F423062

General Info

Members Datasets Scaffolds Average Seq Length
363 164 726 94

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0747336|Ga0466960_0747336_185_520
Length 111
Sequence LTERVFATCAEHARIERMGRASAVADLLHEAAETHHVVYRIVDGDDPDWASWYADWLLTLSELPQLLGSTPVRSHLVHTLVELDRAYTTESREECWEDWYAERLLAEFASV

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
70 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
71 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
72 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
160 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.67
Rhizosphere 86.23
Stem 0
Stem Tuber 0
Unclassified 15.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0747336 3300044901 Unclassified 589
2 Ga0070683_100234475 3300005329 Bacteria 1745
3 Ga0070682_100337728 3300005337 Unclassified 1119
4 Ga0070689_101589463 3300005340 Unclassified 593
5 Ga0070671_100305838 3300005355 Bacteria 1354
6 Ga0070709_11463421 3300005434 Bacteria 554
7 Ga0070714_100004497 3300005435 Bacteria 10510
8 Ga0070714_100092820 3300005435 Unclassified 2646
9 Ga0070714_100379932 3300005435 Bacteria 1332
10 Ga0070714_100836609 3300005435 Bacteria 892
11 Ga0070713_100196816 3300005436 Unclassified 1818
12 Ga0070713_100541347 3300005436 Bacteria 1102
13 Ga0070710_10019873 3300005437 Bacteria 3478
14 Ga0070711_100042961 3300005439 Unclassified 3059
15 Ga0070711_100111280 3300005439 Bacteria 2010
16 Ga0070711_101878536 3300005439 Bacteria 526
17 Ga0070694_100210623 3300005444 Unclassified 1453
18 Ga0070678_100509351 3300005456 Bacteria 1063
19 Ga0070681_10103778 3300005458 Bacteria 2786
20 Ga0070681_10397335 3300005458 Unclassified 1290
21 Ga0070681_10482271 3300005458 Bacteria 1153
22 Ga0070706_100001156 3300005467 Bacteria 28388
23 Ga0070706_101144620 3300005467 Bacteria 716
24 Ga0070707_100062202 3300005468 Bacteria 3581
25 Ga0070698_100031068 3300005471 Bacteria 5538
26 Ga0070698_100559049 3300005471 Bacteria 1084
27 Ga0070698_101676601 3300005471 Unclassified 588
28 Ga0070679_100228462 3300005530 Bacteria 1821
29 Ga0070679_100797142 3300005530 Bacteria 888
30 Ga0070684_100922219 3300005535 Bacteria 819
31 Ga0070684_101125606 3300005535 Bacteria 738
32 Ga0070697_100145602 3300005536 Unclassified 1994
33 Ga0070697_100710144 3300005536 Bacteria 887
34 Ga0070697_100897879 3300005536 Unclassified 786
35 Ga0070672_100437862 3300005543 Bacteria 1125
36 Ga0070686_100129019 3300005544 Bacteria 1746
37 Ga0070695_100000074 3300005545 Bacteria 40508
38 Ga0070695_100452853 3300005545 Bacteria 984
39 Ga0070696_101293420 3300005546 Bacteria 619
40 Ga0068855_100059609 3300005563 Bacteria 4465
41 Ga0068856_100033683 3300005614 Bacteria 5016
42 Ga0068856_100058093 3300005614 Bacteria 3820
43 Ga0070717_10017341 3300006028 Bacteria 5602
44 Ga0070716_100704845 3300006173 Bacteria 772
45 Ga0070712_100003371 3300006175 Bacteria 9824
46 Ga0070712_100435208 3300006175 Bacteria 1089
47 Ga0075433_10097424 3300006852 Bacteria 2603
48 Ga0075434_100133425 3300006871 Unclassified 2502
49 Ga0075434_100257661 3300006871 Unclassified 1763
50 Ga0075436_100251222 3300006914 Unclassified 1259
51 Ga0075436_100323529 3300006914 Bacteria 1108
52 Ga0075435_100187182 3300007076 Bacteria 1751
53 Ga0075435_100783196 3300007076 Bacteria 830
54 Ga0111539_10263084 3300009094 Unclassified 2008
55 Ga0111539_13494046 3300009094 Unclassified 504
56 Ga0105245_10000001 3300009098 Bacteria 939270
57 Ga0105245_10923911 3300009098 Bacteria 915
