F422955

General Info

Members Datasets Scaffolds Average Seq Length
363 203 726 397

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10104339|Ga0163162_101043391
Length 438
Sequence LSISDAASKISIVPAEPHELSRPQRKTMQRSTDRILVTHVGSLVRPMSIRNILWARDHGQPYDEAAYRKTLRDEVAGVVRQQAEAGIDIVSDGEYGKAGWIRYVSERLGGFDHRPFRVGDREQNPVYMIREAERFREFYEAYTPIQYYDWQPPGESKTGLNNTVSAIRQNLWVWECVAPITYKGQEAVGQDIANFKAALTNVNVTGGFMPVAAPMSARGLWLNAYYKSDEEIVVALADALKEEYKAIVDAGFILQLDDAFLAHEYDRLRGLTSDRDAHKYAERCIDLTNYALSGIPEDRVRYHVCWGSWNAPHTTDPPLRTLSDLILKIKAQAYSLESANPRHEHEWMVWKDVKLPDGKILIPGIVTHSTNVVEHPELVAWRIKNFASVVGRENVIAGTDCGFAQSYNIVRCHPSVQWAKLEALVEGARMASKELWGR

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 7.71
Rhizosphere 86.5
Stem 0
Stem Tuber 0
Unclassified 8.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10104339 3300013306 Bacteria 2929
2 JGI25405J52794_10003503 3300003911 Bacteria 2756
3 Ga0065712_10000440 3300005290 Bacteria 13842
4 Ga0065715_10015170 3300005293 Bacteria 4684
5 Ga0065715_10089825 3300005293 Bacteria 8384
6 Ga0070676_10045020 3300005328 Bacteria 2569
7 Ga0070690_100035313 3300005330 Bacteria 3136
8 Ga0070670_100031006 3300005331 Bacteria 4604
9 Ga0070670_100040454 3300005331 Bacteria 4008
10 Ga0070666_10054569 3300005335 Bacteria 2696
11 Ga0070680_100007165 3300005336 Bacteria 8498
12 Ga0070680_100023683 3300005336 Bacteria 4900
13 Ga0070682_100015512 3300005337 Bacteria 4416
14 Ga0070682_100080284 3300005337 Bacteria 2109
15 Ga0070660_100011008 3300005339 Bacteria 6410
16 Ga0070691_10010914 3300005341 Bacteria 4148
17 Ga0070675_100154682 3300005354 Bacteria 1968
18 Ga0070674_100052838 3300005356 Bacteria 2804
19 Ga0070674_100077661 3300005356 Bacteria 2364
20 Ga0070673_100080565 3300005364 Bacteria 2638
21 Ga0070659_100043434 3300005366 Bacteria 3515
22 Ga0070713_100003937 3300005436 Bacteria 9862
23 Ga0070713_100200040 3300005436 Bacteria 1804
24 Ga0070705_100061802 3300005440 Bacteria 2227
25 Ga0070694_100062855 3300005444 Bacteria 2537
26 Ga0070708_100003363 3300005445 Bacteria 12528
27 Ga0070708_100111437 3300005445 Bacteria 2516
28 Ga0070708_100135119 3300005445 Bacteria 2284
29 Ga0070708_100352770 3300005445 Bacteria 1386
30 Ga0070678_100030462 3300005456 Bacteria 3709
31 Ga0070678_100080443 3300005456 Bacteria 2468
32 Ga0070678_100187562 3300005456 Bacteria 1698
33 Ga0070681_10004620 3300005458 Bacteria 13149
34 Ga0070681_10007993 3300005458 Bacteria 10352
35 Ga0070681_10063251 3300005458 Bacteria 3673
36 Ga0070681_10089951 3300005458 Bacteria 3021
37 Ga0070706_100002919 3300005467 Bacteria 17017
38 Ga0070706_100088589 3300005467 Bacteria 2869
39 Ga0070707_100002054 3300005468 Bacteria 19285
40 Ga0070707_100011845 3300005468 Bacteria 8141
41 Ga0070707_100087210 3300005468 Bacteria 3019
42 Ga0070698_100263570 3300005471 Bacteria 1655
43 Ga0070699_100000663 3300005518 Bacteria 32166
44 Ga0070699_100030594 3300005518 Bacteria 4647
45 Ga0070679_100002535 3300005530 Bacteria 16544
46 Ga0070679_100038003 3300005530 Bacteria 4784
47 Ga0070679_100056076 3300005530 Bacteria 3925
48 Ga0070697_100001042 3300005536 Bacteria 20943
49 Ga0070697_100036320 3300005536 Unclassified 3980
50 Ga0070697_100168368 3300005536 Bacteria 1853
51 Ga0068853_100114782 3300005539 Bacteria 2396
52 Ga0070696_100063889 3300005546 Bacteria 2579
53 Ga0070665_100064264 3300005548 Bacteria 3680
54 Ga0070704_100145279 3300005549 Bacteria 1858
55 Ga0068855_100024451 3300005563 Bacteria 7226
56 Ga0070664_100010181 3300005564 Bacteria 7627
57 Ga0070664_100116086 3300005564 Bacteria 2340
58 Ga0070664_100247171 3300005564 Bacteria 1603
59 Ga0068856_100080010 3300005614 Bacteria 3241
60 Ga0068864_100261372 3300005618 Bacteria 1610
61 Ga0068858_100116823 3300005842 Bacteria 2493
62 Ga0081455_10001932 3300005937 Bacteria 24895
63 Ga0081455_10008996 3300005937 Bacteria 10312
