Bacteria | 3021 |
| 93 | Ga0207652_10552906 | 3300025921 | Bacteria | 1034 |
| 94 | Ga0207652_10636726 | 3300025921 | Unclassified | 954 |
| 95 | Ga0207646_10080795 | 3300025922 | Bacteria | 2907 |
| 96 | Ga0207646_11575730 | 3300025922 | Unclassified | 567 |
| 97 | Ga0207646_11673675 | 3300025922 | Bacteria | 547 |
| 98 | Ga0207687_10000004 | 3300025927 | Bacteria | 841177 |
| 99 | Ga0207687_10116569 | 3300025927 | Bacteria | 1991 |
| 100 | Ga0207687_10648297 | 3300025927 | Bacteria | 893 |
| 101 | Ga0207700_10054163 | 3300025928 | Bacteria | 3009 |
| 102 | Ga0207700_10526734 | 3300025928 | Bacteria | 1047 |
| 103 | Ga0207700_11266254 | 3300025928 | Bacteria | 657 |
| 104 | Ga0207664_10001852 | 3300025929 | Bacteria | 13953 |
| 105 | Ga0207664_10020529 | 3300025929 | Bacteria | 4898 |
| 106 | Ga0207664_10025873 | 3300025929 | Bacteria | 4427 |
| 107 | Ga0207664_10814251 | 3300025929 | Bacteria | 840 |
| 108 | Ga0207644_10297387 | 3300025931 | Bacteria | 1300 |
| 109 | Ga0207686_10655572 | 3300025934 | Bacteria | 831 |
| 110 | Ga0207691_10134544 | 3300025940 | Bacteria | 2182 |
| 111 | Ga0207711_10310436 | 3300025941 | Bacteria | 1456 |
| 112 | Ga0207711_10548742 | 3300025941 | Bacteria | 1078 |
| 113 | Ga0207667_10399967 | 3300025949 | Bacteria | 1398 |
| 114 | Ga0207702_10120795 | 3300026078 | Bacteria | 2345 |
| 115 | Ga0207676_11690764 | 3300026095 | Unclassified | 631 |
| 116 | Ga0207683_10634007 | 3300026121 | Unclassified | 990 |
| 117 | Ga0207698_10953783 | 3300026142 | Bacteria | 867 |
| 118 | Ga0265318_10003753 | 3300028577 | Bacteria | 7558 |
| 119 | Ga0373928_0071282 | 3300035084 | Bacteria | 860 |
| 120 | Ga0373945_0397689 | 3300035116 | Bacteria | 603 |
| 121 | Ga0373946_0128603 | 3300035171 | Bacteria | 1163 |
| 122 | Ga0373955_0045849 | 3300035172 | Bacteria | 2361 |
| 123 | Ga0373924_0265996 | 3300035410 | Bacteria | 760 |
| 124 | Ga0373935_0852857 | 3300035692 | Unclassified | 674 |
| 125 | Ga0373947_0099885 | 3300035725 | Bacteria | 1822 |
| 126 | Ga0373937_0380010 | 3300036401 | Bacteria | 1339 |
| 127 | Ga0373925_0170765 | 3300037068 | Bacteria | 1717 |
| 128 | Ga0395900_0133415 | 3300037418 | Bacteria | 2544 |
| 129 | Ga0395898_0208231 | 3300037466 | Bacteria | 1866 |
| 130 | Ga0395905_0110185 | 3300037471 | Bacteria | 2585 |
| 131 | Ga0395905_0120779 | 3300037471 | Bacteria | 2463 |
| 132 | Ga0436365_0369417 | 3300039437 | Bacteria | 7222 |
| 133 | Ga0436365_0579854 | 3300039437 | Bacteria | 1427 |
| 134 | Ga0436360_0558782 | 3300039438 | Bacteria | 9074 |
| 135 | Ga0436363_1218413 | 3300039450 | Bacteria | 1074 |
| 136 | Ga0436363_1689239 | 3300039450 | Bacteria | 685 |
| 137 | Ga0436362_0731494 | 3300039453 | Bacteria | 1569 |
| 138 | Ga0451807_1591040 | 3300041486 | Bacteria | 670 |
| 139 | Ga0466972_0154932 | 3300044658 | Bacteria | 1076 |
| 140 | Ga0466965_0042989 | 3300044683 | Bacteria | 2230 |
| 141 | Ga0466965_0163222 | 3300044683 | Bacteria | 1169 |
| 142 | Ga0466966_0813319 | 3300044684 | Bacteria | 563 |
| 143 | Ga0466961_0013410 | 3300044693 | Bacteria | 5248 |
| 144 | Ga0466961_0171300 | 3300044693 | Bacteria | 1350 |
| 145 | Ga0466961_0946012 | 3300044693 | Bacteria | 512 |
| 146 | Ga0466963_0006509 | 3300044694 | Bacteria | 6915 |
| 147 | Ga0466963_0008389 | 3300044694 | Bacteria | 6190 |
| 148 | Ga0466963_0031876 | 3300044694 | Bacteria | 3408 |
| 149 | Ga0466963_0080930 | 3300044694 | Bacteria | 2199 |
| 150 | Ga0466963_0102139 | 3300044694 | Bacteria | 1963 |
| 151 | Ga0466963_0269755 | 3300044694 | Bacteria | 1195 |
| 152 | Ga0466963_0342605 | 3300044694 | Bacteria | 1052 |
| 153 | Ga0466963_0391692 | 3300044694 | Bacteria | 979 |
| 154 | Ga0466963_0594379 | 3300044694 | Unclassified | 782 |
