F422895

General Info

Members Datasets Scaffolds Average Seq Length
363 206 726 183

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100043360|Ga0070699_1000433604
Length 188
Sequence VILYRCFAWKKAARDDAPDGPLWFPRPFQGEGRHDNPDAYGCLYLADRAVSCVVEQLAPFRGQRLIAPLLRRRDLPLALAQIELNGDAALLDLDDPSVLRRERLRPSQVATRHRSVTQPQALDLYRRHPDAAGLRWWSAWEAIWANVTVFDRAAKALRLIDVTELTLDHPNLLEAAELFGLRVVERRV

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
77 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
78 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
91 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
92 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
93 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
117 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
124 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
203 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.74
Rhizosphere 89.26
Stem 0
Stem Tuber 0
Unclassified 14.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100043360 3300005518 Bacteria 3894
2 Ga0070658_10039145 3300005327 Bacteria 3824
3 Ga0070658_10090003 3300005327 Bacteria 2528
4 Ga0070680_100049167 3300005336 Bacteria 3437
5 Ga0070680_100089868 3300005336 Bacteria 2542
6 Ga0070682_100731979 3300005337 Unclassified 796
7 Ga0070660_100009546 3300005339 Bacteria 6832
8 Ga0070660_100191790 3300005339 Bacteria 1655
9 Ga0070691_10115838 3300005341 Bacteria 1345
10 Ga0070661_100193705 3300005344 Bacteria 1551
11 Ga0070661_100272008 3300005344 Unclassified 1312
12 Ga0070661_100508288 3300005344 Bacteria 965
13 Ga0070671_100358869 3300005355 Bacteria 1244
14 Ga0070674_101202596 3300005356 Bacteria 673
15 Ga0070709_10034416 3300005434 Bacteria 3071
16 Ga0070709_10123018 3300005434 Bacteria 1761
17 Ga0070714_100059965 3300005435 Bacteria 3264
18 Ga0070714_101201444 3300005435 Unclassified 740
19 Ga0070713_100035410 3300005436 Bacteria 4018
20 Ga0070713_100102754 3300005436 Bacteria 2479
21 Ga0070710_10067626 3300005437 Unclassified 2050
22 Ga0070711_100130710 3300005439 Bacteria 1869
23 Ga0070694_100348941 3300005444 Bacteria 1146
24 Ga0070681_10046665 3300005458 Bacteria 4330
25 Ga0070707_100188154 3300005468 Bacteria 2013
26 Ga0070707_100507355 3300005468 Bacteria 1168
27 Ga0070679_100021888 3300005530 Bacteria 6245
28 Ga0070679_100046940 3300005530 Bacteria 4306
29 Ga0070679_100157624 3300005530 Bacteria 2244
30 Ga0070684_100115793 3300005535 Bacteria 2407
31 Ga0070684_101038047 3300005535 Unclassified 770
32 Ga0070695_100000347 3300005545 Bacteria 23666
33 Ga0070704_100066548 3300005549 Bacteria 2599
34 Ga0070664_100291267 3300005564 Bacteria 1474
35 Ga0068856_100081777 3300005614 Bacteria 3205
36 Ga0068858_100547872 3300005842 Bacteria 1120
37 Ga0070717_10452345 3300006028 Bacteria 1157
38 Ga0070717_10509766 3300006028 Unclassified 1088