64 Ga0081455_10012292 3300005937 Bacteria 8543
65 Ga0081455_10017579 3300005937 Bacteria 6846
66 Ga0081455_10139269 3300005937 Bacteria 1887
67 Ga0081538_10038244 3300005981 Unclassified 3099
68 Ga0081538_10040427 3300005981 Bacteria 2974
69 Ga0081540_1079782 3300005983 Bacteria 1478
70 Ga0081539_10017370 3300005985 Bacteria 5055
71 Ga0070717_10001154 3300006028 Bacteria 17843
72 Ga0070717_10012986 3300006028 Bacteria 6362
73 Ga0070717_10015989 3300006028 Bacteria 5809
74 Ga0070717_10089891 3300006028 Bacteria 2591
75 Ga0075365_10008928 3300006038 Bacteria 5726
76 Ga0070712_100009186 3300006175 Bacteria 6226
77 Ga0070712_100052648 3300006175 Bacteria 2840
78 Ga0070712_100087549 3300006175 Bacteria 2273
79 Ga0075362_10056793 3300006177 Bacteria 1763
80 Ga0097621_100111719 3300006237 Bacteria 2310
81 Ga0068871_100099862 3300006358 Bacteria 2430
82 Ga0068871_100141951 3300006358 Bacteria 2043
83 Ga0075430_100003261 3300006846 Bacteria 13593
84 Ga0075430_100112215 3300006846 Bacteria 2273
85 Ga0075431_100102960 3300006847 Bacteria 2946
86 Ga0075431_100133407 3300006847 Bacteria 2561
87 Ga0075434_100002051 3300006871 Bacteria 17487
88 Ga0075434_100033961 3300006871 Bacteria 5035
89 Ga0075434_100059672 3300006871 Bacteria 3793
90 Ga0075434_100271727 3300006871 Bacteria 1714
91 Ga0075435_100177620 3300007076 Bacteria 1798
92 Ga0105240_10259999 3300009093 Bacteria 2003
93 Ga0111539_10080155 3300009094 Bacteria 3840
94 Ga0105245_10001585 3300009098 Bacteria 20674
95 Ga0105245_10005407 3300009098 Bacteria 11223
96 Ga0105245_10153662 3300009098 Bacteria 2178
97 Ga0114129_10038204 3300009147 Bacteria 6774
98 Ga0114129_10223918 3300009147 Bacteria 2536
99 Ga0114129_10349896 3300009147 Bacteria 1958
100 Ga0114129_10350575 3300009147 Bacteria 1956
101 Ga0105241_10128091 3300009174 Bacteria 2052
102 Ga0105241_10138513 3300009174 Bacteria 1979
103 Ga0105242_10052858 3300009176 Bacteria 3316
104 Ga0105248_10002542 3300009177 Bacteria 20317
105 Ga0105248_10474164 3300009177 Bacteria 1411
106 Ga0105238_10148536 3300009551 Bacteria 2320
107 Ga0105238_10203061 3300009551 Bacteria 1958
108 Ga0105238_10356030 3300009551 Unclassified 1453
109 Ga0105239_10110038 3300010375 Bacteria 3054
110 Ga0157370_10001602 3300013104 Bacteria 27969
111 Ga0157374_10249535 3300013296 Bacteria 1746
112 Ga0157378_10066280 3300013297 Bacteria 3234
113 Ga0163162_10065441 3300013306 Bacteria 3682
114 Ga0157372_10116261 3300013307 Bacteria 3067
115 Ga0157375_10065198 3300013308 Bacteria 3630
116 Ga0163163_10001592 3300014325 Bacteria 19081
117 Ga0157379_10371603 3300014968 Unclassified 1311
118 Ga0157376_10068612 3300014969 Bacteria 3003
119 Ga0213876_10028954 3300021384 Bacteria 2921
120 Ga0213875_10000153 3300021388 Bacteria 73168
121 Ga0224712_10047402 3300022467 Bacteria 1654
122 Ga0207680_10104312 3300025903 Bacteria 1827
123 Ga0207684_10006095 3300025910 Bacteria 11028
124 Ga0207684_10034220 3300025910 Unclassified 4318
125 Ga0207684_10228791 3300025910 Bacteria 1604
126 Ga0207654_10080254 3300025911 Bacteria 1961
127 Ga0207707_10003353 3300025912 Bacteria 14220
128 Ga0207707_10072174 3300025912 Bacteria 3009
129 Ga0207695_10269553 3300025913 Unclassified 1598
130 Ga0207693_10014471 3300025915 Bacteria 6341
131 Ga0207693_10071360 3300025915 Bacteria 2718
132 Ga0207693_10141940 3300025915 Bacteria 1888
133 Ga0207663_10025542 3300025916 Bacteria 3416
134 Ga0207660_10013871 3300025917 Bacteria 5287
135 Ga0207660_10081028 3300025917 Bacteria 2385
136 Ga0207660_10090646 3300025917 Bacteria 2266
137 Ga0207657_10001659 3300025919 Bacteria 24001
138 Ga0207649_10031134 3300025920 Bacteria 3168
139 Ga0207652_10024831 3300025921 Bacteria 4974
140 Ga0207652_10254203 3300025921 Bacteria 1585
141 Ga0207646_10008942 3300025922 Bacteria 9974
142 Ga0207681_10178768 3300025923 Bacteria 1614