58 Ga0114129_10228483 3300009147 Bacteria 2507
59 Ga0114129_10354135 3300009147 Bacteria 1944
60 Ga0105241_10948932 3300009174 Bacteria 802
61 Ga0105241_11270989 3300009174 Unclassified 700
62 Ga0105242_12448950 3300009176 Unclassified 570
63 Ga0105248_10163944 3300009177 Bacteria 2506
64 Ga0105248_10259599 3300009177 Bacteria 1956
65 Ga0105237_10037397 3300009545 Bacteria 4906
66 Ga0105237_12633914 3300009545 Unclassified 514
67 Ga0157370_10103146 3300013104 Bacteria 2670
68 Ga0157370_10103448 3300013104 Bacteria 2666
69 Ga0157370_11029186 3300013104 Unclassified 745
70 Ga0157369_10036665 3300013105 Bacteria 5371
71 Ga0157369_10481047 3300013105 Bacteria 1285
72 Ga0157369_10942258 3300013105 Unclassified 885
73 Ga0163162_10428057 3300013306 Bacteria 1455
74 Ga0157372_10009801 3300013307 Bacteria 10188
75 Ga0157375_10118400 3300013308 Bacteria 2755
76 Ga0182008_10004812 3300014497 Bacteria 7808
77 Ga0182008_10052897 3300014497 Bacteria 2012
78 Ga0157376_11309044 3300014969 Bacteria 755
79 Ga0157376_11919824 3300014969 Unclassified 629
80 Ga0182007_10190222 3300015262 Bacteria 713
81 Ga0207699_10287546 3300025906 Bacteria 1144
82 Ga0207684_10000016 3300025910 Bacteria 409263
83 Ga0207684_10025905 3300025910 Unclassified 4999
84 Ga0207684_10836009 3300025910 Bacteria 777
85 Ga0207684_11553075 3300025910 Bacteria 537
86 Ga0207707_10138236 3300025912 Bacteria 2130
87 Ga0207707_10393674 3300025912 Bacteria 1190
88 Ga0207695_10465756 3300025913 Unclassified 1147
89 Ga0207671_10152683 3300025914 Bacteria 1785
90 Ga0207693_10006220 3300025915 Bacteria 9905
91 Ga0207693_10277730 3300025915 Bacteria 1313
92 Ga0207663_10034663 3300025916 Bacteria 3021
93 Ga0207652_10552906 3300025921 Bacteria 1034
94 Ga0207652_10636726 3300025921 Unclassified 954
95 Ga0207646_10080795 3300025922 Bacteria 2907
96 Ga0207646_11575730 3300025922 Unclassified 567
97 Ga0207646_11673675 3300025922 Bacteria 547
98 Ga0207687_10000004 3300025927 Bacteria 841177
99 Ga0207687_10116569 3300025927 Bacteria 1991
100 Ga0207687_10648297 3300025927 Bacteria 893
101 Ga0207700_10054163 3300025928 Bacteria 3009
102 Ga0207700_10526734 3300025928 Bacteria 1047
103 Ga0207700_11266254 3300025928 Bacteria 657
104 Ga0207664_10001852 3300025929 Bacteria 13953
105 Ga0207664_10020529 3300025929 Bacteria 4898
106 Ga0207664_10025873 3300025929 Bacteria 4427
107 Ga0207664_10814251 3300025929 Bacteria 840
108 Ga0207644_10297387 3300025931 Bacteria 1300
109 Ga0207686_10655572 3300025934 Bacteria 831
110 Ga0207691_10134544 3300025940 Bacteria 2182
111 Ga0207711_10310436 3300025941 Bacteria 1456
112 Ga0207711_10548742 3300025941 Bacteria 1078
113 Ga0207667_10399967 3300025949 Bacteria 1398
114 Ga0207702_10120795 3300026078 Bacteria 2345
115 Ga0207676_11690764 3300026095 Unclassified 631
116 Ga0207683_10634007 3300026121 Unclassified 990
117 Ga0207698_10953783 3300026142 Bacteria 867
118 Ga0265318_10003753 3300028577 Bacteria 7558
119 Ga0373928_0071282 3300035084 Bacteria 860
120 Ga0373945_0397689 3300035116 Bacteria 603
121 Ga0373946_0128603 3300035171 Bacteria 1163
122 Ga0373955_0045849 3300035172 Bacteria 2361
123 Ga0373924_0265996 3300035410 Bacteria 760
124 Ga0373935_0852857 3300035692 Unclassified 674
125 Ga0373947_0099885 3300035725 Bacteria 1822
126 Ga0373937_0380010 3300036401 Bacteria 1339
127 Ga0373925_0170765 3300037068 Bacteria 1717
128 Ga0395900_0133415 3300037418 Bacteria 2544
129 Ga0395898_0208231 3300037466 Bacteria 1866
130 Ga0395905_0110185 3300037471 Bacteria 2585