39 Ga0070715_10000160 3300006163 Bacteria 15702
40 Ga0070716_100002694 3300006173 Bacteria 8226
41 Ga0070716_100057178 3300006173 Bacteria 2241
42 Ga0070712_100335940 3300006175 Bacteria 1232
43 Ga0070712_100339400 3300006175 Unclassified 1226
44 Ga0097621_100756502 3300006237 Unclassified 898
45 Ga0097621_100800956 3300006237 Bacteria 873
46 Ga0075433_10578670 3300006852 Bacteria 986
47 Ga0075434_100053127 3300006871 Bacteria 4026
48 Ga0075434_100302106 3300006871 Bacteria 1621
49 Ga0075436_100055854 3300006914 Unclassified 2727
50 Ga0075435_100011198 3300007076 Bacteria 6582
51 Ga0075435_100668714 3300007076 Bacteria 902
52 Ga0105251_10150717 3300009011 Unclassified 1050
53 Ga0105240_10045540 3300009093 Bacteria 5564
54 Ga0105240_10280287 3300009093 Bacteria 1915
55 Ga0111539_10849591 3300009094 Bacteria 1062
56 Ga0105245_10698200 3300009098 Bacteria 1048
57 Ga0105241_11133186 3300009174 Bacteria 738
58 Ga0105238_10147112 3300009551 Bacteria 2332
59 Ga0157370_11072308 3300013104 Bacteria 728
60 Ga0157369_10133714 3300013105 Bacteria 2627
61 Ga0157369_10204485 3300013105 Bacteria 2071
62 Ga0157369_10531775 3300013105 Bacteria 1216
63 Ga0163162_10253562 3300013306 Bacteria 1891
64 Ga0157372_10028011 3300013307 Bacteria 6144
65 Ga0157375_10724153 3300013308 Bacteria 1147
66 Ga0157376_10041614 3300014969 Bacteria 3763
67 Ga0207692_10026166 3300025898 Bacteria 2735
68 Ga0207692_10052296 3300025898 Bacteria 2075
69 Ga0207685_10000936 3300025905 Bacteria 5581
70 Ga0207699_10022404 3300025906 Bacteria 3422
71 Ga0207699_10259522 3300025906 Bacteria 1200
72 Ga0207699_10516102 3300025906 Bacteria 864
73 Ga0207705_10739705 3300025909 Unclassified 764
74 Ga0207695_10030418 3300025913 Bacteria 5943
75 Ga0207695_10103558 3300025913 Bacteria 2837
76 Ga0207671_10059809 3300025914 Bacteria 2826
77 Ga0207693_10000179 3300025915 Bacteria 57434
78 Ga0207693_10005185 3300025915 Bacteria 10910
79 Ga0207663_10005108 3300025916 Bacteria 6596
80 Ga0207663_10479157 3300025916 Bacteria 964
81 Ga0207663_10807574 3300025916 Bacteria 747
82 Ga0207660_10057171 3300025917 Bacteria 2794
83 Ga0207660_10145545 3300025917 Bacteria 1816
84 Ga0207660_10278786 3300025917 Unclassified 1326
85 Ga0207657_10002452 3300025919 Bacteria 20036
86 Ga0207657_10023156 3300025919 Bacteria 5790
87 Ga0207652_10040533 3300025921 Bacteria 3955
88 Ga0207652_10124235 3300025921 Bacteria 2298
89 Ga0207652_10179043 3300025921 Bacteria 1904
90 Ga0207646_10667782 3300025922 Bacteria 930
91 Ga0207646_10782908 3300025922 Bacteria 850
92 Ga0207694_10500661 3300025924 Unclassified 1017
93 Ga0207687_10507842 3300025927 Bacteria 1007
94 Ga0207700_10029317 3300025928 Bacteria 3881
95 Ga0207700_10154586 3300025928 Bacteria 1899
96 Ga0207664_10017250 3300025929 Bacteria 5288
97 Ga0207664_10057708 3300025929 Bacteria 3086
98 Ga0207664_10111951 3300025929 Bacteria 2272
