metagRoot

F422962

General Info

Members	Datasets	Scaffolds	Average Seq Length
363	247	359	367

Family's Representative Sequence

Representative Sequence	3300014326\|Ga0157380_10111405\|Ga0157380_101114052
Length	397
Sequence	MIDSTVRVPAHDPEKWVPVFGQDHAPKGERPMNIEVRQPLRAQKTRYGIVDCDIHPKLTYDELRPYLSNQWWSHLQTYGLRPRHGFAKTYPMPKITPQAARRDAWPPTGGLPGSDLAFMQQQLLDFYDMDYGIMNPLSPTGQGDQNPDFSAAMAFASNEAQVARWTSREKRLKASVVVPYENPEASKAEIKRRAGNKDYAQVFMLSRTAEAHGRRRYWPIYEAAVEAGLPVGIHVFGYSGWAMTNSGWPSFYIEEMTEHATGQAAVVASMIFEGLFEQYRDLKVVLIESGFGWLPALGWRLDKHWERMRDEVPHVRRPPSEYIREHFWVSTQPMEEAEDPDHVMDAMRWIGFDRILFASDYPHWDFDDPFLALPPSLTEQQRQMIYAGNAKKLYGLG

Samples

	Sample ID	Description	Type	Environment
1	2864997549	Paenibacillus sp. R-72005	Isolate	Unclassified
2	2889295896	Paenibacillus sp. PvR098	Isolate	Rhizosphere
3	2894772417	Roseomonas oryzicola KCTC 22478	Isolate	Rhizosphere
4	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
5	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
6	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
7	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
8	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
9	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
10	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
11	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
12	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
13	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
14	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
15	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
16	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
17	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
18	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
19	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
20	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
21	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
22	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
23	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
24	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
25	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
26	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
27	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
28	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
29	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
30	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
31	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
32	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
33	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
34	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
35	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
36	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
37	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
38	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
39	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
40	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
41	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
42	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
43	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
44	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
45	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
46	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
47	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
48	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
49	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
50	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
51	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
52	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
53	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
54	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
55	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
56	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
57	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
58	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
59	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
60	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
61	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
62	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
63	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
64	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
65	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
66	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
67	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
68	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
69	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
70	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
71	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
72	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
73	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
74	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
76	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
77	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
78	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
79	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
80	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
81	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
82	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
83	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
84	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
85	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
86	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
87	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
88	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
89	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
90	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
129	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
132	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
133	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
134	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
135	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
136	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
137	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
138	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
139	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
140	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
141	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
142	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
143	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
144	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
145	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
146	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
147	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
148	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
149	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
150	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
151	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
152	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
153	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
154	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
155	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
156	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
157	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
158	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
159	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
160	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
161	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
162	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
163	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
164	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
165	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
166	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
167	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
168	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
169	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
170	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
171	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
172	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
173	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
174	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
175	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
176	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
177	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
178	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
179	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
180	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
181	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
182	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
183	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
184	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
185	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
186	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
187	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
188	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
189	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
190	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
191	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
192	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
193	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
194	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
195	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
196	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
197	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
198	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
199	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
200	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
201	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
202	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
203	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
204	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
205	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
206	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
207	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
208	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
209	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
210	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
211	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
212	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
213	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
214	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
215	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
216	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
217	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
218	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
219	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
220	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
221	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
222	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
223	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
224	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
225	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
226	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
227	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
228	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
229	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
230	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
231	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
232	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
233	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
234	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
235	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
236	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
237	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
238	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
239	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
240	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
241	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
242	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
243	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
244	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
245	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
246	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
247	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.07
Metatranscriptomes	0.83
Isolates	1.1

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.13
Nodule	0
Rhizoplane	8.82
Rhizosphere	83.47
Stem	0
Stem Tuber	0
Unclassified	3.58