131 Ga0395905_0120779 3300037471 Bacteria 2463
132 Ga0436365_0369417 3300039437 Bacteria 7222
133 Ga0436365_0579854 3300039437 Bacteria 1427
134 Ga0436360_0558782 3300039438 Bacteria 9074
135 Ga0436363_1218413 3300039450 Bacteria 1074
136 Ga0436363_1689239 3300039450 Bacteria 685
137 Ga0436362_0731494 3300039453 Bacteria 1569
138 Ga0451807_1591040 3300041486 Bacteria 670
139 Ga0466972_0154932 3300044658 Bacteria 1076
140 Ga0466965_0042989 3300044683 Bacteria 2230
141 Ga0466965_0163222 3300044683 Bacteria 1169
142 Ga0466966_0813319 3300044684 Bacteria 563
143 Ga0466961_0013410 3300044693 Bacteria 5248
144 Ga0466961_0171300 3300044693 Bacteria 1350
145 Ga0466961_0946012 3300044693 Bacteria 512
146 Ga0466963_0006509 3300044694 Bacteria 6915
147 Ga0466963_0008389 3300044694 Bacteria 6190
148 Ga0466963_0031876 3300044694 Bacteria 3408
149 Ga0466963_0080930 3300044694 Bacteria 2199
150 Ga0466963_0102139 3300044694 Bacteria 1963
151 Ga0466963_0269755 3300044694 Bacteria 1195
152 Ga0466963_0342605 3300044694 Bacteria 1052
153 Ga0466963_0391692 3300044694 Bacteria 979
154 Ga0466963_0594379 3300044694 Unclassified 782
155 Ga0466963_0850182 3300044694 Bacteria 643
156 Ga0466963_1119716 3300044694 Unclassified 554
157 Ga0466964_0001404 3300044706 Bacteria 8216
158 Ga0466964_0012821 3300044706 Bacteria 3175
159 Ga0466964_0013408 3300044706 Bacteria 3110
160 Ga0466964_0015413 3300044706 Bacteria 2909
161 Ga0466964_0029177 3300044706 Bacteria 2177
162 Ga0466964_0030883 3300044706 Bacteria 2122
163 Ga0466964_0582310 3300044706 Bacteria 611
164 Ga0466971_0048109 3300044719 Bacteria 1917
165 Ga0466971_0063832 3300044719 Bacteria 1667
166 Ga0466971_0114484 3300044719 Bacteria 1246
167 Ga0466968_0000590 3300044735 Bacteria 12374
168 Ga0466968_0017757 3300044735 Bacteria 2848
169 Ga0466968_0128569 3300044735 Bacteria 1151
170 Ga0466968_0238797 3300044735 Bacteria 860
171 Ga0466970_0000979 3300044765 Bacteria 13756
172 Ga0466970_0239068 3300044765 Bacteria 1016
173 Ga0466957_0019590 3300044842 Bacteria 3980
174 Ga0466957_0055260 3300044842 Bacteria 2426
175 Ga0466957_0086285 3300044842 Bacteria 1961
176 Ga0466957_0122087 3300044842 Bacteria 1661
177 Ga0466957_0150152 3300044842 Bacteria 1506
178 Ga0466957_0422005 3300044842 Bacteria 915
179 Ga0466957_1195428 3300044842 Bacteria 550
180 Ga0466960_0069730 3300044901 Bacteria 1747
181 Ga0466960_0100376 3300044901 Bacteria 1489
182 Ga0466959_0017530 3300045049 Bacteria 5250
183 Ga0466959_0050779 3300045049 Bacteria 3044
184 Ga0466959_0237787 3300045049 Bacteria 1259
185 Ga0466958_0000140 3300045836 Bacteria 24688
186 Ga0466958_0004006 3300045836 Bacteria 7725
187 Ga0466958_0018582 3300045836 Bacteria 4036
188 Ga0466958_0028186 3300045836 Bacteria 3328
189 Ga0466958_0051387 3300045836 Bacteria 2495
190 Ga0466958_0093233 3300045836 Bacteria 1865
191 Ga0466958_0146174 3300045836 Bacteria 1490
192 Ga0466958_0205643 3300045836 Bacteria 1253
193 Ga0466967_0010772 3300045976 Bacteria 6876
194 Ga0466967_0036193 3300045976 Bacteria 4211
195 Ga0466967_0051080 3300045976 Bacteria 3622
196 Ga0466967_0076678 3300045976 Bacteria 3007
197 Ga0466967_0080369 3300045976 Bacteria 2941
198 Ga0466967_0100917 3300045976 Bacteria 2637
199 Ga0466967_0119816 3300045976 Bacteria 2429
200 Ga0466967_0122022 3300045976 Bacteria 2409
201 Ga0466967_0137794 3300045976 Bacteria 2270
202 Ga0466967_0152908 3300045976 Bacteria 2158
203 Ga0466967_0173806 3300045976 Bacteria 2028
204 Ga0466967_0223191 3300045976 Bacteria 1791