99 Ga0207664_10951567 3300025929 Bacteria 770
100 Ga0207644_10124419 3300025931 Bacteria 1967
101 Ga0207690_10196211 3300025932 Bacteria 1530
102 Ga0207690_10702958 3300025932 Unclassified 831
103 Ga0207665_10001710 3300025939 Bacteria 14754
104 Ga0207665_10030957 3300025939 Bacteria 3539
105 Ga0207711_11309943 3300025941 Bacteria 666
106 Ga0207661_10237109 3300025944 Bacteria 1617
107 Ga0207661_10335490 3300025944 Bacteria 1362
108 Ga0207667_10196305 3300025949 Bacteria 2070
109 Ga0207703_10511277 3300026035 Bacteria 1128
110 Ga0207702_10135735 3300026078 Bacteria 2219
111 Ga0207702_10851975 3300026078 Bacteria 902
112 Ga0207674_10219384 3300026116 Bacteria 1850
113 Ga0209971_1054239 3300027682 Bacteria 969
114 Ga0207428_10376754 3300027907 Bacteria 1041
115 Ga0307409_100139060 3300031995 Bacteria 2089
116 Ga0307409_100201061 3300031995 Unclassified 1783
117 Ga0307409_100265569 3300031995 Bacteria 1578
118 Ga0307409_100309871 3300031995 Unclassified 1473
119 Ga0307416_100210330 3300032002 Bacteria 1855
120 Ga0307411_10466371 3300032005 Bacteria 1060
121 Ga0373926_0071143 3300035083 Bacteria 1278
122 Ga0373934_0306422 3300035086 Unclassified 659
123 Ga0373936_0324220 3300035113 Bacteria 698
124 Ga0373956_0145576 3300035119 Bacteria 1114
125 Ga0373943_0087122 3300035170 Bacteria 1611
126 Ga0373943_0191525 3300035170 Bacteria 1128
127 Ga0373946_0356705 3300035171 Bacteria 732
128 Ga0373935_0306758 3300035692 Bacteria 1123
129 Ga0373933_0048289 3300035724 Bacteria 2534
130 Ga0373933_0261594 3300035724 Bacteria 1116
131 Ga0373947_0033959 3300035725 Bacteria 3016
132 Ga0373937_0010535 3300036401 Bacteria 8073
133 Ga0373937_0631887 3300036401 Unclassified 1016
134 Ga0373937_1302047 3300036401 Unclassified 675
135 Ga0373925_0005462 3300037068 Bacteria 9468
136 Ga0395899_0226681 3300037312 Bacteria 1292
137 Ga0395898_0567666 3300037466 Bacteria 1077
138 Ga0395901_0138989 3300038443 Bacteria 2553
139 Ga0395901_0183551 3300038443 Bacteria 2194
140 Ga0450896_000230 3300042133 Bacteria 5053
141 Ga0450906_002959 3300042145 Bacteria 3691
142 Ga0450918_028448 3300042531 Bacteria 984
143 Ga0466965_0014097 3300044683 Bacteria 3782
144 Ga0466965_0060642 3300044683 Bacteria 1890
145 Ga0466966_0296578 3300044684 Bacteria 972
146 Ga0466961_0032285 3300044693 Bacteria 3363
147 Ga0466961_0131517 3300044693 Bacteria 1568
148 Ga0466963_0005585 3300044694 Bacteria 7375
149 Ga0466963_0006107 3300044694 Bacteria 7103
150 Ga0466963_0009005 3300044694 Bacteria 5994
151 Ga0466963_0009560 3300044694 Bacteria 5842
152 Ga0466963_0020954 3300044694 Bacteria 4118
153 Ga0466963_0053307 3300044694 Bacteria 2685
154 Ga0466963_0058782 3300044694 Bacteria 2564
155 Ga0466963_0224644 3300044694 Bacteria 1315
156 Ga0466963_0259910 3300044694 Bacteria 1219
157 Ga0466963_0280279 3300044694 Unclassified 1171
158 Ga0466964_0162653 3300044706 Bacteria 1044