| 155 | Ga0466963_0850182 | 3300044694 | Bacteria | 643 |
| 156 | Ga0466963_1119716 | 3300044694 | Unclassified | 554 |
| 157 | Ga0466964_0001404 | 3300044706 | Bacteria | 8216 |
| 158 | Ga0466964_0012821 | 3300044706 | Bacteria | 3175 |
| 159 | Ga0466964_0013408 | 3300044706 | Bacteria | 3110 |
| 160 | Ga0466964_0015413 | 3300044706 | Bacteria | 2909 |
| 161 | Ga0466964_0029177 | 3300044706 | Bacteria | 2177 |
| 162 | Ga0466964_0030883 | 3300044706 | Bacteria | 2122 |
| 163 | Ga0466964_0582310 | 3300044706 | Bacteria | 611 |
| 164 | Ga0466971_0048109 | 3300044719 | Bacteria | 1917 |
| 165 | Ga0466971_0063832 | 3300044719 | Bacteria | 1667 |
| 166 | Ga0466971_0114484 | 3300044719 | Bacteria | 1246 |
| 167 | Ga0466968_0000590 | 3300044735 | Bacteria | 12374 |
| 168 | Ga0466968_0017757 | 3300044735 | Bacteria | 2848 |
| 169 | Ga0466968_0128569 | 3300044735 | Bacteria | 1151 |
| 170 | Ga0466968_0238797 | 3300044735 | Bacteria | 860 |
| 171 | Ga0466970_0000979 | 3300044765 | Bacteria | 13756 |
| 172 | Ga0466970_0239068 | 3300044765 | Bacteria | 1016 |
| 173 | Ga0466957_0019590 | 3300044842 | Bacteria | 3980 |
| 174 | Ga0466957_0055260 | 3300044842 | Bacteria | 2426 |
| 175 | Ga0466957_0086285 | 3300044842 | Bacteria | 1961 |
| 176 | Ga0466957_0122087 | 3300044842 | Bacteria | 1661 |
| 177 | Ga0466957_0150152 | 3300044842 | Bacteria | 1506 |
| 178 | Ga0466957_0422005 | 3300044842 | Bacteria | 915 |
| 179 | Ga0466957_1195428 | 3300044842 | Bacteria | 550 |
| 180 | Ga0466960_0069730 | 3300044901 | Bacteria | 1747 |
| 181 | Ga0466960_0100376 | 3300044901 | Bacteria | 1489 |
| 182 | Ga0466959_0017530 | 3300045049 | Bacteria | 5250 |
| 183 | Ga0466959_0050779 | 3300045049 | Bacteria | 3044 |
| 184 | Ga0466959_0237787 | 3300045049 | Bacteria | 1259 |
| 185 | Ga0466958_0000140 | 3300045836 | Bacteria | 24688 |
| 186 | Ga0466958_0004006 | 3300045836 | Bacteria | 7725 |
| 187 | Ga0466958_0018582 | 3300045836 | Bacteria | 4036 |
| 188 | Ga0466958_0028186 | 3300045836 | Bacteria | 3328 |
| 189 | Ga0466958_0051387 | 3300045836 | Bacteria | 2495 |
| 190 | Ga0466958_0093233 | 3300045836 | Bacteria | 1865 |
| 191 | Ga0466958_0146174 | 3300045836 | Bacteria | 1490 |
| 192 | Ga0466958_0205643 | 3300045836 | Bacteria | 1253 |
| 193 | Ga0466967_0010772 | 3300045976 | Bacteria | 6876 |
| 194 | Ga0466967_0036193 | 3300045976 | Bacteria | 4211 |
| 195 | Ga0466967_0051080 | 3300045976 | Bacteria | 3622 |
| 196 | Ga0466967_0076678 | 3300045976 | Bacteria | 3007 |
| 197 | Ga0466967_0080369 | 3300045976 | Bacteria | 2941 |
| 198 | Ga0466967_0100917 | 3300045976 | Bacteria | 2637 |
| 199 | Ga0466967_0119816 | 3300045976 | Bacteria | 2429 |
| 200 | Ga0466967_0122022 | 3300045976 | Bacteria | 2409 |
| 201 | Ga0466967_0137794 | 3300045976 | Bacteria | 2270 |
| 202 | Ga0466967_0152908 | 3300045976 | Bacteria | 2158 |
| 203 | Ga0466967_0173806 | 3300045976 | Bacteria | 2028 |
| 204 | Ga0466967_0223191 | 3300045976 | Bacteria | 1791 |
| 205 | Ga0466967_0226883 | 3300045976 | Bacteria | 1777 |
| 206 | Ga0466967_0349791 | 3300045976 | Bacteria | 1430 |
| 207 | Ga0466967_0385580 | 3300045976 | Bacteria | 1361 |
| 208 | Ga0466967_0393375 | 3300045976 | Bacteria | 1347 |
| 209 | Ga0466967_0474078 | 3300045976 | Unclassified | 1225 |
| 210 | Ga0466967_1283681 | 3300045976 | Unclassified | 729 |
| 211 | Ga0466967_1512634 | 3300045976 | Bacteria | 668 |
| 212 | Ga0466967_1664486 | 3300045976 | Bacteria | 635 |
| 213 | Ga0466967_1858893 | 3300045976 | Unclassified | 599 |
| 214 | Ga0466967_1883890 | 3300045976 | Bacteria | 595 |
| 215 | Ga0495592_0069467 | 3300046454 | Bacteria | 2568 |
| 216 | Ga0495592_0228899 | 3300046454 | Bacteria | 1239 |
| 217 | Ga0495603_0014963 | 3300046455 | Bacteria | 4691 |