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24750J21931_1001106	3300002070	Bacteria	3491
2	JGI24744J21845_10011934	3300002077	Bacteria	1768
3	JGI25153J46596_10031975	3300003215	Bacteria	1762
4	JGI25404J52841_10000913	3300003659	Bacteria	4799
5	JGI25405J52794_10001601	3300003911	Bacteria	3758
6	Ga0070658_10109749	3300005327	Bacteria	2284
7	Ga0070676_10134247	3300005328	Bacteria	1568
8	Ga0070683_100033091	3300005329	Bacteria	4712
9	Ga0070683_100291652	3300005329	Bacteria	1551
10	Ga0070670_100093731	3300005331	Bacteria	2583
11	Ga0070680_100006835	3300005336	Bacteria	8695
12	Ga0070680_100090650	3300005336	Bacteria	2531
13	Ga0068868_100005973	3300005338	Bacteria	8590
14	Ga0070689_100276138	3300005340	Bacteria	1393
15	Ga0070661_100108715	3300005344	Unclassified	2069
16	Ga0070692_10124319	3300005345	Bacteria	1442
17	Ga0070669_100099627	3300005353	Bacteria	2190
18	Ga0070671_100106347	3300005355	Bacteria	2355
19	Ga0070674_100003515	3300005356	Bacteria	8801
20	Ga0070673_100034886	3300005364	Bacteria	3811
21	Ga0070673_100039540	3300005364	Bacteria	3611
22	Ga0070688_100018857	3300005365	Bacteria	3988
23	Ga0070688_100194913	3300005365	Bacteria	1414
24	Ga0070667_100067133	3300005367	Bacteria	3049
25	Ga0070703_10001575	3300005406	Bacteria	6793
26	Ga0070709_10094648	3300005434	Bacteria	1977
27	Ga0070714_100090388	3300005435	Bacteria	2681
28	Ga0070705_100000277	3300005440	Bacteria	30646
29	Ga0070700_100079315	3300005441	Bacteria	2116
30	Ga0070694_100024161	3300005444	Bacteria	3920
31	Ga0070708_100001133	3300005445	Bacteria	20453
32	Ga0070663_100073968	3300005455	Bacteria	2487
33	Ga0070678_100069567	3300005456	Bacteria	2628
34	Ga0070662_100025624	3300005457	Bacteria	4074
35	Ga0070662_100053704	3300005457	Bacteria	2918
36	Ga0070681_10011683	3300005458	Bacteria	8698
37	Ga0070681_10218410	3300005458	Bacteria	1822
38	Ga0068867_100015548	3300005459	Bacteria	5399
39	Ga0068867_100060267	3300005459	Bacteria	2815
40	Ga0070685_10038700	3300005466	Bacteria	2705
41	Ga0070699_100000435	3300005518	Bacteria	40050
42	Ga0070684_100017443	3300005535	Bacteria	5893
43	Ga0070697_100011752	3300005536	Bacteria	6850
44	Ga0068853_100159483	3300005539	Bacteria	2035
45	Ga0070672_100030934	3300005543	Bacteria	4026
46	Ga0070696_100000789	3300005546	Bacteria	20381
47	Ga0070693_100094277	3300005547	Bacteria	1811
48	Ga0070704_100000598	3300005549	Bacteria	17320
49	Ga0068855_100109487	3300005563	Bacteria	3172
50	Ga0070702_100082371	3300005615	Bacteria	1930
51	Ga0068859_100012527	3300005617	Bacteria	8531
52	Ga0068864_100169356	3300005618	Bacteria	1991
53	Ga0068870_10031635	3300005840	Bacteria	2683
54	Ga0068860_100002995	3300005843	Bacteria	17450
55	Ga0068862_100000834	3300005844	Bacteria	30467
56	Ga0081455_10023684	3300005937	Bacteria	5707
57	Ga0081455_10024718	3300005937	Bacteria	5557
58	Ga0081538_10011003	3300005981	Bacteria	7362
59	Ga0081538_10033310	3300005981	Bacteria	3432
60	Ga0081540_1000183	3300005983	Bacteria	65356
61	Ga0081540_1008066	3300005983	Bacteria	7402
62	Ga0081540_1027266	3300005983	Bacteria	3241
63	Ga0070717_10048242	3300006028	Bacteria	3492
64	Ga0075365_10013485	3300006038	Bacteria	4892
65	Ga0075364_10055222	3300006051	Bacteria	2598
66	Ga0070716_100036221	3300006173	Bacteria	2719
67	Ga0070712_100132174	3300006175	Bacteria	1893
68	Ga0075362_10007255	3300006177	Bacteria	4187
69	Ga0075367_10049494	3300006178	Bacteria	2477
70	Ga0075366_10056049	3300006195	Bacteria	2340
71	Ga0097621_100060742	3300006237	Bacteria	3099
72	Ga0075428_100005749	3300006844	Bacteria	13779
73	Ga0075428_100064730	3300006844	Bacteria	4005
74	Ga0075428_100131814	3300006844	Bacteria	2718
75	Ga0075430_100016861	3300006846	Bacteria	6222
76	Ga0075430_100054106	3300006846	Bacteria	3377
77	Ga0075430_100061093	3300006846	Bacteria	3167
78	Ga0075431_100000004	3300006847	Bacteria	106006
79	Ga0075431_100002116	3300006847	Bacteria	18969
80	Ga0075431_100010686	3300006847	Bacteria	9223
81	Ga0075431_100200753	3300006847	Bacteria	2040
82	Ga0075431_100296303	3300006847	Bacteria	1635
83	Ga0075434_100124057	3300006871	Bacteria	2599
84	Ga0075429_100008566	3300006880	Bacteria	8898
85	Ga0075436_100017326	3300006914	Bacteria	4931
86	Ga0097620_100012528	3300006931	Bacteria	8531
87	Ga0075435_100037094	3300007076	Bacteria	3880
88	Ga0075435_100116946	3300007076	Bacteria	2222
89	Ga0111539_10001363	3300009094	Bacteria	32517
90	Ga0111539_10072555	3300009094	Bacteria	4059
91	Ga0111539_10150715	3300009094	Bacteria	2722
92	Ga0111539_10343780	3300009094	Bacteria	1737
93	Ga0111539_10525323	3300009094	Bacteria	1379
94	Ga0105245_10153066	3300009098	Bacteria	2182
95	Ga0114129_10000327	3300009147	Bacteria	55595
96	Ga0114129_10004711	3300009147	Bacteria	19257
97	Ga0114129_10352385	3300009147	Bacteria	1949
98	Ga0105248_10100961	3300009177	Bacteria	3252
99	Ga0105238_10049356	3300009551	Bacteria	4239
100	Ga0105238_10372873	3300009551	Bacteria	1418
101	Ga0105249_10002048	3300009553	Bacteria	17485
102	Ga0105249_10043653	3300009553	Bacteria	4077
103	Ga0105246_10065968	3300011119	Bacteria	2533
104	Ga0157374_10017481	3300013296	Bacteria	6316
105	Ga0157378_10363360	3300013297	Bacteria	1417
106	Ga0163163_10013323	3300014325	Bacteria	7524
107	Ga0163163_10042825	3300014325	Bacteria	4435
108	Ga0163163_10328937	3300014325	Bacteria	1582
109	Ga0157380_10111405	3300014326	Bacteria	2300
110	Ga0157377_10043980	3300014745	Bacteria	2488
111	Ga0157376_10226035	3300014969	Bacteria	1736
112	Ga0206356_10536564	3300020070	Bacteria	1346
113	Ga0206350_10651046	3300020080	Bacteria	2258
114	Ga0213875_10000040	3300021388	Bacteria	156362
115	Ga0213875_10004663	3300021388	Bacteria	7469
116	Ga0224712_10065144	3300022467	Bacteria	1463
117	Ga0209758_1000362	3300025297	Bacteria	80796
118	Ga0207656_10030823	3300025321	Bacteria	2218
119	Ga0207653_10003194	3300025885	Bacteria	5177