159 Ga0466964_0673546 3300044706 Bacteria 574
160 Ga0466971_0001296 3300044719 Bacteria 10446
161 Ga0466971_0002583 3300044719 Bacteria 7654
162 Ga0466971_0011633 3300044719 Bacteria 3853
163 Ga0466968_0002555 3300044735 Bacteria 6689
164 Ga0466968_0012069 3300044735 Bacteria 3375
165 Ga0466968_0014112 3300044735 Bacteria 3153
166 Ga0466968_0124686 3300044735 Bacteria 1168
167 Ga0466970_0067421 3300044765 Bacteria 1922
168 Ga0466970_0405635 3300044765 Bacteria 778
169 Ga0466957_0002015 3300044842 Bacteria 10827
170 Ga0466957_0004041 3300044842 Bacteria 8121
171 Ga0466957_0014491 3300044842 Bacteria 4590
172 Ga0466957_0061125 3300044842 Bacteria 2311
173 Ga0466957_0474531 3300044842 Unclassified 865
174 Ga0466960_0067512 3300044901 Unclassified 1771
175 Ga0466959_0094476 3300045049 Bacteria 2145
176 Ga0466959_0515023 3300045049 Bacteria 808
177 Ga0466958_0004975 3300045836 Bacteria 7090
178 Ga0466958_0008625 3300045836 Bacteria 5658
179 Ga0466958_0010752 3300045836 Bacteria 5134
180 Ga0466958_0056232 3300045836 Bacteria 2389
181 Ga0466967_0011919 3300045976 Bacteria 6621
182 Ga0466967_0014065 3300045976 Bacteria 6216
183 Ga0466967_0060565 3300045976 Bacteria 3354
184 Ga0466967_0063591 3300045976 Bacteria 3279
185 Ga0466967_0091840 3300045976 Bacteria 2759
186 Ga0466967_0137087 3300045976 Bacteria 2276
187 Ga0466967_0152909 3300045976 Bacteria 2158
188 Ga0466967_0166238 3300045976 Bacteria 2073
189 Ga0466967_0220878 3300045976 Unclassified 1800
190 Ga0466967_0911132 3300045976 Bacteria 874
191 Ga0466967_1202106 3300045976 Bacteria 755
192 Ga0495592_0000325 3300046454 Bacteria 39655
193 Ga0495592_0016494 3300046454 Bacteria 5605
194 Ga0495603_0033570 3300046455 Bacteria 3088
195 Ga0495603_0080959 3300046455 Unclassified 1903
196 Ga0495629_0251894 3300046459 Bacteria 1215
197 Ga0495629_0457564 3300046459 Unclassified 864
198 Ga0495641_0126161 3300046461 Bacteria 1142
199 Ga0495651_0000001 3300046462 Bacteria 210544
200 Ga0495653_0000668 3300046463 Bacteria 26201
201 Ga0495653_0035699 3300046463 Bacteria 3921
202 Ga0495582_0538937 3300046473 Bacteria 675
203 Ga0495605_0131170 3300046474 Unclassified 1130
204 Ga0495639_0118854 3300046475 Bacteria 1260
205 Ga0495664_0355055 3300046477 Unclassified 882
206 Ga0495584_0043936 3300046491 Bacteria 2256
207 Ga0495585_0020696 3300046492 Bacteria 3782
208 Ga0495596_0045953 3300046500 Bacteria 1716
209 Ga0495607_0015790 3300046501 Bacteria 4885
210 Ga0495608_0000570 3300046511 Bacteria 25336
211 Ga0495608_0026228 3300046511 Bacteria 3974
212 Ga0495608_0173898 3300046511 Bacteria 1365
213 Ga0495608_0280098 3300046511 Bacteria 1035
214 Ga0495618_0001207 3300046514 Bacteria 17501
215 Ga0495628_0000810 3300046516 Bacteria 28910
216 Ga0495628_0071012 3300046516 Bacteria 2714
217 Ga0495644_0000722 3300046523 Bacteria 13702
218 Ga0495663_0016851 3300046525 Unclassified 2068