| 218 | Ga0495629_0300123 | 3300046459 | Bacteria | 1100 |
| 219 | Ga0495641_0021731 | 3300046461 | Bacteria | 3223 |
| 220 | Ga0495641_0044960 | 3300046461 | Bacteria | 2034 |
| 221 | Ga0495651_0001663 | 3300046462 | Bacteria | 17191 |
| 222 | Ga0495651_0201716 | 3300046462 | Bacteria | 1391 |
| 223 | Ga0495653_0011382 | 3300046463 | Bacteria | 7268 |
| 224 | Ga0495653_0018639 | 3300046463 | Bacteria | 5634 |
| 225 | Ga0495653_0284983 | 3300046463 | Bacteria | 1083 |
| 226 | Ga0495653_0534634 | 3300046463 | Bacteria | 727 |
| 227 | Ga0495582_0061663 | 3300046473 | Bacteria | 2071 |
| 228 | Ga0495664_0120156 | 3300046477 | Bacteria | 1589 |
| 229 | Ga0495664_0252455 | 3300046477 | Bacteria | 1066 |
| 230 | Ga0495664_0287405 | 3300046477 | Bacteria | 993 |
| 231 | Ga0495594_0086811 | 3300046499 | Bacteria | 1751 |
| 232 | Ga0495594_0404445 | 3300046499 | Unclassified | 777 |
| 233 | Ga0495608_0215122 | 3300046511 | Bacteria | 1207 |
| 234 | Ga0495608_0280398 | 3300046511 | Bacteria | 1034 |
| 235 | Ga0495628_0161186 | 3300046516 | Bacteria | 1704 |
| 236 | Ga0495628_0226316 | 3300046516 | Bacteria | 1403 |
| 237 | Ga0495630_0006287 | 3300046517 | Bacteria | 8436 |
| 238 | Ga0495630_0039182 | 3300046517 | Bacteria | 3544 |
| 239 | Ga0495630_1500899 | 3300046517 | Bacteria | 506 |
| 240 | Ga0495652_0175096 | 3300046529 | Bacteria | 1652 |
| 241 | Ga0495652_0211394 | 3300046529 | Unclassified | 1464 |
| 242 | Ga0495652_0258241 | 3300046529 | Bacteria | 1287 |
| 243 | Ga0495652_0857384 | 3300046529 | Bacteria | 601 |
| 244 | Ga0495586_0563730 | 3300046535 | Bacteria | 658 |
| 245 | Ga0495587_0010781 | 3300046536 | Bacteria | 5803 |
| 246 | Ga0495587_0026013 | 3300046536 | Unclassified | 3571 |
| 247 | Ga0495587_0088967 | 3300046536 | Bacteria | 1785 |
| 248 | Ga0495645_0064929 | 3300046543 | Bacteria | 2641 |
| 249 | Ga0495645_0075454 | 3300046543 | Bacteria | 2426 |
| 250 | Ga0495622_0523178 | 3300046557 | Bacteria | 506 |
| 251 | Ga0495667_0159235 | 3300046559 | Bacteria | 1452 |
| 252 | Ga0495667_0229167 | 3300046559 | Bacteria | 1184 |
| 253 | Ga0495656_0079669 | 3300046615 | Unclassified | 1475 |
| 254 | Ga0495656_0479479 | 3300046615 | Bacteria | 658 |
| 255 | Ga0495635_0059215 | 3300046663 | Bacteria | 2634 |
| 256 | Ga0495635_0388652 | 3300046663 | Bacteria | 928 |
| 257 | Ga0495635_0391181 | 3300046663 | Unclassified | 924 |
| 258 | Ga0495588_0141519 | 3300046674 | Bacteria | 1271 |
| 259 | Ga0495657_0055638 | 3300046675 | Bacteria | 2638 |
| 260 | Ga0495599_0004281 | 3300046678 | Bacteria | 8437 |
| 261 | Ga0495599_0029445 | 3300046678 | Bacteria | 3443 |
| 262 | Ga0495599_0054656 | 3300046678 | Bacteria | 2501 |
| 263 | Ga0495623_0124156 | 3300046679 | Bacteria | 1551 |
| 264 | Ga0495658_0618645 | 3300046683 | Bacteria | 694 |
| 265 | Ga0495613_0199063 | 3300046689 | Bacteria | 1413 |
| 266 | Ga0495613_0559206 | 3300046689 | Bacteria | 765 |
| 267 | Ga0495600_0009590 | 3300046809 | Bacteria | 5986 |
| 268 | Ga0495600_0098640 | 3300046809 | Bacteria | 1904 |
| 269 | Ga0495600_0138946 | 3300046809 | Bacteria | 1577 |
| 270 | Ga0495581_0039782 | 3300047315 | Unclassified | 2722 |
| 271 | Ga0495604_0339977 | 3300047317 | Bacteria | 999 |
| 272 | Ga0495604_0696704 | 3300047317 | Unclassified | 645 |
| 273 | Ga0495674_0336931 | 3300047319 | Bacteria | 1226 |
| 274 | Ga0495674_0426328 | 3300047319 | Bacteria | 1068 |
| 275 | Ga0495674_0467779 | 3300047319 | Bacteria | 1011 |
| 276 | Ga0495676_0042335 | 3300047321 | Unclassified | 3740 |
| 277 | Ga0495676_0467348 | 3300047321 | Bacteria | 831 |
| 278 | Ga0495680_0011483 | 3300047322 | Bacteria | 7837 |
| 279 | Ga0495680_0090808 | 3300047322 | Bacteria | 2290 |
| 280 | Ga0495680_0520179 | 3300047322 | Bacteria | 805 |