205 Ga0466967_0226883 3300045976 Bacteria 1777
206 Ga0466967_0349791 3300045976 Bacteria 1430
207 Ga0466967_0385580 3300045976 Bacteria 1361
208 Ga0466967_0393375 3300045976 Bacteria 1347
209 Ga0466967_0474078 3300045976 Unclassified 1225
210 Ga0466967_1283681 3300045976 Unclassified 729
211 Ga0466967_1512634 3300045976 Bacteria 668
212 Ga0466967_1664486 3300045976 Bacteria 635
213 Ga0466967_1858893 3300045976 Unclassified 599
214 Ga0466967_1883890 3300045976 Bacteria 595
215 Ga0495592_0069467 3300046454 Bacteria 2568
216 Ga0495592_0228899 3300046454 Bacteria 1239
217 Ga0495603_0014963 3300046455 Bacteria 4691
218 Ga0495629_0300123 3300046459 Bacteria 1100
219 Ga0495641_0021731 3300046461 Bacteria 3223
220 Ga0495641_0044960 3300046461 Bacteria 2034
221 Ga0495651_0001663 3300046462 Bacteria 17191
222 Ga0495651_0201716 3300046462 Bacteria 1391
223 Ga0495653_0011382 3300046463 Bacteria 7268
224 Ga0495653_0018639 3300046463 Bacteria 5634
225 Ga0495653_0284983 3300046463 Bacteria 1083
226 Ga0495653_0534634 3300046463 Bacteria 727
227 Ga0495582_0061663 3300046473 Bacteria 2071
228 Ga0495664_0120156 3300046477 Bacteria 1589
229 Ga0495664_0252455 3300046477 Bacteria 1066
230 Ga0495664_0287405 3300046477 Bacteria 993
231 Ga0495594_0086811 3300046499 Bacteria 1751
232 Ga0495594_0404445 3300046499 Unclassified 777
233 Ga0495608_0215122 3300046511 Bacteria 1207
234 Ga0495608_0280398 3300046511 Bacteria 1034
235 Ga0495628_0161186 3300046516 Bacteria 1704
236 Ga0495628_0226316 3300046516 Bacteria 1403
237 Ga0495630_0006287 3300046517 Bacteria 8436
238 Ga0495630_0039182 3300046517 Bacteria 3544
239 Ga0495630_1500899 3300046517 Bacteria 506
240 Ga0495652_0175096 3300046529 Bacteria 1652
241 Ga0495652_0211394 3300046529 Unclassified 1464
242 Ga0495652_0258241 3300046529 Bacteria 1287
243 Ga0495652_0857384 3300046529 Bacteria 601
244 Ga0495586_0563730 3300046535 Bacteria 658
245 Ga0495587_0010781 3300046536 Bacteria 5803
246 Ga0495587_0026013 3300046536 Unclassified 3571
247 Ga0495587_0088967 3300046536 Bacteria 1785
248 Ga0495645_0064929 3300046543 Bacteria 2641
249 Ga0495645_0075454 3300046543 Bacteria 2426
250 Ga0495622_0523178 3300046557 Bacteria 506
251 Ga0495667_0159235 3300046559 Bacteria 1452
252 Ga0495667_0229167 3300046559 Bacteria 1184
253 Ga0495656_0079669 3300046615 Unclassified 1475
254 Ga0495656_0479479 3300046615 Bacteria 658
255 Ga0495635_0059215 3300046663 Bacteria 2634
256 Ga0495635_0388652 3300046663 Bacteria 928
257 Ga0495635_0391181 3300046663 Unclassified 924
258 Ga0495588_0141519 3300046674 Bacteria 1271
259 Ga0495657_0055638 3300046675 Bacteria 2638
260 Ga0495599_0004281 3300046678 Bacteria 8437
261 Ga0495599_0029445 3300046678 Bacteria 3443
262 Ga0495599_0054656 3300046678 Bacteria 2501
263 Ga0495623_0124156 3300046679 Bacteria 1551
264 Ga0495658_0618645 3300046683 Bacteria 694
265 Ga0495613_0199063 3300046689 Bacteria 1413
266 Ga0495613_0559206 3300046689 Bacteria 765
267 Ga0495600_0009590 3300046809 Bacteria 5986
268 Ga0495600_0098640 3300046809 Bacteria 1904
269 Ga0495600_0138946 3300046809 Bacteria 1577
270 Ga0495581_0039782 3300047315 Unclassified 2722
271 Ga0495604_0339977 3300047317 Bacteria 999
272 Ga0495604_0696704 3300047317 Unclassified 645
273 Ga0495674_0336931 3300047319 Bacteria 1226
274 Ga0495674_0426328 3300047319 Bacteria 1068
275 Ga0495674_0467779 3300047319 Bacteria 1011
276 Ga0495676_0042335 3300047321 Unclassified 3740
277 Ga0495676_0467348 3300047321 Bacteria 831
278 Ga0495680_0011483 3300047322 Bacteria 7837