219 Ga0495666_0222270 3300046526 Bacteria 865
220 Ga0495652_0000899 3300046529 Bacteria 34104
221 Ga0495652_0139663 3300046529 Bacteria 1906
222 Ga0495652_0495927 3300046529 Unclassified 847
223 Ga0495654_0268254 3300046530 Unclassified 706
224 Ga0495640_0291911 3300046533 Bacteria 1014
225 Ga0495640_0307072 3300046533 Bacteria 984
226 Ga0495640_0418654 3300046533 Unclassified 821
227 Ga0495586_0211502 3300046535 Bacteria 1100
228 Ga0495587_0000036 3300046536 Bacteria 117570
229 Ga0495587_0277483 3300046536 Unclassified 939
230 Ga0495598_0094214 3300046537 Unclassified 981
231 Ga0495645_0000039 3300046543 Bacteria 94569
232 Ga0495645_0048374 3300046543 Unclassified 3097
233 Ga0495645_0441354 3300046543 Bacteria 822
234 Ga0495633_0249379 3300046558 Bacteria 810
235 Ga0495667_0111304 3300046559 Bacteria 1769
236 Ga0495667_0189419 3300046559 Bacteria 1319
237 Ga0495656_0001133 3300046615 Bacteria 8666
238 Ga0495634_0058340 3300046642 Bacteria 2573
239 Ga0495634_0163710 3300046642 Bacteria 1401
240 Ga0495634_0598317 3300046642 Bacteria 640
241 Ga0495611_0004771 3300046648 Bacteria 5825
242 Ga0495635_0139457 3300046663 Bacteria 1652
243 Ga0495635_0162670 3300046663 Bacteria 1519
244 Ga0495659_0101038 3300046664 Unclassified 1117
245 Ga0495588_0277166 3300046674 Bacteria 884
246 Ga0495657_0055729 3300046675 Bacteria 2636
247 Ga0495657_0153937 3300046675 Bacteria 1426
248 Ga0495599_0000063 3300046678 Bacteria 73690
249 Ga0495599_0181585 3300046678 Bacteria 1297
250 Ga0495646_0000178 3300046680 Bacteria 31765
251 Ga0495646_0031734 3300046680 Bacteria 3291
252 Ga0495647_0281886 3300046681 Bacteria 745
253 Ga0495647_0371416 3300046681 Bacteria 654
254 Ga0495658_0127649 3300046683 Bacteria 1545
255 Ga0495658_0254738 3300046683 Unclassified 1104
256 Ga0495670_0273679 3300046691 Unclassified 902
257 Ga0495589_0068819 3300046794 Bacteria 1732
258 Ga0495600_0033881 3300046809 Unclassified 3316
259 Ga0495600_0448865 3300046809 Bacteria 798
260 Ga0495604_0000004 3300047317 Bacteria 456385
261 Ga0495604_0039478 3300047317 Bacteria 3710
262 Ga0495674_0189362 3300047319 Bacteria 1711
263 Ga0495676_0261515 3300047321 Bacteria 1177
264 Ga0495680_0005446 3300047322 Bacteria 11978
265 Ga0495675_0000075 3300047444 Bacteria 69347
266 Ga0495675_0462329 3300047444 Bacteria 733
267 Ga0495684_0525700 3300047471 Unclassified 809
268 Ga0495684_0808326 3300047471 Bacteria 612
269 Ga0495602_0000159 3300048088 Bacteria 62801
270 Ga0495602_0044878 3300048088 Bacteria 4005
271 Ga0495602_0236667 3300048088 Unclassified 1368
272 Ga0496100_0039890 3300048903 Bacteria 2983
273 Ga0496100_0046388 3300048903 Bacteria 2793
274 Ga0496100_0065434 3300048903 Bacteria 2409
275 Ga0496101_0034241 3300048904 Bacteria 3586
276 Ga0496102_0157689 3300048905 Bacteria 2134
277 Ga0496102_1467317 3300048905 Bacteria 601