| 281 | Ga0495675_0060698 | 3300047444 | Bacteria | 2396 |
| 282 | Ga0495675_0246144 | 3300047444 | Bacteria | 1075 |
| 283 | Ga0495675_0284569 | 3300047444 | Bacteria | 985 |
| 284 | Ga0495675_0739972 | 3300047444 | Unclassified | 548 |
| 285 | Ga0495684_0132108 | 3300047471 | Bacteria | 1874 |
| 286 | Ga0495684_0160615 | 3300047471 | Bacteria | 1676 |
| 287 | Ga0495602_0012801 | 3300048088 | Bacteria | 8601 |
| 288 | Ga0495602_0406658 | 3300048088 | Bacteria | 969 |
| 289 | Ga0496100_0209314 | 3300048903 | Bacteria | 1426 |
| 290 | Ga0496100_0880119 | 3300048903 | Bacteria | 703 |
| 291 | Ga0496101_0264555 | 3300048904 | Bacteria | 1342 |
| 292 | Ga0496101_0446385 | 3300048904 | Bacteria | 1020 |
| 293 | Ga0496102_0008528 | 3300048905 | Bacteria | 8788 |
| 294 | Ga0496102_0024634 | 3300048905 | Bacteria | 5351 |
| 295 | Ga0496102_0028803 | 3300048905 | Bacteria | 4965 |
| 296 | Ga0496103_0159803 | 3300048906 | Bacteria | 1445 |
| 297 | Ga0496103_0325971 | 3300048906 | Bacteria | 988 |
| 298 | Ga0496104_0043687 | 3300048907 | Bacteria | 4209 |
| 299 | Ga0496104_0088723 | 3300048907 | Bacteria | 2954 |
| 300 | Ga0496104_0316442 | 3300048907 | Bacteria | 1474 |
| 301 | Ga0496105_0021065 | 3300048908 | Bacteria | 5273 |
| 302 | Ga0496105_0352714 | 3300048908 | Bacteria | 1175 |
| 303 | Ga0496106_0005699 | 3300048909 | Bacteria | 9210 |
| 304 | Ga0496106_0143174 | 3300048909 | Bacteria | 1881 |
| 305 | Ga0496106_1115582 | 3300048909 | Unclassified | 618 |
| 306 | Ga0496106_1195764 | 3300048909 | Unclassified | 593 |
| 307 | Ga0496107_0004781 | 3300048910 | Bacteria | 9201 |
| 308 | Ga0496107_0174127 | 3300048910 | Bacteria | 1597 |
| 309 | Ga0496107_1154521 | 3300048910 | Bacteria | 558 |
| 310 | Ga0496108_0003838 | 3300048911 | Bacteria | 12053 |
| 311 | Ga0496109_0045964 | 3300048912 | Bacteria | 3964 |
| 312 | Ga0496109_0116041 | 3300048912 | Bacteria | 2491 |
| 313 | Ga0496110_0011946 | 3300048913 | Bacteria | 7133 |
| 314 | Ga0496110_0062061 | 3300048913 | Bacteria | 3300 |
| 315 | Ga0496110_0139474 | 3300048913 | Bacteria | 2192 |
| 316 | Ga0496110_1277218 | 3300048913 | Unclassified | 643 |
| 317 | Ga0496110_1455941 | 3300048913 | Unclassified | 594 |
| 318 | Ga0496111_0000083 | 3300048914 | Bacteria | 39397 |
| 319 | Ga0496111_0688787 | 3300048914 | Bacteria | 744 |
| 320 | Ga0496111_0721436 | 3300048914 | Bacteria | 724 |
| 321 | Ga0496112_0205644 | 3300048915 | Bacteria | 1927 |
| 322 | Ga0496112_1783090 | 3300048915 | Unclassified | 527 |
| 323 | Ga0496112_1927924 | 3300048915 | Bacteria | 502 |
| 324 | Ga0496113_0042968 | 3300048916 | Bacteria | 3342 |
| 325 | Ga0496113_0107713 | 3300048916 | Bacteria | 2166 |
| 326 | Ga0496113_1186954 | 3300048916 | Unclassified | 596 |
| 327 | Ga0496113_1537703 | 3300048916 | Bacteria | 513 |
| 328 | Ga0496114_0012457 | 3300048917 | Bacteria | 6808 |
| 329 | Ga0496114_0145240 | 3300048917 | Bacteria | 2056 |
| 330 | Ga0496114_1768969 | 3300048917 | Unclassified | 506 |
| 331 | Ga0496115_0030832 | 3300048918 | Bacteria | 4221 |
| 332 | Ga0496115_0046057 | 3300048918 | Bacteria | 3484 |
| 333 | Ga0496115_0112089 | 3300048918 | Bacteria | 2241 |
| 334 | Ga0501067_0023946 | 3300049583 | Bacteria | 3385 |
| 335 | Ga0501067_0188821 | 3300049583 | Unclassified | 1147 |
| 336 | Ga0501067_0303393 | 3300049583 | Bacteria | 889 |
| 337 | Ga0501069_0021026 | 3300049585 | Bacteria | 3539 |
| 338 | Ga0501069_0258012 | 3300049585 | Bacteria | 1017 |
| 339 | nmdc:mga08y16_214257_c1 | 3300050511 | Unclassified | 1994 |
| 340 | nmdc:mga0n895_137575_c1 | 3300050512 | Unclassified | 2470 |
| 341 | nmdc:mga0n895_259602_c1 | 3300050512 | Unclassified | 1763 |
| 342 | nmdc:mga0n895_964472_c1 | 3300050512 | Bacteria | 835 |