120	Ga0207682_10006764	3300025893	Bacteria	4604
121	Ga0207682_10062057	3300025893	Bacteria	1566
122	Ga0207642_10115464	3300025899	Bacteria	1375
123	Ga0207710_10013511	3300025900	Bacteria	3435
124	Ga0207688_10001315	3300025901	Bacteria	12902
125	Ga0207688_10093926	3300025901	Bacteria	1725
126	Ga0207680_10127170	3300025903	Bacteria	1674
127	Ga0207647_10078224	3300025904	Bacteria	1987
128	Ga0207645_10046253	3300025907	Bacteria	2780
129	Ga0207643_10017902	3300025908	Bacteria	3880
130	Ga0207707_10213390	3300025912	Bacteria	1681
131	Ga0207693_10037474	3300025915	Bacteria	3821
132	Ga0207663_10116521	3300025916	Bacteria	1822
133	Ga0207660_10002338	3300025917	Bacteria	12483
134	Ga0207662_10004381	3300025918	Bacteria	7418
135	Ga0207662_10024128	3300025918	Bacteria	3499
136	Ga0207657_10122402	3300025919	Bacteria	2140
137	Ga0207646_10169569	3300025922	Bacteria	1971
138	Ga0207681_10213993	3300025923	Bacteria	1487
139	Ga0207659_10067109	3300025926	Bacteria	2605
140	Ga0207659_10096196	3300025926	Bacteria	2222
141	Ga0207687_10082109	3300025927	Bacteria	2331
142	Ga0207706_10032819	3300025933	Bacteria	4621
143	Ga0207706_10053085	3300025933	Bacteria	3578
144	Ga0207686_10047787	3300025934	Bacteria	2648
145	Ga0207670_10036272	3300025936	Bacteria	3205
146	Ga0207669_10049173	3300025937	Bacteria	2511
147	Ga0207669_10068829	3300025937	Bacteria	2212
148	Ga0207665_10137788	3300025939	Bacteria	1738
149	Ga0207691_10016511	3300025940	Bacteria	7010
150	Ga0207691_10019307	3300025940	Bacteria	6451
151	Ga0207689_10013733	3300025942	Bacteria	6902
152	Ga0207679_10158191	3300025945	Bacteria	1852
153	Ga0207712_10008490	3300025961	Bacteria	6495
154	Ga0207712_10038173	3300025961	Bacteria	3283
155	Ga0207639_10116733	3300026041	Bacteria	2186
156	Ga0207678_10036897	3300026067	Bacteria	4255
157	Ga0207678_10049770	3300026067	Bacteria	3621
158	Ga0207641_10260507	3300026088	Bacteria	1623
159	Ga0207648_10011741	3300026089	Bacteria	8238
160	Ga0207648_10036903	3300026089	Bacteria	4305
161	Ga0207676_10062866	3300026095	Bacteria	2946
162	Ga0207676_10069672	3300026095	Bacteria	2817
163	Ga0207676_10182146	3300026095	Bacteria	1840
164	Ga0207674_10000934	3300026116	Bacteria	38036
165	Ga0207674_10055409	3300026116	Bacteria	4031
166	Ga0207674_10080008	3300026116	Bacteria	3271
167	Ga0207675_100052205	3300026118	Bacteria	3815
168	Ga0207675_100103042	3300026118	Bacteria	2689
169	Ga0207683_10008611	3300026121	Bacteria	8727
170	Ga0207683_10021138	3300026121	Bacteria	5570
171	Ga0209588_1022122	3300027671	Bacteria	2000
172	Ga0207428_10034064	3300027907	Bacteria	4177
173	Ga0268265_10198643	3300028380	Bacteria	1738
174	Ga0268264_10001956	3300028381	Bacteria	18511
175	Ga0265340_10014951	3300031247	Bacteria	4042
176	Ga0265340_10027490	3300031247	Bacteria	2868
177	Ga0265340_10101418	3300031247	Bacteria	1337
178	Ga0265339_10049455	3300031249	Bacteria	2302
179	Ga0265316_10075990	3300031344	Bacteria	2582
180	Ga0373926_0022957	3300035083	Bacteria	2165
181	Ga0373944_0004843	3300035089	Bacteria	3524
182	Ga0373944_0022377	3300035089	Bacteria	1836
183	Ga0373923_0006924	3300035111	Bacteria	3952
184	Ga0373936_0004483	3300035113	Bacteria	5280
185	Ga0373953_0012170	3300035117	Bacteria	3040
186	Ga0373954_0014471	3300035118	Bacteria	3517
187	Ga0373954_0032343	3300035118	Bacteria	2418
188	Ga0373956_0031712	3300035119	Bacteria	2317
189	Ga0373946_0000366	3300035171	Bacteria	14664
190	Ga0373946_0052945	3300035171	Bacteria	1704
191	Ga0373955_0026589	3300035172	Bacteria	2982
192	Ga0373924_0006122	3300035410	Bacteria	4294
193	Ga0373931_0144596	3300035691	Bacteria	1381
194	Ga0373935_0109332	3300035692	Bacteria	1833
195	Ga0373927_0004468	3300035695	Bacteria	9791
196	Ga0373927_0013928	3300035695	Bacteria	5335
197	Ga0373927_0062651	3300035695	Bacteria	2405
198	Ga0373933_0030739	3300035724	Bacteria	3111
199	Ga0373947_0051576	3300035725	Bacteria	2475
200	Ga0373937_0000003	3300036401	Bacteria	235408
201	Ga0373925_0000052	3300037068	Bacteria	127490
202	Ga0395898_0053912	3300037466	Bacteria	3926
203	Ga0436364_0411364	3300037853	Bacteria	19778
204	Ga0436364_0633592	3300037853	Bacteria	16701
205	Ga0436365_0375308	3300039437	Bacteria	5622
206	Ga0436365_1131801	3300039437	Bacteria	2944
207	Ga0436365_1149266	3300039437	Bacteria	1274
208	Ga0436362_0184614	3300039453	Bacteria	1730
209	Ga0451853_3566880	3300041512	Bacteria	1801
210	Ga0439446_0037347	3300042156	Bacteria	1422
211	Ga0466957_0045506	3300044842	Bacteria	2662
212	Ga0495592_0000331	3300046454	Bacteria	39293
213	Ga0495629_0126770	3300046459	Bacteria	1778
214	Ga0495641_0049048	3300046461	Bacteria	1934
215	Ga0495651_0000832	3300046462	Bacteria	24002
216	Ga0495653_0002755	3300046463	Bacteria	14019
217	Ga0495662_0032626	3300046476	Bacteria	2516
218	Ga0495662_0035119	3300046476	Bacteria	2419
219	Ga0495664_0000162	3300046477	Bacteria	32874
220	Ga0495608_0000239	3300046511	Bacteria	39851
221	Ga0495608_0202328	3300046511	Bacteria	1251
222	Ga0495618_0000022	3300046514	Bacteria	127582
223	Ga0495628_0000011	3300046516	Bacteria	225267
224	Ga0495630_0001372	3300046517	Bacteria	16772
225	Ga0495652_0000014	3300046529	Bacteria	225484
226	Ga0495640_0000008	3300046533	Bacteria	220320
227	Ga0495587_0000347	3300046536	Bacteria	33002
228	Ga0495598_0002570	3300046537	Bacteria	3754
229	Ga0495645_0000007	3300046543	Bacteria	376299
230	Ga0495645_0163041	3300046543	Bacteria	1540
231	Ga0495667_0000013	3300046559	Bacteria	220294
232	Ga0495656_0011146	3300046615	Bacteria	3293
233	Ga0495634_0001295	3300046642	Bacteria	22846
234	Ga0495635_0000012	3300046663	Bacteria	225271
235	Ga0495659_0012900	3300046664	Bacteria	2715
236	Ga0495657_0035191	3300046675	Bacteria	3472
237	Ga0495599_0000008	3300046678	Bacteria	225534
238	Ga0495623_0000500	3300046679	Bacteria	25998
239	Ga0495646_0000004	3300046680	Bacteria	268993
240	Ga0495624_0013461	3300046690	Bacteria	5578