143 Ga0207694_10137032 3300025924 Bacteria 1967
144 Ga0207650_10008509 3300025925 Bacteria 7004
145 Ga0207659_10116744 3300025926 Bacteria 2038
146 Ga0207659_10146737 3300025926 Bacteria 1838
147 Ga0207687_10074929 3300025927 Bacteria 2427
148 Ga0207700_10040625 3300025928 Bacteria 3396
149 Ga0207700_10204566 3300025928 Bacteria 1665
150 Ga0207690_10125559 3300025932 Bacteria 1870
151 Ga0207706_10042016 3300025933 Bacteria 4051
152 Ga0207669_10035987 3300025937 Bacteria 2824
153 Ga0207691_10051460 3300025940 Bacteria 3766
154 Ga0207711_10013609 3300025941 Bacteria 6759
155 Ga0207689_10067030 3300025942 Bacteria 2950
156 Ga0207668_10099382 3300025972 Bacteria 2159
157 Ga0207640_10165809 3300025981 Bacteria 1640
158 Ga0207677_10012018 3300026023 Bacteria 4959
159 Ga0207703_10216712 3300026035 Bacteria 1710
160 Ga0207678_10010999 3300026067 Bacteria 7948
161 Ga0207641_10146758 3300026088 Bacteria 2134
162 Ga0207648_10043243 3300026089 Bacteria 3955
163 Ga0207648_10206225 3300026089 Bacteria 1744
164 Ga0207683_10069053 3300026121 Bacteria 3121
165 Ga0207683_10161742 3300026121 Bacteria 2024
166 Ga0207683_10238668 3300026121 Bacteria 1658
167 Ga0207698_10257152 3300026142 Bacteria 1602
168 Ga0268266_10111896 3300028379 Bacteria 2420
169 Ga0307408_100026768 3300031548 Bacteria 3966
170 Ga0307408_100153866 3300031548 Bacteria 1818
171 Ga0307413_10013241 3300031824 Bacteria 4137
172 Ga0307407_10096635 3300031903 Bacteria 1824
173 Ga0307409_100001483 3300031995 Bacteria 11574
174 Ga0307409_100191671 3300031995 Bacteria 1820
175 Ga0307409_100327577 3300031995 Bacteria 1436
176 Ga0307416_100005050 3300032002 Bacteria 8042
177 Ga0307414_10010794 3300032004 Bacteria 5326
178 Ga0307411_10002006 3300032005 Bacteria 8728
179 Ga0307411_10022836 3300032005 Bacteria 3693
180 Ga0307415_100002238 3300032126 Bacteria 9573
181 Ga0373934_0034996 3300035086 Bacteria 1975
182 Ga0373961_0034173 3300035241 Bacteria 1436
183 Ga0373931_0014748 3300035691 Bacteria 3825
184 Ga0373935_0191026 3300035692 Bacteria 1411
185 Ga0373933_0000757 3300035724 Bacteria 19803
186 Ga0373937_0000170 3300036401 Bacteria 63587
187 Ga0373937_0000744 3300036401 Bacteria 28108
188 Ga0373937_0073588 3300036401 Bacteria 3152
189 Ga0436364_0064185 3300037853 Bacteria 21115
190 Ga0436364_0520097 3300037853 Bacteria 8710
191 Ga0436364_0520299 3300037853 Bacteria 25980
192 Ga0436364_1027018 3300037853 Bacteria 10268
193 Ga0436364_1193450 3300037853 Bacteria 24753
194 Ga0436364_1509247 3300037853 Bacteria 5870
195 Ga0400485_07786 3300038735 Bacteria 8422
196 Ga0436365_0805715 3300039437 Unclassified 2365
197 Ga0436365_0983980 3300039437 Bacteria 10324
198 Ga0436365_1036483 3300039437 Bacteria 2671
199 Ga0436365_1785808 3300039437 Bacteria 42876
200 Ga0436365_1844272 3300039437 Bacteria 15974
201 Ga0436365_1878166 3300039437 Bacteria 34702
202 Ga0436361_1214790 3300039447 Unclassified 1151
203 Ga0436363_1581596 3300039450 Bacteria 1511
204 Ga0436362_0709695 3300039453 Bacteria 2337
205 Ga0436362_0945518 3300039453 Bacteria 2258
206 Ga0439453_0003278 3300041408 Bacteria 2315
207 Ga0451576_0513569 3300045051 Bacteria 1259
208 Ga0466967_0059116 3300045976 Bacteria 3392
209 Ga0495592_0054460 3300046454 Bacteria 2964
210 Ga0495592_0060914 3300046454 Bacteria 2775
211 Ga0495629_0022868 3300046459 Bacteria 4455
212 Ga0495651_0001720 3300046462 Bacteria 16894
213 Ga0495651_0049502 3300046462 Bacteria 3243
214 Ga0495653_0042664 3300046463 Bacteria 3531
215 Ga0495662_0040159 3300046476 Bacteria 2260
216 Ga0495618_0071682 3300046514 Bacteria 2204
217 Ga0495628_0063716 3300046516 Unclassified 2888
218 Ga0495630_0113603 3300046517 Unclassified 2052
219 Ga0495652_0017276 3300046529 Bacteria 6440
220 Ga0495640_0078158 3300046533 Bacteria 2205
221 Ga0495587_0001357 3300046536 Bacteria 16248