| 343 | nmdc:mga0rr50_919497_c1 | 3300050513 | Bacteria | 746 |
| 344 | nmdc:mga08x19_23694_c1 | 3300050514 | Unclassified | 3809 |
| 345 | nmdc:mga0a205_203878_c1 | 3300050515 | Bacteria | 1867 |
| 346 | Ga0495601_0000253 | 3300053077 | Bacteria | 28610 |
| 347 | Ga0495601_0057368 | 3300053077 | Bacteria | 2467 |
| 348 | Ga0495601_0120542 | 3300053077 | Bacteria | 1703 |
| 349 | Ga0495601_0149321 | 3300053077 | Bacteria | 1525 |
| 350 | Ga0495601_0767219 | 3300053077 | Unclassified | 613 |
| 351 | Ga0495601_0812376 | 3300053077 | Bacteria | 593 |
| 352 | Ga0495612_0123019 | 3300053078 | Bacteria | 1117 |
| 353 | Ga0495612_0296450 | 3300053078 | Bacteria | 725 |
| 354 | Ga0495655_0284833 | 3300053083 | Unclassified | 564 |
| 355 | Ga0495595_0177174 | 3300053084 | Bacteria | 1056 |
| 356 | Ga0495595_0287792 | 3300053084 | Bacteria | 825 |
| 357 | Ga0495619_0038307 | 3300053085 | Bacteria | 3127 |
| 358 | Ga0466962_0018507 | 3300061719 | Bacteria | 3351 |
| 359 | Ga0466962_0102256 | 3300061719 | Bacteria | 1376 |
| 360 | Ga0466962_0247546 | 3300061719 | Bacteria | 875 |
| 361 | Ga0466962_0249559 | 3300061719 | Bacteria | 872 |
| 362 | Ga0466962_0275067 | 3300061719 | Bacteria | 830 |
| 363 | Ga0530510_0021564 | 3300061734 | Bacteria | 4584 |
| 364 | Ga0466960_0747336 | |||
| 365 | Ga0070683_100234475 | |||
| 366 | Ga0070682_100337728 | |||
| 367 | Ga0070689_101589463 | |||
| 368 | Ga0070671_100305838 | |||
| 369 | Ga0070709_11463421 | |||
| 370 | Ga0070714_100004497 | |||
| 371 | Ga0070714_100092820 | |||
| 372 | Ga0070714_100379932 | |||
| 373 | Ga0070714_100836609 | |||
| 374 | Ga0070713_100196816 | |||
| 375 | Ga0070713_100541347 | |||
| 376 | Ga0070710_10019873 | |||
| 377 | Ga0070711_100042961 | |||
| 378 | Ga0070711_100111280 | |||
| 379 | Ga0070711_101878536 | |||
| 380 | Ga0070694_100210623 | |||
| 381 | Ga0070678_100509351 | |||
| 382 | Ga0070681_10103778 | |||
| 383 | Ga0070681_10397335 | |||
| 384 | Ga0070681_10482271 | |||
| 385 | Ga0070706_100001156 | |||
| 386 | Ga0070706_101144620 | |||
| 387 | Ga0070707_100062202 | |||
| 388 | Ga0070698_100031068 | |||
| 389 | Ga0070698_100559049 | |||
| 390 | Ga0070698_101676601 | |||
| 391 | Ga0070679_100228462 | |||
| 392 | Ga0070679_100797142 | |||
| 393 | Ga0070684_100922219 | |||
| 394 | Ga0070684_101125606 | |||
| 395 | Ga0070697_100145602 | |||
| 396 | Ga0070697_100710144 | |||
| 397 | Ga0070697_100897879 | |||
| 398 | Ga0070672_100437862 | |||
| 399 | Ga0070686_100129019 | |||
| 400 | Ga0070695_100000074 | |||
| 401 | Ga0070695_100452853 | |||
| 402 | Ga0070696_101293420 | |||
| 403 | Ga0068855_100059609 | |||
| 404 | Ga0068856_100033683 | |||
| 405 | Ga0068856_100058093 | |||
| 406 | Ga0070717_10017341 | |||
| 407 | Ga0070716_100704845 | |||
| 408 | Ga0070712_100003371 | |||
| 409 | Ga0070712_100435208 | |||
| 410 | Ga0075433_10097424 | |||
| 411 | Ga0075434_100133425 | |||
| 412 | Ga0075434_100257661 | |||
| 413 | Ga0075436_100251222 | |||
| 414 | Ga0075436_100323529 | |||
| 415 | Ga0075435_100187182 | |||
| 416 | Ga0075435_100783196 | |||
| 417 | Ga0111539_10263084 | |||
| 418 | Ga0111539_13494046 | |||
| 419 | Ga0105245_10000001 | |||
| 420 | Ga0105245_10923911 | |||
| 421 | Ga0114129_10228483 | |||
| 422 | Ga0114129_10354135 | |||
| 423 | Ga0105241_10948932 | |||
| 424 | Ga0105241_11270989 | |||
| 425 | Ga0105242_12448950 | |||
| 426 | Ga0105248_10163944 | |||
| 427 | Ga0105248_10259599 | |||
| 428 | Ga0105237_10037397 | |||
| 429 | Ga0105237_12633914 | |||
| 430 | Ga0157370_10103146 | |||
| 431 | Ga0157370_10103448 | |||
| 432 | Ga0157370_11029186 | |||
| 433 | Ga0157369_10036665 | |||
| 434 | Ga0157369_10481047 | |||
| 435 | Ga0157369_10942258 | |||
| 436 | Ga0163162_10428057 | |||