241	Ga0495624_0029118	3300046690	Bacteria	3605
242	Ga0495670_0009469	3300046691	Bacteria	4788
243	Ga0495600_0000084	3300046809	Bacteria	51484
244	Ga0495604_0000001	3300047317	Bacteria	708627
245	Ga0495674_0000630	3300047319	Bacteria	33002
246	Ga0495674_0177776	3300047319	Bacteria	1773
247	Ga0495680_0002587	3300047322	Bacteria	18422
248	Ga0495680_0054582	3300047322	Bacteria	3102
249	Ga0495675_0000023	3300047444	Bacteria	111081
250	Ga0495684_0000007	3300047471	Bacteria	225614
251	Ga0495686_0064740	3300047472	Bacteria	2262
252	Ga0495593_0001338	3300047673	Bacteria	14404
253	Ga0495593_0109790	3300047673	Bacteria	1409
254	Ga0495602_0000431	3300048088	Bacteria	39378
255	Ga0496100_0140319	3300048903	Bacteria	1712
256	Ga0496100_0211438	3300048903	Bacteria	1419
257	Ga0496101_0052891	3300048904	Bacteria	2928
258	Ga0496101_0188982	3300048904	Bacteria	1589
259	Ga0496102_0026659	3300048905	Bacteria	5157
260	Ga0496102_0111147	3300048905	Bacteria	2554
261	Ga0496104_0002475	3300048907	Bacteria	15914
262	Ga0496104_0003224	3300048907	Bacteria	14042
263	Ga0496104_0017349	3300048907	Bacteria	6553
264	Ga0496104_0046473	3300048907	Bacteria	4089
265	Ga0496104_0143699	3300048907	Bacteria	2292
266	Ga0496105_0011082	3300048908	Bacteria	7107
267	Ga0496105_0039946	3300048908	Bacteria	3868
268	Ga0496106_0001461	3300048909	Bacteria	17761
269	Ga0496106_0009961	3300048909	Bacteria	7016
270	Ga0496106_0059366	3300048909	Bacteria	2897
271	Ga0496107_0142858	3300048910	Bacteria	1769
272	Ga0496108_0003879	3300048911	Bacteria	12007
273	Ga0496108_0049199	3300048911	Bacteria	3526
274	Ga0496109_0023471	3300048912	Bacteria	5476
275	Ga0496109_0148308	3300048912	Bacteria	2195
276	Ga0496109_0302777	3300048912	Bacteria	1508
277	Ga0496110_0004052	3300048913	Bacteria	11304
278	Ga0496110_0050641	3300048913	Bacteria	3647
279	Ga0496111_0006481	3300048914	Bacteria	7605
280	Ga0496111_0015139	3300048914	Bacteria	5286
281	Ga0496112_0148449	3300048915	Bacteria	2312
282	Ga0496112_0320959	3300048915	Bacteria	1493
283	Ga0496113_0060602	3300048916	Bacteria	2853
284	Ga0496114_0044828	3300048917	Bacteria	3671
285	Ga0496114_0085724	3300048917	Bacteria	2668
286	Ga0496115_0169068	3300048918	Bacteria	1808
287	Ga0496119_0030166	3300048922	Bacteria	3661
288	Ga0496119_0031777	3300048922	Bacteria	3531
289	Ga0496120_0059877	3300048923	Bacteria	2133
290	Ga0496126_0157924	3300048929	Bacteria	1940
291	Ga0501031_0036232	3300049568	Bacteria	3218
292	Ga0501033_0048418	3300049570	Bacteria	3157
293	Ga0501033_0065433	3300049570	Bacteria	2675
294	Ga0501033_0107681	3300049570	Bacteria	2030
295	Ga0501033_0249020	3300049570	Bacteria	1260
296	Ga0501034_0050779	3300049571	Bacteria	4182
297	Ga0501034_0303789	3300049571	Bacteria	1532
298	Ga0501038_0074204	3300049574	Bacteria	2878
299	Ga0501039_0084029	3300049575	Bacteria	2479
300	Ga0501039_0299506	3300049575	Bacteria	1264
301	Ga0501046_0082599	3300049580	Bacteria	2481
302	Ga0501046_0168426	3300049580	Bacteria	1645
303	Ga0501046_0303283	3300049580	Bacteria	1166
304	Ga0501047_0011509	3300049581	Bacteria	8373
305	Ga0501072_0002942	3300049588	Bacteria	12814
306	Ga0501072_0003002	3300049588	Bacteria	12723
307	Ga0501072_0146069	3300049588	Unclassified	1886
308	Ga0501074_0015252	3300049590	Bacteria	5585
309	Ga0501076_0082410	3300049592	Bacteria	2582
310	Ga0501077_0058628	3300049593	Bacteria	2444
311	Ga0501079_0256564	3300049741	Unclassified	1366
312	Ga0501081_0161270	3300049743	Bacteria	1616
313	Ga0501044_0042775	3300049823	Bacteria	4710
314	Ga0501044_0227654	3300049823	Bacteria	1813
315	Ga0501045_0064346	3300049824	Bacteria	2692
316	nmdc:mga03683_65129_c1	3300050489	Bacteria	1548
317	nmdc:mga03683_89243_c1	3300050489	Bacteria	1342
318	nmdc:mga00v17_126358_c1	3300050491	Bacteria	1632
319	nmdc:mga0yw44_220150_c1	3300050492	Bacteria	1258
320	nmdc:mga0yw44_8753_c1	3300050492	Bacteria	5063
321	nmdc:mga0k408_27793_c1	3300050493	Bacteria	3214
322	nmdc:mga05p37_165076_c2	3300050507	Bacteria	2402
323	nmdc:mga05p37_40_c1	3300050507	Bacteria	108168
324	nmdc:mga05p37_9654_c1	3300050507	Bacteria	11434
325	nmdc:mga09592_136375_c1	3300050508	Bacteria	2114
326	nmdc:mga09592_148829_c1	3300050508	Bacteria	2019
327	nmdc:mga0qj67_100286_c1	3300050509	Bacteria	2334
328	nmdc:mga0qj67_167513_c1	3300050509	Bacteria	1784
329	nmdc:mga0qj67_1747_c1	3300050509	Bacteria	15356
330	nmdc:mga0qj67_19995_c1	3300050509	Bacteria	5124
331	nmdc:mga06r32_118221_c1	3300050510	Bacteria	2613
332	nmdc:mga06r32_140_c1	3300050510	Bacteria	53994
333	nmdc:mga06r32_21927_c1	3300050510	Bacteria	5898
334	nmdc:mga06r32_232031_c1	3300050510	Bacteria	1833
335	nmdc:mga06r32_89151_c2	3300050510	Bacteria	2655
336	nmdc:mga08y16_237334_c1	3300050511	Bacteria	1885
337	nmdc:mga08y16_294314_c1	3300050511	Bacteria	1674
338	nmdc:mga08y16_3354_c1	3300050511	Bacteria	16591
339	nmdc:mga08y16_99048_c1	3300050511	Bacteria	3035
340	nmdc:mga0n895_172768_c1	3300050512	Bacteria	2193
341	nmdc:mga0rr50_28592_c1	3300050513	Bacteria	3920
342	nmdc:mga0rr50_93904_c1	3300050513	Bacteria	2341
343	nmdc:mga08x19_22655_c1	3300050514	Bacteria	3890
344	nmdc:mga0a205_201051_c1	3300050515	Bacteria	1883
345	Ga0495601_0000014	3300053077	Bacteria	220318
346	Ga0495601_0050962	3300053077	Bacteria	2612
347	Ga0495612_0000123	3300053078	Bacteria	32874
348	Ga0495595_0000601	3300053084	Bacteria	13704
349	Ga0495619_0000006	3300053085	Bacteria	384835
350	Ga0495619_0204557	3300053085	Bacteria	1367
351	Ga0500616_0030246	3300053153	Bacteria	2975
352	Ga0500616_0048603	3300053153	Bacteria	2248
353	Ga0501084_0010467	3300054114	Bacteria	7665
354	Ga0501082_0003348	3300060353	Bacteria	13998
355	Ga0501082_0079126	3300060353	Bacteria	2836
356	Ga0501082_0116410	3300060353	Bacteria	2315
357	Ga0501082_0156091	3300060353	Bacteria	1983
358	Ga0501082_0188403	3300060353	Bacteria	1795
359	Ga0530510_0042117	3300061734	Bacteria	3298