279 Ga0495680_0090808 3300047322 Bacteria 2290
280 Ga0495680_0520179 3300047322 Bacteria 805
281 Ga0495675_0060698 3300047444 Bacteria 2396
282 Ga0495675_0246144 3300047444 Bacteria 1075
283 Ga0495675_0284569 3300047444 Bacteria 985
284 Ga0495675_0739972 3300047444 Unclassified 548
285 Ga0495684_0132108 3300047471 Bacteria 1874
286 Ga0495684_0160615 3300047471 Bacteria 1676
287 Ga0495602_0012801 3300048088 Bacteria 8601
288 Ga0495602_0406658 3300048088 Bacteria 969
289 Ga0496100_0209314 3300048903 Bacteria 1426
290 Ga0496100_0880119 3300048903 Bacteria 703
291 Ga0496101_0264555 3300048904 Bacteria 1342
292 Ga0496101_0446385 3300048904 Bacteria 1020
293 Ga0496102_0008528 3300048905 Bacteria 8788
294 Ga0496102_0024634 3300048905 Bacteria 5351
295 Ga0496102_0028803 3300048905 Bacteria 4965
296 Ga0496103_0159803 3300048906 Bacteria 1445
297 Ga0496103_0325971 3300048906 Bacteria 988
298 Ga0496104_0043687 3300048907 Bacteria 4209
299 Ga0496104_0088723 3300048907 Bacteria 2954
300 Ga0496104_0316442 3300048907 Bacteria 1474
301 Ga0496105_0021065 3300048908 Bacteria 5273
302 Ga0496105_0352714 3300048908 Bacteria 1175
303 Ga0496106_0005699 3300048909 Bacteria 9210
304 Ga0496106_0143174 3300048909 Bacteria 1881
305 Ga0496106_1115582 3300048909 Unclassified 618
306 Ga0496106_1195764 3300048909 Unclassified 593
307 Ga0496107_0004781 3300048910 Bacteria 9201
308 Ga0496107_0174127 3300048910 Bacteria 1597
309 Ga0496107_1154521 3300048910 Bacteria 558
310 Ga0496108_0003838 3300048911 Bacteria 12053
311 Ga0496109_0045964 3300048912 Bacteria 3964
312 Ga0496109_0116041 3300048912 Bacteria 2491
313 Ga0496110_0011946 3300048913 Bacteria 7133
314 Ga0496110_0062061 3300048913 Bacteria 3300
315 Ga0496110_0139474 3300048913 Bacteria 2192
316 Ga0496110_1277218 3300048913 Unclassified 643
317 Ga0496110_1455941 3300048913 Unclassified 594
318 Ga0496111_0000083 3300048914 Bacteria 39397
319 Ga0496111_0688787 3300048914 Bacteria 744
320 Ga0496111_0721436 3300048914 Bacteria 724
321 Ga0496112_0205644 3300048915 Bacteria 1927
322 Ga0496112_1783090 3300048915 Unclassified 527
323 Ga0496112_1927924 3300048915 Bacteria 502
324 Ga0496113_0042968 3300048916 Bacteria 3342
325 Ga0496113_0107713 3300048916 Bacteria 2166
326 Ga0496113_1186954 3300048916 Unclassified 596
327 Ga0496113_1537703 3300048916 Bacteria 513
328 Ga0496114_0012457 3300048917 Bacteria 6808
329 Ga0496114_0145240 3300048917 Bacteria 2056
330 Ga0496114_1768969 3300048917 Unclassified 506
331 Ga0496115_0030832 3300048918 Bacteria 4221
332 Ga0496115_0046057 3300048918 Bacteria 3484
333 Ga0496115_0112089 3300048918 Bacteria 2241
334 Ga0501067_0023946 3300049583 Bacteria 3385
335 Ga0501067_0188821 3300049583 Unclassified 1147
336 Ga0501067_0303393 3300049583 Bacteria 889
337 Ga0501069_0021026 3300049585 Bacteria 3539
338 Ga0501069_0258012 3300049585 Bacteria 1017
339 nmdc:mga08y16_214257_c1 3300050511 Unclassified 1994
340 nmdc:mga0n895_137575_c1 3300050512 Unclassified 2470
341 nmdc:mga0n895_259602_c1 3300050512 Unclassified 1763
342 nmdc:mga0n895_964472_c1 3300050512 Bacteria 835
343 nmdc:mga0rr50_919497_c1 3300050513 Bacteria 746
344 nmdc:mga08x19_23694_c1 3300050514 Unclassified 3809
345 nmdc:mga0a205_203878_c1 3300050515 Bacteria 1867
346 Ga0495601_0000253 3300053077 Bacteria 28610
347 Ga0495601_0057368 3300053077 Bacteria 2467
348 Ga0495601_0120542 3300053077 Bacteria 1703
349 Ga0495601_0149321 3300053077 Bacteria 1525
350 Ga0495601_0767219 3300053077 Unclassified 613