222 Ga0495667_0061180 3300046559 Bacteria 2469
223 Ga0495667_0222067 3300046559 Bacteria 1206
224 Ga0495634_0011508 3300046642 Bacteria 6437
225 Ga0495635_0129620 3300046663 Unclassified 1720
226 Ga0495623_0011621 3300046679 Bacteria 5703
227 Ga0495646_0005780 3300046680 Bacteria 7848
228 Ga0495624_0027791 3300046690 Unclassified 3701
229 Ga0495624_0092855 3300046690 Unclassified 1861
230 Ga0495600_0043709 3300046809 Bacteria 2922
231 Ga0495604_0002906 3300047317 Bacteria 13735
232 Ga0495604_0027900 3300047317 Unclassified 4491
233 Ga0495674_0013353 3300047319 Bacteria 7724
234 Ga0495674_0056432 3300047319 Bacteria 3439
235 Ga0495674_0061414 3300047319 Unclassified 3275
236 Ga0495672_0135240 3300047320 Unclassified 1293
237 Ga0495675_0001588 3300047444 Bacteria 13680
238 Ga0495684_0030825 3300047471 Bacteria 4117
239 Ga0495684_0046911 3300047471 Bacteria 3305
240 Ga0495602_0000456 3300048088 Bacteria 38089
241 Ga0495602_0014785 3300048088 Bacteria 7908
242 Ga0496102_0126872 3300048905 Bacteria 2386
243 Ga0496102_0178046 3300048905 Bacteria 2003
244 Ga0496102_0344731 3300048905 Unclassified 1403
245 Ga0496104_0000570 3300048907 Bacteria 31515
246 Ga0496104_0001124 3300048907 Bacteria 22893
247 Ga0496104_0014253 3300048907 Bacteria 7176
248 Ga0496104_0027360 3300048907 Bacteria 5276
249 Ga0496104_0210161 3300048907 Bacteria 1857
250 Ga0496104_0259603 3300048907 Bacteria 1650
251 Ga0496105_0005883 3300048908 Bacteria 9352
252 Ga0496105_0029661 3300048908 Bacteria 4478
253 Ga0496105_0038661 3300048908 Bacteria 3931
254 Ga0496105_0195693 3300048908 Bacteria 1652
255 Ga0496105_0207970 3300048908 Bacteria 1596
256 Ga0496106_0083571 3300048909 Bacteria 2456
257 Ga0496106_0217692 3300048909 Bacteria 1522
258 Ga0496108_0249815 3300048911 Bacteria 1543
259 Ga0496109_0104599 3300048912 Bacteria 2629
260 Ga0496110_0316709 3300048913 Bacteria 1421
261 Ga0496111_0170349 3300048914 Bacteria 1618
262 Ga0496112_0022624 3300048915 Bacteria 5993
263 Ga0496112_0040327 3300048915 Bacteria 4565
264 Ga0496112_0068404 3300048915 Bacteria 3507
265 Ga0496112_0115418 3300048915 Bacteria 2656
266 Ga0496112_0125428 3300048915 Bacteria 2538
267 Ga0496113_0265552 3300048916 Bacteria 1371
268 Ga0496115_0011998 3300048918 Bacteria 6513
269 Ga0496115_0136513 3300048918 Bacteria 2022
270 Ga0496126_0149764 3300048929 Bacteria 2001
271 Ga0501033_0045557 3300049570 Bacteria 3264
272 Ga0501033_0168998 3300049570 Bacteria 1571
273 Ga0501034_0196722 3300049571 Bacteria 1975
274 Ga0501036_0012071 3300049572 Bacteria 7158
275 Ga0501036_0046277 3300049572 Bacteria 3684
276 Ga0501036_0093578 3300049572 Bacteria 2539
277 Ga0501038_0020162 3300049574 Bacteria 5999
278 Ga0501038_0021304 3300049574 Bacteria 5820
279 Ga0501038_0084161 3300049574 Unclassified 2677
280 Ga0501038_0112026 3300049574 Bacteria 2259
281 Ga0501039_0029991 3300049575 Bacteria 4191
282 Ga0501039_0053124 3300049575 Bacteria 3135
283 Ga0501039_0163463 3300049575 Bacteria 1750
284 Ga0501039_0198664 3300049575 Bacteria 1577
285 Ga0501041_0009035 3300049577 Bacteria 5863
286 Ga0501041_0128262 3300049577 Bacteria 1580
287 Ga0501042_0014812 3300049578 Bacteria 5326
288 Ga0501042_0037022 3300049578 Unclassified 3462
289 Ga0501043_0048882 3300049579 Bacteria 3324
290 Ga0501043_0079141 3300049579 Unclassified 2583
291 Ga0501043_0165481 3300049579 Bacteria 1727
292 Ga0501046_0005557 3300049580 Bacteria 11262
293 Ga0501046_0076581 3300049580 Bacteria 2591
294 Ga0501047_0013295 3300049581 Bacteria 7796
295 Ga0501047_0026279 3300049581 Bacteria 5600
296 Ga0501048_0016413 3300049582 Bacteria 5457
297 Ga0501048_0164175 3300049582 Bacteria 1572
298 Ga0501068_0048184 3300049584 Bacteria 2572
299 Ga0501068_0069748 3300049584 Bacteria 2143
300 Ga0501070_0021979 3300049586 Bacteria 5345