| 437 | Ga0157372_10009801 | |||
| 438 | Ga0157375_10118400 | |||
| 439 | Ga0182008_10004812 | |||
| 440 | Ga0182008_10052897 | |||
| 441 | Ga0157376_11309044 | |||
| 442 | Ga0157376_11919824 | |||
| 443 | Ga0182007_10190222 | |||
| 444 | Ga0207699_10287546 | |||
| 445 | Ga0207684_10000016 | |||
| 446 | Ga0207684_10025905 | |||
| 447 | Ga0207684_10836009 | |||
| 448 | Ga0207684_11553075 | |||
| 449 | Ga0207707_10138236 | |||
| 450 | Ga0207707_10393674 | |||
| 451 | Ga0207695_10465756 | |||
| 452 | Ga0207671_10152683 | |||
| 453 | Ga0207693_10006220 | |||
| 454 | Ga0207693_10277730 | |||
| 455 | Ga0207663_10034663 | |||
| 456 | Ga0207652_10552906 | |||
| 457 | Ga0207652_10636726 | |||
| 458 | Ga0207646_10080795 | |||
| 459 | Ga0207646_11575730 | |||
| 460 | Ga0207646_11673675 | |||
| 461 | Ga0207687_10000004 | |||
| 462 | Ga0207687_10116569 | |||
| 463 | Ga0207687_10648297 | |||
| 464 | Ga0207700_10054163 | |||
| 465 | Ga0207700_10526734 | |||
| 466 | Ga0207700_11266254 | |||
| 467 | Ga0207664_10001852 | |||
| 468 | Ga0207664_10020529 | |||
| 469 | Ga0207664_10025873 | |||
| 470 | Ga0207664_10814251 | |||
| 471 | Ga0207644_10297387 | |||
| 472 | Ga0207686_10655572 | |||
| 473 | Ga0207691_10134544 | |||
| 474 | Ga0207711_10310436 | |||
| 475 | Ga0207711_10548742 | |||
| 476 | Ga0207667_10399967 | |||
| 477 | Ga0207702_10120795 | |||
| 478 | Ga0207676_11690764 | |||
| 479 | Ga0207683_10634007 | |||
| 480 | Ga0207698_10953783 | |||
| 481 | Ga0265318_10003753 | |||
| 482 | Ga0373928_0071282 | |||
| 483 | Ga0373945_0397689 | |||
| 484 | Ga0373946_0128603 | |||
| 485 | Ga0373955_0045849 | |||
| 486 | Ga0373924_0265996 | |||
| 487 | Ga0373935_0852857 | |||
| 488 | Ga0373947_0099885 | |||
| 489 | Ga0373937_0380010 | |||
| 490 | Ga0373925_0170765 | |||
| 491 | Ga0395900_0133415 | |||
| 492 | Ga0395898_0208231 | |||
| 493 | Ga0395905_0110185 | |||
| 494 | Ga0395905_0120779 | |||
| 495 | Ga0436365_0369417 | |||
| 496 | Ga0436365_0579854 | |||
| 497 | Ga0436360_0558782 | |||
| 498 | Ga0436363_1218413 | |||
| 499 | Ga0436363_1689239 | |||
| 500 | Ga0436362_0731494 | |||
| 501 | Ga0451807_1591040 | |||
| 502 | Ga0466972_0154932 | |||
| 503 | Ga0466965_0042989 | |||
| 504 | Ga0466965_0163222 | |||
| 505 | Ga0466966_0813319 | |||
| 506 | Ga0466961_0013410 | |||
| 507 | Ga0466961_0171300 | |||
| 508 | Ga0466961_0946012 | |||
| 509 | Ga0466963_0006509 | |||
| 510 | Ga0466963_0008389 | |||
| 511 | Ga0466963_0031876 | |||
| 512 | Ga0466963_0080930 | |||
| 513 | Ga0466963_0102139 | |||
| 514 | Ga0466963_0269755 | |||
| 515 | Ga0466963_0342605 | |||
| 516 | Ga0466963_0391692 | |||
| 517 | Ga0466963_0594379 | |||
| 518 | Ga0466963_0850182 | |||
| 519 | Ga0466963_1119716 | |||
| 520 | Ga0466964_0001404 | |||
| 521 | Ga0466964_0012821 | |||
| 522 | Ga0466964_0013408 | |||
| 523 | Ga0466964_0015413 | |||
| 524 | Ga0466964_0029177 | |||
| 525 | Ga0466964_0030883 | |||
| 526 | Ga0466964_0582310 | |||
| 527 | Ga0466971_0048109 | |||
| 528 | Ga0466971_0063832 | |||
| 529 | Ga0466971_0114484 | |||
| 530 | Ga0466968_0000590 | |||
| 531 | Ga0466968_0017757 | |||
| 532 | Ga0466968_0128569 | |||
| 533 | Ga0466968_0238797 | |||
| 534 | Ga0466970_0000979 | |||
| 535 | Ga0466970_0239068 | |||
| 536 | Ga0466957_0019590 | |||
| 537 | Ga0466957_0055260 | |||
| 538 | Ga0466957_0086285 | |||
| 539 | Ga0466957_0122087 | |||
| 540 | Ga0466957_0150152 | |||
| 541 | Ga0466957_0422005 | |||
| 542 | Ga0466957_1195428 | |||
| 543 | Ga0466960_0069730 | |||
| 544 | Ga0466960_0100376 | |||
| 545 | Ga0466959_0017530 | |||
| 546 | Ga0466959_0050779 | |||
| 547 | Ga0466959_0237787 | |||
| 548 | Ga0466958_0000140 | |||
| 549 | Ga0466958_0004006 | |||
| 550 | Ga0466958_0018582 | |||
| 551 | Ga0466958_0028186 | |||