351 Ga0495601_0812376 3300053077 Bacteria 593
352 Ga0495612_0123019 3300053078 Bacteria 1117
353 Ga0495612_0296450 3300053078 Bacteria 725
354 Ga0495655_0284833 3300053083 Unclassified 564
355 Ga0495595_0177174 3300053084 Bacteria 1056
356 Ga0495595_0287792 3300053084 Bacteria 825
357 Ga0495619_0038307 3300053085 Bacteria 3127
358 Ga0466962_0018507 3300061719 Bacteria 3351
359 Ga0466962_0102256 3300061719 Bacteria 1376
360 Ga0466962_0247546 3300061719 Bacteria 875
361 Ga0466962_0249559 3300061719 Bacteria 872
362 Ga0466962_0275067 3300061719 Bacteria 830
363 Ga0530510_0021564 3300061734 Bacteria 4584
364 Ga0466960_0747336
365 Ga0070683_100234475
366 Ga0070682_100337728
367 Ga0070689_101589463
368 Ga0070671_100305838
369 Ga0070709_11463421
370 Ga0070714_100004497
371 Ga0070714_100092820
372 Ga0070714_100379932
373 Ga0070714_100836609
374 Ga0070713_100196816
375 Ga0070713_100541347
376 Ga0070710_10019873
377 Ga0070711_100042961
378 Ga0070711_100111280
379 Ga0070711_101878536
380 Ga0070694_100210623
381 Ga0070678_100509351
382 Ga0070681_10103778
383 Ga0070681_10397335
384 Ga0070681_10482271
385 Ga0070706_100001156
386 Ga0070706_101144620
387 Ga0070707_100062202
388 Ga0070698_100031068
389 Ga0070698_100559049
390 Ga0070698_101676601
391 Ga0070679_100228462
392 Ga0070679_100797142
393 Ga0070684_100922219
394 Ga0070684_101125606
395 Ga0070697_100145602
396 Ga0070697_100710144
397 Ga0070697_100897879
398 Ga0070672_100437862
399 Ga0070686_100129019
400 Ga0070695_100000074
401 Ga0070695_100452853
402 Ga0070696_101293420
403 Ga0068855_100059609
404 Ga0068856_100033683
405 Ga0068856_100058093
406 Ga0070717_10017341
407 Ga0070716_100704845
408 Ga0070712_100003371
409 Ga0070712_100435208
410 Ga0075433_10097424
411 Ga0075434_100133425
412 Ga0075434_100257661
413 Ga0075436_100251222
414 Ga0075436_100323529
415 Ga0075435_100187182
416 Ga0075435_100783196
417 Ga0111539_10263084
418 Ga0111539_13494046
419 Ga0105245_10000001
420 Ga0105245_10923911
421 Ga0114129_10228483
422 Ga0114129_10354135
423 Ga0105241_10948932
424 Ga0105241_11270989
425 Ga0105242_12448950
426 Ga0105248_10163944
427 Ga0105248_10259599
428 Ga0105237_10037397
429 Ga0105237_12633914
430 Ga0157370_10103146
431 Ga0157370_10103448
432 Ga0157370_11029186
433 Ga0157369_10036665
434 Ga0157369_10481047
435 Ga0157369_10942258
436 Ga0163162_10428057
437 Ga0157372_10009801
438 Ga0157375_10118400
439 Ga0182008_10004812
440 Ga0182008_10052897
441 Ga0157376_11309044
442 Ga0157376_11919824
443 Ga0182007_10190222
444 Ga0207699_10287546
445 Ga0207684_10000016
446 Ga0207684_10025905
447 Ga0207684_10836009
448 Ga0207684_11553075
449 Ga0207707_10138236
450 Ga0207707_10393674
451 Ga0207695_10465756
452 Ga0207671_10152683
453 Ga0207693_10006220
454 Ga0207693_10277730
455 Ga0207663_10034663
456 Ga0207652_10552906
457 Ga0207652_10636726
458 Ga0207646_10080795
459 Ga0207646_11575730
460 Ga0207646_11673675
461 Ga0207687_10000004
462 Ga0207687_10116569
463 Ga0207687_10648297
464 Ga0207700_10054163
465 Ga0207700_10526734
466 Ga0207700_11266254
467 Ga0207664_10001852
468 Ga0207664_10020529
469 Ga0207664_10025873
470 Ga0207664_10814251
471 Ga0207644_10297387
472 Ga0207686_10655572
473 Ga0207691_10134544
474 Ga0207711_10310436
475 Ga0207711_10548742
476 Ga0207667_10399967
477 Ga0207702_10120795
478 Ga0207676_11690764
479 Ga0207683_10634007
480 Ga0207698_10953783
481 Ga0265318_10003753
482 Ga0373928_0071282
483 Ga0373945_0397689
484 Ga0373946_0128603
485 Ga0373955_0045849
486 Ga0373924_0265996