301 Ga0501071_0013293 3300049587 Bacteria 5609
302 Ga0501071_0024737 3300049587 Unclassified 4200
303 Ga0501072_0001294 3300049588 Bacteria 18717
304 Ga0501072_0165198 3300049588 Unclassified 1766
305 Ga0501074_0044502 3300049590 Bacteria 3213
306 Ga0501074_0206755 3300049590 Bacteria 1399
307 Ga0501075_0008708 3300049591 Bacteria 7074
308 Ga0501075_0012475 3300049591 Bacteria 6040
309 Ga0501075_0024718 3300049591 Unclassified 4409
310 Ga0501076_0000466 3300049592 Bacteria 25548
311 Ga0501076_0174357 3300049592 Bacteria 1753
312 Ga0501076_0215651 3300049592 Bacteria 1569
313 Ga0501076_0269776 3300049592 Bacteria 1393
314 Ga0501077_0007044 3300049593 Bacteria 6933
315 Ga0501077_0071119 3300049593 Bacteria 2205
316 Ga0501077_0147011 3300049593 Bacteria 1495
317 Ga0501079_0005266 3300049741 Bacteria 9618
318 Ga0501079_0018900 3300049741 Bacteria 5266
319 Ga0501080_0021563 3300049742 Bacteria 5962
320 Ga0501080_0071278 3300049742 Bacteria 3232
321 Ga0501080_0083009 3300049742 Unclassified 2977
322 Ga0501080_0118604 3300049742 Bacteria 2453
323 Ga0501081_0007601 3300049743 Bacteria 7027
324 Ga0501081_0019004 3300049743 Unclassified 4570
325 Ga0501081_0034253 3300049743 Bacteria 3454
326 Ga0501083_0154049 3300049744 Bacteria 1505
327 Ga0501035_0017993 3300049822 Bacteria 6516
328 Ga0501035_0034501 3300049822 Bacteria 4597
329 Ga0501035_0199711 3300049822 Bacteria 1716
330 Ga0501044_0031591 3300049823 Bacteria 5572
331 Ga0501044_0249069 3300049823 Bacteria 1718
332 nmdc:mga0yw44_1931_c1 3300050492 Bacteria 8576
333 nmdc:mga05p37_14064_c1 3300050507 Bacteria 9603
334 nmdc:mga05p37_185586_c1 3300050507 Bacteria 2529
335 nmdc:mga0qj67_141843_c1 3300050509 Unclassified 1948
336 nmdc:mga0qj67_156238_c1 3300050509 Bacteria 1851
337 nmdc:mga0qj67_66566_c1 3300050509 Bacteria 2869
338 nmdc:mga06r32_138967_c1 3300050510 Unclassified 2405
339 nmdc:mga06r32_213213_c1 3300050510 Bacteria 1919
340 nmdc:mga08y16_51195_c1 3300050511 Bacteria 4320
341 nmdc:mga0n895_220812_c1 3300050512 Bacteria 1924
342 nmdc:mga0n895_30040_c1 3300050512 Bacteria 5189
343 nmdc:mga0n895_73281_c1 3300050512 Unclassified 3400
344 nmdc:mga0rr50_2587_c1 3300050513 Bacteria 10248
345 Ga0495601_0001225 3300053077 Bacteria 14078
346 Ga0495601_0010407 3300053077 Bacteria 5534
347 Ga0495612_0006214 3300053078 Unclassified 4917
348 Ga0495619_0001936 3300053085 Bacteria 13804
349 Ga0495619_0006942 3300053085 Bacteria 7162
350 Ga0495619_0010110 3300053085 Bacteria 5940
351 Ga0495619_0021408 3300053085 Bacteria 4128
352 Ga0495619_0041836 3300053085 Bacteria 2998
353 Ga0495619_0131428 3300053085 Bacteria 1720
354 Ga0500568_0006075 3300053139 Bacteria 6124
355 Ga0501084_0027827 3300054114 Bacteria 4724
356 Ga0501084_0200575 3300054114 Bacteria 1683
357 Ga0501082_0001175 3300060353 Bacteria 22993
358 Ga0501082_0038391 3300060353 Unclassified 4132
359 Ga0501082_0046993 3300060353 Bacteria 3720
360 Ga0530510_0014775 3300061734 Bacteria 5512
361 Ga0530510_0017252 3300061734 Bacteria 5115
362 Ga0530510_0044939 3300061734 Bacteria 3192
363 Ga0530510_0079181 3300061734 Bacteria 2390
364 Ga0163162_10104339
365 JGI25405J52794_10003503
366 Ga0065712_10000440
367 Ga0065715_10015170
368 Ga0065715_10089825
369 Ga0070676_10045020
370 Ga0070690_100035313
371 Ga0070670_100031006
372 Ga0070670_100040454
373 Ga0070666_10054569
374 Ga0070680_100007165
375 Ga0070680_100023683
376 Ga0070682_100015512
377 Ga0070682_100080284
378 Ga0070660_100011008
379 Ga0070691_10010914
380 Ga0070675_100154682
381 Ga0070674_100052838
382 Ga0070674_100077661
383 Ga0070673_100080565
384 Ga0070659_100043434
385 Ga0070713_100003937
386 Ga0070713_100200040
387 Ga0070705_100061802
388 Ga0070694_100062855
389 Ga0070708_100003363
390 Ga0070708_100111437
391 Ga0070708_100135119
392 Ga0070708_100352770
393 Ga0070678_100030462