| 552 | Ga0466958_0051387 | |||
| 553 | Ga0466958_0093233 | |||
| 554 | Ga0466958_0146174 | |||
| 555 | Ga0466958_0205643 | |||
| 556 | Ga0466967_0010772 | |||
| 557 | Ga0466967_0036193 | |||
| 558 | Ga0466967_0051080 | |||
| 559 | Ga0466967_0076678 | |||
| 560 | Ga0466967_0080369 | |||
| 561 | Ga0466967_0100917 | |||
| 562 | Ga0466967_0119816 | |||
| 563 | Ga0466967_0122022 | |||
| 564 | Ga0466967_0137794 | |||
| 565 | Ga0466967_0152908 | |||
| 566 | Ga0466967_0173806 | |||
| 567 | Ga0466967_0223191 | |||
| 568 | Ga0466967_0226883 | |||
| 569 | Ga0466967_0349791 | |||
| 570 | Ga0466967_0385580 | |||
| 571 | Ga0466967_0393375 | |||
| 572 | Ga0466967_0474078 | |||
| 573 | Ga0466967_1283681 | |||
| 574 | Ga0466967_1512634 | |||
| 575 | Ga0466967_1664486 | |||
| 576 | Ga0466967_1858893 | |||
| 577 | Ga0466967_1883890 | |||
| 578 | Ga0495592_0069467 | |||
| 579 | Ga0495592_0228899 | |||
| 580 | Ga0495603_0014963 | |||
| 581 | Ga0495629_0300123 | |||
| 582 | Ga0495641_0021731 | |||
| 583 | Ga0495641_0044960 | |||
| 584 | Ga0495651_0001663 | |||
| 585 | Ga0495651_0201716 | |||
| 586 | Ga0495653_0011382 | |||
| 587 | Ga0495653_0018639 | |||
| 588 | Ga0495653_0284983 | |||
| 589 | Ga0495653_0534634 | |||
| 590 | Ga0495582_0061663 | |||
| 591 | Ga0495664_0120156 | |||
| 592 | Ga0495664_0252455 | |||
| 593 | Ga0495664_0287405 | |||
| 594 | Ga0495594_0086811 | |||
| 595 | Ga0495594_0404445 | |||
| 596 | Ga0495608_0215122 | |||
| 597 | Ga0495608_0280398 | |||
| 598 | Ga0495628_0161186 | |||
| 599 | Ga0495628_0226316 | |||
| 600 | Ga0495630_0006287 | |||
| 601 | Ga0495630_0039182 | |||
| 602 | Ga0495630_1500899 | |||
| 603 | Ga0495652_0175096 | |||
| 604 | Ga0495652_0211394 | |||
| 605 | Ga0495652_0258241 | |||
| 606 | Ga0495652_0857384 | |||
| 607 | Ga0495586_0563730 | |||
| 608 | Ga0495587_0010781 | |||
| 609 | Ga0495587_0026013 | |||
| 610 | Ga0495587_0088967 | |||
| 611 | Ga0495645_0064929 | |||
| 612 | Ga0495645_0075454 | |||
| 613 | Ga0495622_0523178 | |||
| 614 | Ga0495667_0159235 | |||
| 615 | Ga0495667_0229167 | |||
| 616 | Ga0495656_0079669 | |||
| 617 | Ga0495656_0479479 | |||
| 618 | Ga0495635_0059215 | |||
| 619 | Ga0495635_0388652 | |||
| 620 | Ga0495635_0391181 | |||
| 621 | Ga0495588_0141519 | |||
| 622 | Ga0495657_0055638 | |||
| 623 | Ga0495599_0004281 | |||
| 624 | Ga0495599_0029445 | |||
| 625 | Ga0495599_0054656 | |||
| 626 | Ga0495623_0124156 | |||
| 627 | Ga0495658_0618645 | |||
| 628 | Ga0495613_0199063 | |||
| 629 | Ga0495613_0559206 | |||
| 630 | Ga0495600_0009590 | |||
| 631 | Ga0495600_0098640 | |||
| 632 | Ga0495600_0138946 | |||
| 633 | Ga0495581_0039782 | |||
| 634 | Ga0495604_0339977 | |||
| 635 | Ga0495604_0696704 | |||
| 636 | Ga0495674_0336931 | |||
| 637 | Ga0495674_0426328 | |||
| 638 | Ga0495674_0467779 | |||
| 639 | Ga0495676_0042335 | |||
| 640 | Ga0495676_0467348 | |||
| 641 | Ga0495680_0011483 | |||
| 642 | Ga0495680_0090808 | |||
| 643 | Ga0495680_0520179 | |||
| 644 | Ga0495675_0060698 | |||
| 645 | Ga0495675_0246144 | |||
| 646 | Ga0495675_0284569 | |||
| 647 | Ga0495675_0739972 | |||
| 648 | Ga0495684_0132108 | |||
| 649 | Ga0495684_0160615 | |||
| 650 | Ga0495602_0012801 | |||
| 651 | Ga0495602_0406658 | |||
| 652 | Ga0496100_0209314 | |||
| 653 | Ga0496100_0880119 | |||
| 654 | Ga0496101_0264555 | |||
| 655 | Ga0496101_0446385 | |||
| 656 | Ga0496102_0008528 | |||
| 657 | Ga0496102_0024634 | |||
| 658 | Ga0496102_0028803 | |||
| 659 | Ga0496103_0159803 | |||
| 660 | Ga0496103_0325971 | |||
| 661 | Ga0496104_0043687 | |||
| 662 | Ga0496104_0088723 | |||
| 663 | Ga0496104_0316442 | |||
| 664 | Ga0496105_0021065 | |||
| 665 | Ga0496105_0352714 | |||
| 666 | Ga0496106_0005699 | |||
| 667 | Ga0496106_0143174 | |||
| 668 | Ga0496106_1115582 | |||