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049575	Ga0501039_0299506	Ga0501039_0299506_22_960	311
2	3300049580	Ga0501046_0303283	Ga0501046_0303283_182_1156	323
3	3300025937	Ga0207669_10049173	Ga0207669_100491732	335
4	3300025933	Ga0207706_10032819	Ga0207706_100328193	343
5	3300048904	Ga0496101_0188982	Ga0496101_0188982_303_1340	343
6	3300005327	Ga0070658_10109749	Ga0070658_101097492	353
7	3300005563	Ga0068855_100109487	Ga0068855_1001094871	353
8	3300044842	Ga0466957_0045506	Ga0466957_0045506_86_1150	353
9	3300049568	Ga0501031_0036232	Ga0501031_0036232_1394_2458	353
10	3300049570	Ga0501033_0048418	Ga0501033_0048418_763_1827	353
11	3300049574	Ga0501038_0074204	Ga0501038_0074204_1167_2231	353
12	3300049575	Ga0501039_0084029	Ga0501039_0084029_1166_2230	353
13	3300005344	Ga0070661_100108715	Ga0070661_1001087152	354
14	3300006038	Ga0075365_10013485	Ga0075365_100134853	354
15	3300047472	Ga0495686_0064740	Ga0495686_0064740_286_1353	354
16	3300049571	Ga0501034_0050779	Ga0501034_0050779_764_1831	354
17	3300021388	Ga0213875_10004663	Ga0213875_100046638	357
18	3300037853	Ga0436364_0633592	Ga0436364_0633592_10200_11315	357
19	3300048922	Ga0496119_0030166	Ga0496119_0030166_1285_2391	357
20	3300005937	Ga0081455_10023684	Ga0081455_100236843	359
21	3300020080	Ga0206350_10651046	Ga0206350_106510462	360
22	3300022467	Ga0224712_10065144	Ga0224712_100651442	360
23	3300025903	Ga0207680_10127170	Ga0207680_101271702	360
24	iso_pu_bacteria	2864997549	2865001749	362
25	iso_pu_bacteria	2889295896	2889297478	362
26	iso_pu_bacteria	2889295896	2889297483	362
27	iso_pu_bacteria	2894772417	2894772951	362
28	3300037466	Ga0395898_0053912	Ga0395898_0053912_841_1947	363
29	3300053153	Ga0500616_0030246	Ga0500616_0030246_987_2078	363
30	3300003215	JGI25153J46596_10031975	JGI25153J46596_100319751	365
31	3300005435	Ga0070714_100090388	Ga0070714_1000903883	365
32	3300005981	Ga0081538_10033310	Ga0081538_100333102	365
33	3300006028	Ga0070717_10048242	Ga0070717_100482424	365
34	3300006173	Ga0070716_100036221	Ga0070716_1000362213	365
35	3300006846	Ga0075430_100016861	Ga0075430_1000168612	365
36	3300006847	Ga0075431_100010686	Ga0075431_1000106864	365
37	3300009094	Ga0111539_10525323	Ga0111539_105253232	365
38	3300021388	Ga0213875_10000040	Ga0213875_10000040101	365
39	3300025297	Ga0209758_1000362	Ga0209758_100036280	365
40	3300031247	Ga0265340_10027490	Ga0265340_100274902	365
41	3300037853	Ga0436364_0411364	Ga0436364_0411364_5633_6733	365
42	3300039453	Ga0436362_0184614	Ga0436362_0184614_185_1285	365
43	3300048903	Ga0496100_0140319	Ga0496100_0140319_584_1681	365
44	3300048913	Ga0496110_0004052	Ga0496110_0004052_5473_6600	365
45	3300048922	Ga0496119_0031777	Ga0496119_0031777_907_2049	365
46	3300048923	Ga0496120_0059877	Ga0496120_0059877_59_1201	365
47	3300048929	Ga0496126_0157924	Ga0496126_0157924_91_1218	365
48	3300049580	Ga0501046_0168426	Ga0501046_0168426_82_1203	365
49	3300049590	Ga0501074_0015252	Ga0501074_0015252_762_1883	365
50	3300049592	Ga0501076_0082410	Ga0501076_0082410_672_1793	365
51	3300049593	Ga0501077_0058628	Ga0501077_0058628_853_1974	365
52	3300049741	Ga0501079_0256564	Ga0501079_0256564_40_1161	365
53	3300049824	Ga0501045_0064346	Ga0501045_0064346_708_1838	365
54	3300050510	nmdc:mga06r32_118221_c1	nmdc:mga06r32_118221_c1_485_1612	365
55	3300053153	Ga0500616_0048603	Ga0500616_0048603_549_1646	365
56	3300054114	Ga0501084_0010467	Ga0501084_0010467_6223_7344	365
57	3300060353	Ga0501082_0116410	Ga0501082_0116410_67_1197	365
58	3300060353	Ga0501082_0156091	Ga0501082_0156091_236_1339	365
59	3300060353	Ga0501082_0188403	Ga0501082_0188403_632_1735	365
60	3300061734	Ga0530510_0042117	Ga0530510_0042117_455_1585	365
61	3300002070	JGI24750J21931_1001106	JGI24750J21931_10011062	366
62	3300002077	JGI24744J21845_10011934	JGI24744J21845_100119342	366
63	3300003659	JGI25404J52841_10000913	JGI25404J52841_100009133	366
64	3300003911	JGI25405J52794_10001601	JGI25405J52794_100016013	366
65	3300005328	Ga0070676_10134247	Ga0070676_101342472	366
66	3300005329	Ga0070683_100033091	Ga0070683_1000330913	366
67	3300005329	Ga0070683_100291652	Ga0070683_1002916522	366
68	3300005331	Ga0070670_100093731	Ga0070670_1000937312	366
69	3300005336	Ga0070680_100006835	Ga0070680_1000068356	366
70	3300005336	Ga0070680_100090650	Ga0070680_1000906503	366
71	3300005338	Ga0068868_100005973	Ga0068868_1000059733	366
72	3300005340	Ga0070689_100276138	Ga0070689_1002761382	366
73	3300005345	Ga0070692_10124319	Ga0070692_101243191	366
74	3300005353	Ga0070669_100099627	Ga0070669_1000996272	366
75	3300005355	Ga0070671_100106347	Ga0070671_1001063472	366
76	3300005356	Ga0070674_100003515	Ga0070674_10000351511	366
77	3300005364	Ga0070673_100034886	Ga0070673_1000348862	366
78	3300005364	Ga0070673_100039540	Ga0070673_1000395404	366
79	3300005365	Ga0070688_100018857	Ga0070688_1000188572	366
80	3300005365	Ga0070688_100194913	Ga0070688_1001949132	366
81	3300005367	Ga0070667_100067133	Ga0070667_1000671332	366
82	3300005406	Ga0070703_10001575	Ga0070703_100015755	366
83	3300005434	Ga0070709_10094648	Ga0070709_100946482	366
84	3300005440	Ga0070705_100000277	Ga0070705_10000027720	366
85	3300005441	Ga0070700_100079315	Ga0070700_1000793152	366
86	3300005444	Ga0070694_100024161	Ga0070694_1000241612	366
87	3300005445	Ga0070708_100001133	Ga0070708_10000113310	366
88	3300005455	Ga0070663_100073968	Ga0070663_1000739682	366
89	3300005456	Ga0070678_100069567	Ga0070678_1000695673	366
90	3300005457	Ga0070662_100025624	Ga0070662_1000256242	366
91	3300005457	Ga0070662_100053704	Ga0070662_1000537042	366
92	3300005458	Ga0070681_10011683	Ga0070681_100116832	366
93	3300005458	Ga0070681_10218410	Ga0070681_102184102	366
94	3300005459	Ga0068867_100015548	Ga0068867_1000155486	366
95	3300005459	Ga0068867_100060267	Ga0068867_1000602672	366
96	3300005466	Ga0070685_10038700	Ga0070685_100387003	366
97	3300005518	Ga0070699_100000435	Ga0070699_1000004353	366
98	3300005535	Ga0070684_100017443	Ga0070684_1000174432	366
99	3300005536	Ga0070697_100011752	Ga0070697_1000117525	366
100	3300005539	Ga0068853_100159483	Ga0068853_1001594832	366
101	3300005543	Ga0070672_100030934	Ga0070672_1000309344	366
102	3300005546	Ga0070696_100000789	Ga0070696_10000078913	366
103	3300005547	Ga0070693_100094277	Ga0070693_1000942772	366
104	3300005549	Ga0070704_100000598	Ga0070704_1000005983	366
105	3300005615	Ga0070702_100082371	Ga0070702_1000823711	366
106	3300005617	Ga0068859_100012527	Ga0068859_1000125276	366
107	3300005618	Ga0068864_100169356	Ga0068864_1001693562	366
108	3300005840	Ga0068870_10031635	Ga0068870_100316352	366
109	3300005843	Ga0068860_100002995	Ga0068860_1000029959	366
110	3300005844	Ga0068862_100000834	Ga0068862_10000083411	366
111	3300005937	Ga0081455_10024718	Ga0081455_100247183	366
112	3300005981	Ga0081538_10011003	Ga0081538_100110033	366
113	3300005983	Ga0081540_1000183	Ga0081540_100018328	366
114	3300005983	Ga0081540_1008066	Ga0081540_10080662	366
115	3300005983	Ga0081540_1027266	Ga0081540_10272662	366
116	3300006051	Ga0075364_10055222	Ga0075364_100552223	366
117	3300006175	Ga0070712_100132174	Ga0070712_1001321742	366
118	3300006177	Ga0075362_10007255	Ga0075362_100072552	366
119	3300006178	Ga0075367_10049494	Ga0075367_100494943	366
120	3300006195	Ga0075366_10056049	Ga0075366_100560493	366
121	3300006237	Ga0097621_100060742	Ga0097621_1000607422	366
122	3300006844	Ga0075428_100005749	Ga0075428_1000057494	366
123	3300006844	Ga0075428_100064730	Ga0075428_1000647302	366
124	3300006844	Ga0075428_100131814	Ga0075428_1001318144	366
125	3300006846	Ga0075430_100054106	Ga0075430_1000541064	366
126	3300006846	Ga0075430_100061093	Ga0075430_1000610932	366