394 Ga0070678_100080443
395 Ga0070678_100187562
396 Ga0070681_10004620
397 Ga0070681_10007993
398 Ga0070681_10063251
399 Ga0070681_10089951
400 Ga0070706_100002919
401 Ga0070706_100088589
402 Ga0070707_100002054
403 Ga0070707_100011845
404 Ga0070707_100087210
405 Ga0070698_100263570
406 Ga0070699_100000663
407 Ga0070699_100030594
408 Ga0070679_100002535
409 Ga0070679_100038003
410 Ga0070679_100056076
411 Ga0070697_100001042
412 Ga0070697_100036320
413 Ga0070697_100168368
414 Ga0068853_100114782
415 Ga0070696_100063889
416 Ga0070665_100064264
417 Ga0070704_100145279
418 Ga0068855_100024451
419 Ga0070664_100010181
420 Ga0070664_100116086
421 Ga0070664_100247171
422 Ga0068856_100080010
423 Ga0068864_100261372
424 Ga0068858_100116823
425 Ga0081455_10001932
426 Ga0081455_10008996
427 Ga0081455_10012292
428 Ga0081455_10017579
429 Ga0081455_10139269
430 Ga0081538_10038244
431 Ga0081538_10040427
432 Ga0081540_1079782
433 Ga0081539_10017370
434 Ga0070717_10001154
435 Ga0070717_10012986
436 Ga0070717_10015989
437 Ga0070717_10089891
438 Ga0075365_10008928
439 Ga0070712_100009186
440 Ga0070712_100052648
441 Ga0070712_100087549
442 Ga0075362_10056793
443 Ga0097621_100111719
444 Ga0068871_100099862
445 Ga0068871_100141951
446 Ga0075430_100003261
447 Ga0075430_100112215
448 Ga0075431_100102960
449 Ga0075431_100133407
450 Ga0075434_100002051
451 Ga0075434_100033961
452 Ga0075434_100059672
453 Ga0075434_100271727
454 Ga0075435_100177620
455 Ga0105240_10259999
456 Ga0111539_10080155
457 Ga0105245_10001585
458 Ga0105245_10005407
459 Ga0105245_10153662
460 Ga0114129_10038204
461 Ga0114129_10223918
462 Ga0114129_10349896
463 Ga0114129_10350575
464 Ga0105241_10128091
465 Ga0105241_10138513
466 Ga0105242_10052858
467 Ga0105248_10002542
468 Ga0105248_10474164
469 Ga0105238_10148536
470 Ga0105238_10203061
471 Ga0105238_10356030
472 Ga0105239_10110038
473 Ga0157370_10001602
474 Ga0157374_10249535
475 Ga0157378_10066280
476 Ga0163162_10065441
477 Ga0157372_10116261
478 Ga0157375_10065198
479 Ga0163163_10001592
480 Ga0157379_10371603
481 Ga0157376_10068612
482 Ga0213876_10028954
483 Ga0213875_10000153
484 Ga0224712_10047402
485 Ga0207680_10104312
486 Ga0207684_10006095
487 Ga0207684_10034220
488 Ga0207684_10228791
489 Ga0207654_10080254
490 Ga0207707_10003353
491 Ga0207707_10072174
492 Ga0207695_10269553
493 Ga0207693_10014471
494 Ga0207693_10071360
495 Ga0207693_10141940
496 Ga0207663_10025542
497 Ga0207660_10013871
498 Ga0207660_10081028
499 Ga0207660_10090646
500 Ga0207657_10001659
501 Ga0207649_10031134
502 Ga0207652_10024831
503 Ga0207652_10254203
504 Ga0207646_10008942
505 Ga0207681_10178768
506 Ga0207694_10137032
507 Ga0207650_10008509
508 Ga0207659_10116744
509 Ga0207659_10146737
510 Ga0207687_10074929
511 Ga0207700_10040625
512 Ga0207700_10204566
513 Ga0207690_10125559
514 Ga0207706_10042016
515 Ga0207669_10035987
516 Ga0207691_10051460
517 Ga0207711_10013609
518 Ga0207689_10067030
519 Ga0207668_10099382
520 Ga0207640_10165809
521 Ga0207677_10012018
522 Ga0207703_10216712
523 Ga0207678_10010999
524 Ga0207641_10146758
525 Ga0207648_10043243
526 Ga0207648_10206225
527 Ga0207683_10069053
528 Ga0207683_10161742
529 Ga0207683_10238668
530 Ga0207698_10257152
531 Ga0268266_10111896
532 Ga0307408_100026768
533 Ga0307408_100153866
534 Ga0307413_10013241
535 Ga0307407_10096635
536 Ga0307409_100001483
537 Ga0307409_100191671
538 Ga0307409_100327577
539 Ga0307416_100005050
540 Ga0307414_10010794
541 Ga0307411_10002006
542 Ga0307411_10022836
543 Ga0307415_100002238
544 Ga0373934_0034996
545 Ga0373961_0034173
546 Ga0373931_0014748
547 Ga0373935_0191026
548 Ga0373933_0000757
549 Ga0373937_0000170
550 Ga0373937_0000744
551 Ga0373937_0073588
552 Ga0436364_0064185
553 Ga0436364_0520097
554 Ga0436364_0520299
555 Ga0436364_1027018
556 Ga0436364_1193450
557 Ga0436364_1509247