| 669 | Ga0496106_1195764 | |||
| 670 | Ga0496107_0004781 | |||
| 671 | Ga0496107_0174127 | |||
| 672 | Ga0496107_1154521 | |||
| 673 | Ga0496108_0003838 | |||
| 674 | Ga0496109_0045964 | |||
| 675 | Ga0496109_0116041 | |||
| 676 | Ga0496110_0011946 | |||
| 677 | Ga0496110_0062061 | |||
| 678 | Ga0496110_0139474 | |||
| 679 | Ga0496110_1277218 | |||
| 680 | Ga0496110_1455941 | |||
| 681 | Ga0496111_0000083 | |||
| 682 | Ga0496111_0688787 | |||
| 683 | Ga0496111_0721436 | |||
| 684 | Ga0496112_0205644 | |||
| 685 | Ga0496112_1783090 | |||
| 686 | Ga0496112_1927924 | |||
| 687 | Ga0496113_0042968 | |||
| 688 | Ga0496113_0107713 | |||
| 689 | Ga0496113_1186954 | |||
| 690 | Ga0496113_1537703 | |||
| 691 | Ga0496114_0012457 | |||
| 692 | Ga0496114_0145240 | |||
| 693 | Ga0496114_1768969 | |||
| 694 | Ga0496115_0030832 | |||
| 695 | Ga0496115_0046057 | |||
| 696 | Ga0496115_0112089 | |||
| 697 | Ga0501067_0023946 | |||
| 698 | Ga0501067_0188821 | |||
| 699 | Ga0501067_0303393 | |||
| 700 | Ga0501069_0021026 | |||
| 701 | Ga0501069_0258012 | |||
| 702 | nmdc:mga08y16_214257_c1 | |||
| 703 | nmdc:mga0n895_137575_c1 | |||
| 704 | nmdc:mga0n895_259602_c1 | |||
| 705 | nmdc:mga0n895_964472_c1 | |||
| 706 | nmdc:mga0rr50_919497_c1 | |||
| 707 | nmdc:mga08x19_23694_c1 | |||
| 708 | nmdc:mga0a205_203878_c1 | |||
| 709 | Ga0495601_0000253 | |||
| 710 | Ga0495601_0057368 | |||
| 711 | Ga0495601_0120542 | |||
| 712 | Ga0495601_0149321 | |||
| 713 | Ga0495601_0767219 | |||
| 714 | Ga0495601_0812376 | |||
| 715 | Ga0495612_0123019 | |||
| 716 | Ga0495612_0296450 | |||
| 717 | Ga0495655_0284833 | |||
| 718 | Ga0495595_0177174 | |||
| 719 | Ga0495595_0287792 | |||
| 720 | Ga0495619_0038307 | |||
| 721 | Ga0466962_0018507 | |||
| 722 | Ga0466962_0102256 | |||
| 723 | Ga0466962_0247546 | |||
| 724 | Ga0466962_0249559 | |||
| 725 | Ga0466962_0275067 | |||
| 726 | Ga0530510_0021564 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cg3-assembly1.cif.gz_F | staggered ring conformation of cthsp104 (hsp104 from chaetomium thermophilum) | 0.5109 | 25 | 93 |
| 2xsj-assembly1.cif.gz_E | structure of desulforubidin from desulfomicrobium norvegicum | 0.464 | 52 | 91 |
| 6ncl-assembly1.cif.gz_a0 | near-atomic structure of icosahedrally averaged pbcv-1 capsid | 0.4634 | 8 | 90 |
| 3v51-assembly1.cif.gz_A | calcium-dependent protein kinase 1 from toxoplasma gondii (tgcdpk1) in complex with inhibitor rm-1-176 | 0.4533 | 3 | 93 |
| 3a14-assembly1.cif.gz_B | crystal structure of dxr from thermotoga maritima, in complex with nadph | 0.4408 | 31 | 94 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6PTB7_39_134_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.5815 | 3 | 72 | 1.10.10.60 |
| af_D3ZHX4_1_59_1.10.8.1020 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecQ-mediated genome instability protein 1, N-terminal domain | 0.5587 | 33 | 94 | 1.10.8.1020 |
| af_Q7XT13_20_110_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.5577 | 7 | 71 | 1.10.10.60 |
| af_K7W4Y3_19_108_2.60.40.150 | Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain | 0.5476 | 8 | 71 | 2.60.40.150 |
| af_D3ZHX4_1_59_1.10.8.1020 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecQ-mediated genome instability protein 1, N-terminal domain | 0.5182 | 33 | 94 | 1.10.8.1020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W7QU73-F1-model_v4 | Uncharacterized protein | 0.9921 | 3 | 91 |
|
| AF-A0A7V9FL84-F1-model_v4 | Uncharacterized protein | 0.991 | 6 | 90 |
|
| AF-A0A537ZRM2-F1-model_v4 | Uncharacterized protein | 0.9875 | 3 | 91 |
|
| AF-A0A7W1Q797-F1-model_v4 | Uncharacterized protein | 0.9824 | 3 | 93 |
|
| AF-A0A542ZNA3-F1-model_v4 | Uncharacterized protein | 0.9816 | 3 | 91 |
|