487 Ga0373935_0852857
488 Ga0373947_0099885
489 Ga0373937_0380010
490 Ga0373925_0170765
491 Ga0395900_0133415
492 Ga0395898_0208231
493 Ga0395905_0110185
494 Ga0395905_0120779
495 Ga0436365_0369417
496 Ga0436365_0579854
497 Ga0436360_0558782
498 Ga0436363_1218413
499 Ga0436363_1689239
500 Ga0436362_0731494
501 Ga0451807_1591040
502 Ga0466972_0154932
503 Ga0466965_0042989
504 Ga0466965_0163222
505 Ga0466966_0813319
506 Ga0466961_0013410
507 Ga0466961_0171300
508 Ga0466961_0946012
509 Ga0466963_0006509
510 Ga0466963_0008389
511 Ga0466963_0031876
512 Ga0466963_0080930
513 Ga0466963_0102139
514 Ga0466963_0269755
515 Ga0466963_0342605
516 Ga0466963_0391692
517 Ga0466963_0594379
518 Ga0466963_0850182
519 Ga0466963_1119716
520 Ga0466964_0001404
521 Ga0466964_0012821
522 Ga0466964_0013408
523 Ga0466964_0015413
524 Ga0466964_0029177
525 Ga0466964_0030883
526 Ga0466964_0582310
527 Ga0466971_0048109
528 Ga0466971_0063832
529 Ga0466971_0114484
530 Ga0466968_0000590
531 Ga0466968_0017757
532 Ga0466968_0128569
533 Ga0466968_0238797
534 Ga0466970_0000979
535 Ga0466970_0239068
536 Ga0466957_0019590
537 Ga0466957_0055260
538 Ga0466957_0086285
539 Ga0466957_0122087
540 Ga0466957_0150152
541 Ga0466957_0422005
542 Ga0466957_1195428
543 Ga0466960_0069730
544 Ga0466960_0100376
545 Ga0466959_0017530
546 Ga0466959_0050779
547 Ga0466959_0237787
548 Ga0466958_0000140
549 Ga0466958_0004006
550 Ga0466958_0018582
551 Ga0466958_0028186
552 Ga0466958_0051387
553 Ga0466958_0093233
554 Ga0466958_0146174
555 Ga0466958_0205643
556 Ga0466967_0010772
557 Ga0466967_0036193
558 Ga0466967_0051080
559 Ga0466967_0076678
560 Ga0466967_0080369
561 Ga0466967_0100917
562 Ga0466967_0119816
563 Ga0466967_0122022
564 Ga0466967_0137794
565 Ga0466967_0152908
566 Ga0466967_0173806
567 Ga0466967_0223191
568 Ga0466967_0226883
569 Ga0466967_0349791
570 Ga0466967_0385580
571 Ga0466967_0393375
572 Ga0466967_0474078
573 Ga0466967_1283681
574 Ga0466967_1512634
575 Ga0466967_1664486
576 Ga0466967_1858893
577 Ga0466967_1883890
578 Ga0495592_0069467
579 Ga0495592_0228899
580 Ga0495603_0014963
581 Ga0495629_0300123
582 Ga0495641_0021731
583 Ga0495641_0044960
584 Ga0495651_0001663
585 Ga0495651_0201716
586 Ga0495653_0011382
587 Ga0495653_0018639
588 Ga0495653_0284983
589 Ga0495653_0534634
590 Ga0495582_0061663
591 Ga0495664_0120156
592 Ga0495664_0252455
593 Ga0495664_0287405
594 Ga0495594_0086811
595 Ga0495594_0404445
596 Ga0495608_0215122
597 Ga0495608_0280398
598 Ga0495628_0161186
599 Ga0495628_0226316
600 Ga0495630_0006287
601 Ga0495630_0039182
602 Ga0495630_1500899
603 Ga0495652_0175096
604 Ga0495652_0211394
605 Ga0495652_0258241
606 Ga0495652_0857384
607 Ga0495586_0563730
608 Ga0495587_0010781
609 Ga0495587_0026013
610 Ga0495587_0088967
611 Ga0495645_0064929
612 Ga0495645_0075454
613 Ga0495622_0523178
614 Ga0495667_0159235
615 Ga0495667_0229167
616 Ga0495656_0079669
617 Ga0495656_0479479
618 Ga0495635_0059215
619 Ga0495635_0388652
620 Ga0495635_0391181
621 Ga0495588_0141519
622 Ga0495657_0055638
623 Ga0495599_0004281
624 Ga0495599_0029445
625 Ga0495599_0054656
626 Ga0495623_0124156
627 Ga0495658_0618645
628 Ga0495613_0199063
629 Ga0495613_0559206
630 Ga0495600_0009590
631 Ga0495600_0098640
632 Ga0495600_0138946
633 Ga0495581_0039782
634 Ga0495604_0339977
635 Ga0495604_0696704
636 Ga0495674_0336931
637 Ga0495674_0426328
638 Ga0495674_0467779
639 Ga0495676_0042335
640 Ga0495676_0467348
641 Ga0495680_0011483
642 Ga0495680_0090808
643 Ga0495680_0520179
644 Ga0495675_0060698