558 Ga0400485_07786
559 Ga0436365_0805715
560 Ga0436365_0983980
561 Ga0436365_1036483
562 Ga0436365_1785808
563 Ga0436365_1844272
564 Ga0436365_1878166
565 Ga0436361_1214790
566 Ga0436363_1581596
567 Ga0436362_0709695
568 Ga0436362_0945518
569 Ga0439453_0003278
570 Ga0451576_0513569
571 Ga0466967_0059116
572 Ga0495592_0054460
573 Ga0495592_0060914
574 Ga0495629_0022868
575 Ga0495651_0001720
576 Ga0495651_0049502
577 Ga0495653_0042664
578 Ga0495662_0040159
579 Ga0495618_0071682
580 Ga0495628_0063716
581 Ga0495630_0113603
582 Ga0495652_0017276
583 Ga0495640_0078158
584 Ga0495587_0001357
585 Ga0495667_0061180
586 Ga0495667_0222067
587 Ga0495634_0011508
588 Ga0495635_0129620
589 Ga0495623_0011621
590 Ga0495646_0005780
591 Ga0495624_0027791
592 Ga0495624_0092855
593 Ga0495600_0043709
594 Ga0495604_0002906
595 Ga0495604_0027900
596 Ga0495674_0013353
597 Ga0495674_0056432
598 Ga0495674_0061414
599 Ga0495672_0135240
600 Ga0495675_0001588
601 Ga0495684_0030825
602 Ga0495684_0046911
603 Ga0495602_0000456
604 Ga0495602_0014785
605 Ga0496102_0126872
606 Ga0496102_0178046
607 Ga0496102_0344731
608 Ga0496104_0000570
609 Ga0496104_0001124
610 Ga0496104_0014253
611 Ga0496104_0027360
612 Ga0496104_0210161
613 Ga0496104_0259603
614 Ga0496105_0005883
615 Ga0496105_0029661
616 Ga0496105_0038661
617 Ga0496105_0195693
618 Ga0496105_0207970
619 Ga0496106_0083571
620 Ga0496106_0217692
621 Ga0496108_0249815
622 Ga0496109_0104599
623 Ga0496110_0316709
624 Ga0496111_0170349
625 Ga0496112_0022624
626 Ga0496112_0040327
627 Ga0496112_0068404
628 Ga0496112_0115418
629 Ga0496112_0125428
630 Ga0496113_0265552
631 Ga0496115_0011998
632 Ga0496115_0136513
633 Ga0496126_0149764
634 Ga0501033_0045557
635 Ga0501033_0168998
636 Ga0501034_0196722
637 Ga0501036_0012071
638 Ga0501036_0046277
639 Ga0501036_0093578
640 Ga0501038_0020162
641 Ga0501038_0021304
642 Ga0501038_0084161
643 Ga0501038_0112026
644 Ga0501039_0029991
645 Ga0501039_0053124
646 Ga0501039_0163463
647 Ga0501039_0198664
648 Ga0501041_0009035
649 Ga0501041_0128262
650 Ga0501042_0014812
651 Ga0501042_0037022
652 Ga0501043_0048882
653 Ga0501043_0079141
654 Ga0501043_0165481
655 Ga0501046_0005557
656 Ga0501046_0076581
657 Ga0501047_0013295
658 Ga0501047_0026279
659 Ga0501048_0016413
660 Ga0501048_0164175
661 Ga0501068_0048184
662 Ga0501068_0069748
663 Ga0501070_0021979
664 Ga0501071_0013293
665 Ga0501071_0024737
666 Ga0501072_0001294
667 Ga0501072_0165198
668 Ga0501074_0044502
669 Ga0501074_0206755
670 Ga0501075_0008708
671 Ga0501075_0012475
672 Ga0501075_0024718
673 Ga0501076_0000466
674 Ga0501076_0174357
675 Ga0501076_0215651
676 Ga0501076_0269776
677 Ga0501077_0007044
678 Ga0501077_0071119
679 Ga0501077_0147011
680 Ga0501079_0005266
681 Ga0501079_0018900
682 Ga0501080_0021563
683 Ga0501080_0071278
684 Ga0501080_0083009
685 Ga0501080_0118604
686 Ga0501081_0007601
687 Ga0501081_0019004
688 Ga0501081_0034253
689 Ga0501083_0154049
690 Ga0501035_0017993
691 Ga0501035_0034501
692 Ga0501035_0199711
693 Ga0501044_0031591
694 Ga0501044_0249069
695 nmdc:mga0yw44_1931_c1
696 nmdc:mga05p37_14064_c1
697 nmdc:mga05p37_185586_c1
698 nmdc:mga0qj67_141843_c1
699 nmdc:mga0qj67_156238_c1
700 nmdc:mga0qj67_66566_c1
701 nmdc:mga06r32_138967_c1
702 nmdc:mga06r32_213213_c1
703 nmdc:mga08y16_51195_c1
704 nmdc:mga0n895_220812_c1
705 nmdc:mga0n895_30040_c1
706 nmdc:mga0n895_73281_c1
707 nmdc:mga0rr50_2587_c1
708 Ga0495601_0001225
709 Ga0495601_0010407
710 Ga0495612_0006214
711 Ga0495619_0001936
712 Ga0495619_0006942
713 Ga0495619_0010110
714 Ga0495619_0021408
715 Ga0495619_0041836
716 Ga0495619_0131428
717 Ga0500568_0006075
718 Ga0501084_0027827
719 Ga0501084_0200575
720 Ga0501082_0001175
721 Ga0501082_0038391
722 Ga0501082_0046993
723 Ga0530510_0014775
724 Ga0530510_0017252
725 Ga0530510_0044939
726 Ga0530510_0079181