127	3300006847	Ga0075431_100000004	Ga0075431_10000000475	366
128	3300006847	Ga0075431_100002116	Ga0075431_1000021165	366
129	3300006847	Ga0075431_100200753	Ga0075431_1002007533	366
130	3300006847	Ga0075431_100296303	Ga0075431_1002963032	366
131	3300006871	Ga0075434_100124057	Ga0075434_1001240573	366
132	3300006880	Ga0075429_100008566	Ga0075429_1000085666	366
133	3300006914	Ga0075436_100017326	Ga0075436_1000173264	366
134	3300006931	Ga0097620_100012528	Ga0097620_1000125283	366
135	3300007076	Ga0075435_100037094	Ga0075435_1000370943	366
136	3300007076	Ga0075435_100116946	Ga0075435_1001169463	366
137	3300009094	Ga0111539_10001363	Ga0111539_100013638	366
138	3300009094	Ga0111539_10072555	Ga0111539_100725553	366
139	3300009094	Ga0111539_10150715	Ga0111539_101507153	366
140	3300009094	Ga0111539_10343780	Ga0111539_103437803	366
141	3300009098	Ga0105245_10153066	Ga0105245_101530662	366
142	3300009147	Ga0114129_10000327	Ga0114129_1000032725	366
143	3300009147	Ga0114129_10004711	Ga0114129_100047119	366
144	3300009147	Ga0114129_10352385	Ga0114129_103523852	366
145	3300009177	Ga0105248_10100961	Ga0105248_101009612	366
146	3300009551	Ga0105238_10049356	Ga0105238_100493562	366
147	3300009551	Ga0105238_10372873	Ga0105238_103728731	366
148	3300009553	Ga0105249_10002048	Ga0105249_1000204812	366
149	3300009553	Ga0105249_10043653	Ga0105249_100436533	366
150	3300011119	Ga0105246_10065968	Ga0105246_100659682	366
151	3300013296	Ga0157374_10017481	Ga0157374_100174818	366
152	3300013297	Ga0157378_10363360	Ga0157378_103633601	366
153	3300014325	Ga0163163_10013323	Ga0163163_100133233	366
154	3300014325	Ga0163163_10042825	Ga0163163_100428254	366
155	3300014325	Ga0163163_10328937	Ga0163163_103289372	366
156	3300014326	Ga0157380_10111405	Ga0157380_101114052	366
157	3300014745	Ga0157377_10043980	Ga0157377_100439802	366
158	3300014969	Ga0157376_10226035	Ga0157376_102260352	366
159	3300020070	Ga0206356_10536564	Ga0206356_105365641	366
160	3300025321	Ga0207656_10030823	Ga0207656_100308232	366
161	3300025885	Ga0207653_10003194	Ga0207653_100031945	366
162	3300025893	Ga0207682_10006764	Ga0207682_100067645	366
163	3300025893	Ga0207682_10062057	Ga0207682_100620572	366
164	3300025899	Ga0207642_10115464	Ga0207642_101154642	366
165	3300025900	Ga0207710_10013511	Ga0207710_100135112	366
166	3300025901	Ga0207688_10001315	Ga0207688_100013152	366
167	3300025901	Ga0207688_10093926	Ga0207688_100939262	366
168	3300025904	Ga0207647_10078224	Ga0207647_100782242	366
169	3300025907	Ga0207645_10046253	Ga0207645_100462532	366
170	3300025908	Ga0207643_10017902	Ga0207643_100179024	366
171	3300025912	Ga0207707_10213390	Ga0207707_102133901	366
172	3300025915	Ga0207693_10037474	Ga0207693_100374742	366
173	3300025916	Ga0207663_10116521	Ga0207663_101165212	366
174	3300025917	Ga0207660_10002338	Ga0207660_100023382	366
175	3300025918	Ga0207662_10004381	Ga0207662_100043815	366
176	3300025918	Ga0207662_10024128	Ga0207662_100241284	366
177	3300025919	Ga0207657_10122402	Ga0207657_101224022	366
178	3300025922	Ga0207646_10169569	Ga0207646_101695692	366
179	3300025923	Ga0207681_10213993	Ga0207681_102139932	366
180	3300025926	Ga0207659_10067109	Ga0207659_100671092	366
181	3300025926	Ga0207659_10096196	Ga0207659_100961963	366
182	3300025927	Ga0207687_10082109	Ga0207687_100821092	366
183	3300025933	Ga0207706_10053085	Ga0207706_100530853	366
184	3300025934	Ga0207686_10047787	Ga0207686_100477872	366
185	3300025936	Ga0207670_10036272	Ga0207670_100362723	366
186	3300025937	Ga0207669_10068829	Ga0207669_100688292	366
187	3300025939	Ga0207665_10137788	Ga0207665_101377881	366
188	3300025940	Ga0207691_10016511	Ga0207691_100165117	366
189	3300025940	Ga0207691_10019307	Ga0207691_100193074	366
190	3300025942	Ga0207689_10013733	Ga0207689_100137334	366
191	3300025945	Ga0207679_10158191	Ga0207679_101581912	366
192	3300025961	Ga0207712_10008490	Ga0207712_100084901	366
193	3300025961	Ga0207712_10038173	Ga0207712_100381732	366
194	3300026041	Ga0207639_10116733	Ga0207639_101167332	366
195	3300026067	Ga0207678_10036897	Ga0207678_100368973	366
196	3300026067	Ga0207678_10049770	Ga0207678_100497702	366
197	3300026088	Ga0207641_10260507	Ga0207641_102605072	366
198	3300026089	Ga0207648_10011741	Ga0207648_100117416	366
199	3300026089	Ga0207648_10036903	Ga0207648_100369033	366
200	3300026095	Ga0207676_10062866	Ga0207676_100628662	366
201	3300026095	Ga0207676_10069672	Ga0207676_100696722	366
202	3300026095	Ga0207676_10182146	Ga0207676_101821462	366
203	3300026116	Ga0207674_10000934	Ga0207674_1000093418	366
204	3300026116	Ga0207674_10055409	Ga0207674_100554092	366
205	3300026116	Ga0207674_10080008	Ga0207674_100800082	366
206	3300026118	Ga0207675_100052205	Ga0207675_1000522053	366
207	3300026118	Ga0207675_100103042	Ga0207675_1001030422	366
208	3300026121	Ga0207683_10008611	Ga0207683_100086112	366
209	3300026121	Ga0207683_10021138	Ga0207683_100211386	366
210	3300027671	Ga0209588_1022122	Ga0209588_10221222	366
211	3300027907	Ga0207428_10034064	Ga0207428_100340644	366
212	3300028380	Ga0268265_10198643	Ga0268265_101986432	366
213	3300028381	Ga0268264_10001956	Ga0268264_100019569	366
214	3300031247	Ga0265340_10014951	Ga0265340_100149514	366
215	3300031247	Ga0265340_10101418	Ga0265340_101014182	366
216	3300031249	Ga0265339_10049455	Ga0265339_100494552	366
217	3300031344	Ga0265316_10075990	Ga0265316_100759902	366
218	3300035083	Ga0373926_0022957	Ga0373926_0022957_791_1891	366
219	3300035089	Ga0373944_0004843	Ga0373944_0004843_789_1889	366
220	3300035089	Ga0373944_0022377	Ga0373944_0022377_299_1399	366
221	3300035111	Ga0373923_0006924	Ga0373923_0006924_1121_2221	366
222	3300035113	Ga0373936_0004483	Ga0373936_0004483_1159_2259	366
223	3300035117	Ga0373953_0012170	Ga0373953_0012170_1613_2713	366
224	3300035118	Ga0373954_0014471	Ga0373954_0014471_1138_2238	366
225	3300035118	Ga0373954_0032343	Ga0373954_0032343_1180_2292	366
226	3300035119	Ga0373956_0031712	Ga0373956_0031712_1071_2171	366
227	3300035171	Ga0373946_0000366	Ga0373946_0000366_1203_2303	366
228	3300035171	Ga0373946_0052945	Ga0373946_0052945_217_1317	366
229	3300035172	Ga0373955_0026589	Ga0373955_0026589_1121_2221	366
230	3300035410	Ga0373924_0006122	Ga0373924_0006122_1652_2752	366
231	3300035691	Ga0373931_0144596	Ga0373931_0144596_189_1319	366
232	3300035692	Ga0373935_0109332	Ga0373935_0109332_56_1156	366
233	3300035695	Ga0373927_0004468	Ga0373927_0004468_7190_8290	366
234	3300035695	Ga0373927_0013928	Ga0373927_0013928_2614_3726	366
235	3300035695	Ga0373927_0062651	Ga0373927_0062651_790_1902	366
236	3300035724	Ga0373933_0030739	Ga0373933_0030739_1119_2219	366
237	3300035725	Ga0373947_0051576	Ga0373947_0051576_1280_2380	366
238	3300036401	Ga0373937_0000003	Ga0373937_0000003_233169_234269	366
239	3300037068	Ga0373925_0000052	Ga0373925_0000052_125251_126351	366
240	3300039437	Ga0436365_0375308	Ga0436365_0375308_2437_3561	366
241	3300039437	Ga0436365_1131801	Ga0436365_1131801_388_1488	366
242	3300039437	Ga0436365_1149266	Ga0436365_1149266_133_1233	366
243	3300041512	Ga0451853_3566880	Ga0451853_3566880_15_1127	366
244	3300042156	Ga0439446_0037347	Ga0439446_0037347_286_1386	366
245	3300046454	Ga0495592_0000331	Ga0495592_0000331_37054_38154	366
246	3300046459	Ga0495629_0126770	Ga0495629_0126770_136_1236	366
247	3300046461	Ga0495641_0049048	Ga0495641_0049048_696_1796	366
248	3300046462	Ga0495651_0000832	Ga0495651_0000832_11708_12808	366
249	3300046463	Ga0495653_0002755	Ga0495653_0002755_11780_12880	366
250	3300046476	Ga0495662_0032626	Ga0495662_0032626_250_1350	366
251	3300046476	Ga0495662_0035119	Ga0495662_0035119_180_1280	366