645 Ga0495675_0246144
646 Ga0495675_0284569
647 Ga0495675_0739972
648 Ga0495684_0132108
649 Ga0495684_0160615
650 Ga0495602_0012801
651 Ga0495602_0406658
652 Ga0496100_0209314
653 Ga0496100_0880119
654 Ga0496101_0264555
655 Ga0496101_0446385
656 Ga0496102_0008528
657 Ga0496102_0024634
658 Ga0496102_0028803
659 Ga0496103_0159803
660 Ga0496103_0325971
661 Ga0496104_0043687
662 Ga0496104_0088723
663 Ga0496104_0316442
664 Ga0496105_0021065
665 Ga0496105_0352714
666 Ga0496106_0005699
667 Ga0496106_0143174
668 Ga0496106_1115582
669 Ga0496106_1195764
670 Ga0496107_0004781
671 Ga0496107_0174127
672 Ga0496107_1154521
673 Ga0496108_0003838
674 Ga0496109_0045964
675 Ga0496109_0116041
676 Ga0496110_0011946
677 Ga0496110_0062061
678 Ga0496110_0139474
679 Ga0496110_1277218
680 Ga0496110_1455941
681 Ga0496111_0000083
682 Ga0496111_0688787
683 Ga0496111_0721436
684 Ga0496112_0205644
685 Ga0496112_1783090
686 Ga0496112_1927924
687 Ga0496113_0042968
688 Ga0496113_0107713
689 Ga0496113_1186954
690 Ga0496113_1537703
691 Ga0496114_0012457
692 Ga0496114_0145240
693 Ga0496114_1768969
694 Ga0496115_0030832
695 Ga0496115_0046057
696 Ga0496115_0112089
697 Ga0501067_0023946
698 Ga0501067_0188821
699 Ga0501067_0303393
700 Ga0501069_0021026
701 Ga0501069_0258012
702 nmdc:mga08y16_214257_c1
703 nmdc:mga0n895_137575_c1
704 nmdc:mga0n895_259602_c1
705 nmdc:mga0n895_964472_c1
706 nmdc:mga0rr50_919497_c1
707 nmdc:mga08x19_23694_c1
708 nmdc:mga0a205_203878_c1
709 Ga0495601_0000253
710 Ga0495601_0057368
711 Ga0495601_0120542
712 Ga0495601_0149321
713 Ga0495601_0767219
714 Ga0495601_0812376
715 Ga0495612_0123019
716 Ga0495612_0296450
717 Ga0495655_0284833
718 Ga0495595_0177174
719 Ga0495595_0287792
720 Ga0495619_0038307
721 Ga0466962_0018507
722 Ga0466962_0102256
723 Ga0466962_0247546
724 Ga0466962_0249559
725 Ga0466962_0275067
726 Ga0530510_0021564

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cg3-assembly1.cif.gz_F staggered ring conformation of cthsp104 (hsp104 from chaetomium thermophilum) 0.5109 25 93
2xsj-assembly1.cif.gz_E structure of desulforubidin from desulfomicrobium norvegicum 0.464 52 91
6ncl-assembly1.cif.gz_a0 near-atomic structure of icosahedrally averaged pbcv-1 capsid 0.4634 8 90
3v51-assembly1.cif.gz_A calcium-dependent protein kinase 1 from toxoplasma gondii (tgcdpk1) in complex with inhibitor rm-1-176 0.4533 3 93
3a14-assembly1.cif.gz_B crystal structure of dxr from thermotoga maritima, in complex with nadph 0.4408 31 94
ID Description Score Start End Superfamily
af_A0A1D6PTB7_39_134_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.5815 3 72 1.10.10.60
af_D3ZHX4_1_59_1.10.8.1020 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecQ-mediated genome instability protein 1, N-terminal domain 0.5587 33 94 1.10.8.1020
af_Q7XT13_20_110_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.5577 7 71 1.10.10.60
af_K7W4Y3_19_108_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.5476 8 71 2.60.40.150
af_D3ZHX4_1_59_1.10.8.1020 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecQ-mediated genome instability protein 1, N-terminal domain 0.5182 33 94 1.10.8.1020
ID Description Score Start End GO Terms
AF-A0A7W7QU73-F1-model_v4 Uncharacterized protein 0.9921 3 91
AF-A0A7V9FL84-F1-model_v4 Uncharacterized protein 0.991 6 90
AF-A0A537ZRM2-F1-model_v4 Uncharacterized protein 0.9875 3 91
AF-A0A7W1Q797-F1-model_v4 Uncharacterized protein 0.9824 3 93
AF-A0A542ZNA3-F1-model_v4 Uncharacterized protein 0.9816 3 91

Map