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01717

Meth_synt_2

Cobalamin-independent synthase, Catalytic domain

35

117

0.89

PF01717

Meth_synt_2

Cobalamin-independent synthase, Catalytic domain

223

419

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xr2-assembly1.cif.gz_A crystal structure of oxidized t. maritima cobalamin-independent methionine synthase complexed with methyltetrahydrofolate 0.8636 8 393
1xdj-assembly2.cif.gz_B crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ and homocysteine 0.8605 7 395
1xr2-assembly2.cif.gz_B crystal structure of oxidized t. maritima cobalamin-independent methionine synthase complexed with methyltetrahydrofolate 0.8599 7 396
1xpg-assembly1.cif.gz_A crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ and methyltetrahydrofolate 0.8573 7 397
3bq6-assembly1.cif.gz_A crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ (monoclinic) 0.8545 8 397
ID Description Score Start End Superfamily
1xdjA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8599 8 397 3.20.20.210
af_K7MME4_84_171_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8567 312 393 3.20.20.210
2nq5A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8321 7 396 3.20.20.210
af_K7KK03_1_110_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8282 286 398 3.20.20.210
4l61A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8246 6 395 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A251XH34-F1-model_v4 Uncharacterized protein 0.9922 243 358
AF-A0A2V8N9N3-F1-model_v4 Epoxyalkane--coenzyme M transferase 0.9905 261 399 GO:0016740
AF-A0A537W1R3-F1-model_v4 Epoxyalkane--coenzyme M transferase 0.9876 299 398 GO:0003871
GO:0008270
GO:0009086
AF-A0A537QYG2-F1-model_v4 Epoxyalkane--coenzyme M transferase 0.9871 248 401 GO:0003871
GO:0008270
GO:0009086
AF-A0A399P223-F1-model_v4 Epoxyalkane--coenzyme M transferase 0.9868 226 399 GO:0003871
GO:0008270
GO:0009086

Map