252	3300046477	Ga0495664_0000162	Ga0495664_0000162_1140_2240	366
253	3300046511	Ga0495608_0000239	Ga0495608_0000239_37138_38238	366
254	3300046511	Ga0495608_0202328	Ga0495608_0202328_84_1196	366
255	3300046514	Ga0495618_0000022	Ga0495618_0000022_125367_126467	366
256	3300046516	Ga0495628_0000011	Ga0495628_0000011_1140_2240	366
257	3300046517	Ga0495630_0001372	Ga0495630_0001372_1744_2844	366
258	3300046529	Ga0495652_0000014	Ga0495652_0000014_223245_224345	366
259	3300046533	Ga0495640_0000008	Ga0495640_0000008_1140_2240	366
260	3300046536	Ga0495587_0000347	Ga0495587_0000347_1140_2240	366
261	3300046537	Ga0495598_0002570	Ga0495598_0002570_2112_3212	366
262	3300046543	Ga0495645_0000007	Ga0495645_0000007_338044_339144	366
263	3300046543	Ga0495645_0163041	Ga0495645_0163041_17_1129	366
264	3300046559	Ga0495667_0000013	Ga0495667_0000013_1126_2226	366
265	3300046615	Ga0495656_0011146	Ga0495656_0011146_1119_2219	366
266	3300046642	Ga0495634_0001295	Ga0495634_0001295_1625_2725	366
267	3300046663	Ga0495635_0000012	Ga0495635_0000012_223032_224132	366
268	3300046664	Ga0495659_0012900	Ga0495659_0012900_19_1119	366
269	3300046675	Ga0495657_0035191	Ga0495657_0035191_1117_2217	366
270	3300046678	Ga0495599_0000008	Ga0495599_0000008_223295_224395	366
271	3300046679	Ga0495623_0000500	Ga0495623_0000500_1124_2224	366
272	3300046680	Ga0495646_0000004	Ga0495646_0000004_49794_50894	366
273	3300046690	Ga0495624_0013461	Ga0495624_0013461_2074_3174	366
274	3300046690	Ga0495624_0029118	Ga0495624_0029118_1649_2749	366
275	3300046691	Ga0495670_0009469	Ga0495670_0009469_3138_4238	366
276	3300046809	Ga0495600_0000084	Ga0495600_0000084_13280_14380	366
277	3300047317	Ga0495604_0000001	Ga0495604_0000001_285733_286833	366
278	3300047319	Ga0495674_0000630	Ga0495674_0000630_30763_31863	366
279	3300047319	Ga0495674_0177776	Ga0495674_0177776_312_1412	366
280	3300047322	Ga0495680_0002587	Ga0495680_0002587_16183_17283	366
281	3300047322	Ga0495680_0054582	Ga0495680_0054582_1827_2939	366
282	3300047444	Ga0495675_0000023	Ga0495675_0000023_108842_109942	366
283	3300047471	Ga0495684_0000007	Ga0495684_0000007_223105_224205	366
284	3300047673	Ga0495593_0001338	Ga0495593_0001338_8492_9592	366
285	3300047673	Ga0495593_0109790	Ga0495593_0109790_275_1375	366
286	3300048088	Ga0495602_0000431	Ga0495602_0000431_1140_2240	366
287	3300048903	Ga0496100_0211438	Ga0496100_0211438_178_1278	366
288	3300048904	Ga0496101_0052891	Ga0496101_0052891_455_1555	366
289	3300048905	Ga0496102_0026659	Ga0496102_0026659_1563_2663	366
290	3300048905	Ga0496102_0111147	Ga0496102_0111147_1317_2417	366
291	3300048907	Ga0496104_0002475	Ga0496104_0002475_2930_4030	366
292	3300048907	Ga0496104_0003224	Ga0496104_0003224_9648_10748	366
293	3300048907	Ga0496104_0017349	Ga0496104_0017349_792_1892	366
294	3300048907	Ga0496104_0046473	Ga0496104_0046473_855_1955	366
295	3300048907	Ga0496104_0143699	Ga0496104_0143699_1120_2250	366
296	3300048908	Ga0496105_0011082	Ga0496105_0011082_1254_2354	366
297	3300048908	Ga0496105_0039946	Ga0496105_0039946_2413_3513	366
298	3300048909	Ga0496106_0001461	Ga0496106_0001461_10837_11967	366
299	3300048909	Ga0496106_0009961	Ga0496106_0009961_3185_4285	366
300	3300048909	Ga0496106_0059366	Ga0496106_0059366_306_1406	366
301	3300048910	Ga0496107_0142858	Ga0496107_0142858_151_1251	366
302	3300048911	Ga0496108_0003879	Ga0496108_0003879_6503_7603	366
303	3300048911	Ga0496108_0049199	Ga0496108_0049199_1377_2477	366
304	3300048912	Ga0496109_0023471	Ga0496109_0023471_1372_2472	366
305	3300048912	Ga0496109_0148308	Ga0496109_0148308_482_1582	366
306	3300048912	Ga0496109_0302777	Ga0496109_0302777_81_1181	366
307	3300048913	Ga0496110_0050641	Ga0496110_0050641_385_1485	366
308	3300048914	Ga0496111_0006481	Ga0496111_0006481_1125_2225	366
309	3300048914	Ga0496111_0015139	Ga0496111_0015139_1372_2472	366
310	3300048915	Ga0496112_0148449	Ga0496112_0148449_482_1582	366
311	3300048915	Ga0496112_0320959	Ga0496112_0320959_336_1448	366
312	3300048916	Ga0496113_0060602	Ga0496113_0060602_1373_2473	366
313	3300048917	Ga0496114_0044828	Ga0496114_0044828_1458_2558	366
314	3300048917	Ga0496114_0085724	Ga0496114_0085724_1439_2539	366
315	3300048918	Ga0496115_0169068	Ga0496115_0169068_196_1296	366
316	3300049570	Ga0501033_0065433	Ga0501033_0065433_935_2038	366
317	3300049570	Ga0501033_0107681	Ga0501033_0107681_829_1944	366
318	3300049570	Ga0501033_0249020	Ga0501033_0249020_50_1165	366
319	3300049571	Ga0501034_0303789	Ga0501034_0303789_214_1326	366
320	3300049580	Ga0501046_0082599	Ga0501046_0082599_1173_2294	366
321	3300049581	Ga0501047_0011509	Ga0501047_0011509_6057_7172	366
322	3300049588	Ga0501072_0002942	Ga0501072_0002942_3926_5029	366
323	3300049588	Ga0501072_0003002	Ga0501072_0003002_6721_7821	366
324	3300049588	Ga0501072_0146069	Ga0501072_0146069_170_1300	366
325	3300049743	Ga0501081_0161270	Ga0501081_0161270_269_1372	366
326	3300049823	Ga0501044_0042775	Ga0501044_0042775_2314_3417	366
327	3300049823	Ga0501044_0227654	Ga0501044_0227654_508_1623	366
328	3300050489	nmdc:mga03683_65129_c1	nmdc:mga03683_65129_c1_398_1498	366
329	3300050489	nmdc:mga03683_89243_c1	nmdc:mga03683_89243_c1_120_1220	366
330	3300050491	nmdc:mga00v17_126358_c1	nmdc:mga00v17_126358_c1_55_1155	366
331	3300050492	nmdc:mga0yw44_220150_c1	nmdc:mga0yw44_220150_c1_90_1202	366
332	3300050492	nmdc:mga0yw44_8753_c1	nmdc:mga0yw44_8753_c1_2607_3707	366
333	3300050493	nmdc:mga0k408_27793_c1	nmdc:mga0k408_27793_c1_1365_2465	366
334	3300050507	nmdc:mga05p37_165076_c2	nmdc:mga05p37_165076_c2_788_1888	366
335	3300050507	nmdc:mga05p37_40_c1	nmdc:mga05p37_40_c1_76165_77265	366
336	3300050507	nmdc:mga05p37_9654_c1	nmdc:mga05p37_9654_c1_9865_10965	366
337	3300050508	nmdc:mga09592_136375_c1	nmdc:mga09592_136375_c1_854_1954	366
338	3300050508	nmdc:mga09592_148829_c1	nmdc:mga09592_148829_c1_461_1561	366
339	3300050509	nmdc:mga0qj67_100286_c1	nmdc:mga0qj67_100286_c1_967_2067	366
340	3300050509	nmdc:mga0qj67_167513_c1	nmdc:mga0qj67_167513_c1_613_1719	366
341	3300050509	nmdc:mga0qj67_1747_c1	nmdc:mga0qj67_1747_c1_12681_13781	366
342	3300050509	nmdc:mga0qj67_19995_c1	nmdc:mga0qj67_19995_c1_1614_2747	366
343	3300050510	nmdc:mga06r32_140_c1	nmdc:mga06r32_140_c1_21990_23090	366
344	3300050510	nmdc:mga06r32_21927_c1	nmdc:mga06r32_21927_c1_2639_3772	366
345	3300050510	nmdc:mga06r32_232031_c1	nmdc:mga06r32_232031_c1_689_1789	366
346	3300050510	nmdc:mga06r32_89151_c2	nmdc:mga06r32_89151_c2_289_1395	366
347	3300050511	nmdc:mga08y16_237334_c1	nmdc:mga08y16_237334_c1_579_1679	366
348	3300050511	nmdc:mga08y16_294314_c1	nmdc:mga08y16_294314_c1_42_1142	366
349	3300050511	nmdc:mga08y16_3354_c1	nmdc:mga08y16_3354_c1_775_1875	366
350	3300050511	nmdc:mga08y16_99048_c1	nmdc:mga08y16_99048_c1_1849_2949	366
351	3300050512	nmdc:mga0n895_172768_c1	nmdc:mga0n895_172768_c1_269_1369	366
352	3300050513	nmdc:mga0rr50_28592_c1	nmdc:mga0rr50_28592_c1_1369_2469	366
353	3300050513	nmdc:mga0rr50_93904_c1	nmdc:mga0rr50_93904_c1_369_1475	366
354	3300050514	nmdc:mga08x19_22655_c1	nmdc:mga08x19_22655_c1_1490_2590	366
355	3300050515	nmdc:mga0a205_201051_c1	nmdc:mga0a205_201051_c1_331_1431	366
356	3300053077	Ga0495601_0000014	Ga0495601_0000014_218079_219179	366
357	3300053077	Ga0495601_0050962	Ga0495601_0050962_324_1436	366
358	3300053078	Ga0495612_0000123	Ga0495612_0000123_1140_2240	366
359	3300053084	Ga0495595_0000601	Ga0495595_0000601_11465_12565	366
360	3300053085	Ga0495619_0000006	Ga0495619_0000006_1140_2240	366
361	3300053085	Ga0495619_0204557	Ga0495619_0204557_209_1321	366
362	3300060353	Ga0501082_0003348	Ga0501082_0003348_390_1490	366
363	3300060353	Ga0501082_0079126	Ga0501082_0079126_1412_2515	366

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

50

396

0.89 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6m1w-assembly1.cif.gz_B-2	structure of the 2-aminoisobutyric acid monooxygenase hydroxylase	0.9048	17	366
8fun-assembly1.cif.gz_D	enzymatically active, mn/fe metallated form of aibh1h2	0.892	4	366
8fun-assembly1.cif.gz_D	enzymatically active, mn/fe metallated form of aibh1h2	0.8826	4	366
6m1w-assembly1.cif.gz_B-2	structure of the 2-aminoisobutyric acid monooxygenase hydroxylase	0.8746	17	366
6m2i-assembly1.cif.gz_B-2	structure of the 2-aminoisobutyric acid monooxygenase hydroxylase	0.8717	5	366

ID	Description	Score	Start	End	Superfamily
4ofcD00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases	0.7912	18	366	3.20.20.140
3nurA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases	0.7786	82	365	3.20.20.140
3ij6C00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases	0.7744	18	363	3.20.20.140
4ofcD00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases	0.7738	18	366	3.20.20.140
4icmA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases	0.7725	17	366	3.20.20.140

ID	Description	Score	Start	End	GO Terms
AF-A0A7C9VI65-F1-model_v4	Amidohydrolase	0.9681	223	365	GO:0005737 GO:0016787 GO:0016831 GO:0019748
AF-A0A1Q3YXF2-F1-model_v4	Hydrolase	0.9568	18	365	GO:0005737 GO:0016787 GO:0016831 GO:0019748
AF-A0A401U1S4-F1-model_v4	2-amino-3-carboxymuconate-6-semialdehyde decarboxylase (EC 4.1.1.45) (Picolinate carboxylase)	0.956	23	201	GO:0001760 GO:0005829 GO:0016787 GO:0019748 GO:1904985
AF-A0A2D6CZR2-F1-model_v4	Amidohydrolase-related domain-containing protein	0.9555	243	366	GO:0005737 GO:0016787 GO:0016831 GO:0019748
AF-A0A7C9VI65-F1-model_v4	Amidohydrolase	0.955	223	365	GO:0005737 GO:0016787 GO:0016831 GO:0019748

Feature Viewer

pLDDT	pTM	Quality
86.99	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F422962

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF04909

Amidohydro_2

Amidohydrolase

50

396

0.89

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map