278 Ga0496104_0090593 3300048907 Unclassified 2922
279 Ga0496104_0184604 3300048907 Bacteria 1996
280 Ga0496104_0255569 3300048907 Bacteria 1665
281 Ga0496104_0605766 3300048907 Bacteria 1005
282 Ga0496104_0605767 3300048907 Bacteria 1005
283 Ga0496105_0000305 3300048908 Bacteria 32361
284 Ga0496105_0480447 3300048908 Bacteria 977
285 Ga0496106_0284561 3300048909 Unclassified 1325
286 Ga0496107_0015629 3300048910 Bacteria 5321
287 Ga0496107_0185726 3300048910 Unclassified 1544
288 Ga0496107_0204158 3300048910 Bacteria 1469
289 Ga0496108_0066740 3300048911 Bacteria 3034
290 Ga0496108_0255536 3300048911 Bacteria 1524
291 Ga0496109_0003122 3300048912 Bacteria 13819
292 Ga0496109_0035984 3300048912 Bacteria 4469
293 Ga0496109_0059350 3300048912 Bacteria 3494
294 Ga0496109_0084954 3300048912 Bacteria 2920
295 Ga0496109_0367123 3300048912 Bacteria 1360
296 Ga0496109_0664023 3300048912 Unclassified 979
297 Ga0496110_0024635 3300048913 Bacteria 5131
298 Ga0496110_0108889 3300048913 Unclassified 2488
299 Ga0496111_0004995 3300048914 Bacteria 8439
300 Ga0496111_0339396 3300048914 Bacteria 1112
301 Ga0496112_0860682 3300048915 Bacteria 829
302 Ga0496113_0003295 3300048916 Bacteria 9646
303 Ga0496113_0189666 3300048916 Unclassified 1632
304 Ga0496113_0519666 3300048916 Bacteria 955
305 Ga0496114_0027427 3300048917 Bacteria 4665
306 Ga0496114_0396977 3300048917 Unclassified 1221
307 Ga0496115_0040754 3300048918 Bacteria 3693
308 Ga0496115_0058425 3300048918 Bacteria 3103
309 Ga0496115_0318058 3300048918 Bacteria 1273
310 Ga0496115_0550159 3300048918 Bacteria 922
311 Ga0501031_0021431 3300049568 Bacteria 4212
312 Ga0501032_0007474 3300049569 Bacteria 7983
313 Ga0501034_0417812 3300049571 Bacteria 1262
314 Ga0501036_0022308 3300049572 Bacteria 5325
315 Ga0501037_0419216 3300049573 Bacteria 916
316 Ga0501038_0021746 3300049574 Bacteria 5755
317 Ga0501039_0113677 3300049575 Bacteria 2117
318 Ga0501039_0810918 3300049575 Bacteria 730
319 Ga0501042_0051079 3300049578 Bacteria 2950
320 Ga0501043_0332265 3300049579 Bacteria 1157
321 Ga0501046_0075279 3300049580 Bacteria 2617
322 Ga0501047_0034980 3300049581 Bacteria 4851
323 Ga0501048_0352802 3300049582 Bacteria 1049
324 Ga0501048_0751660 3300049582 Bacteria 700
325 Ga0501067_0032803 3300049583 Bacteria 2882
326 Ga0501068_0098373 3300049584 Bacteria 1811
327 Ga0501070_0429494 3300049586 Bacteria 1066
328 Ga0501071_0109998 3300049587 Bacteria 2036
329 Ga0501072_0167493 3300049588 Unclassified 1753
330 Ga0501073_0005500 3300049589 Bacteria 9493
331 Ga0501073_0823870 3300049589 Unclassified 639
332 Ga0501074_0096247 3300049590 Bacteria 2120
333 Ga0501074_0307497 3300049590 Unclassified 1126
334 Ga0501075_0027705 3300049591 Bacteria 4177
335 Ga0501075_0231958 3300049591 Unclassified 1407
336 Ga0501075_0515619 3300049591 Bacteria 912
337 Ga0501076_0004060 3300049592 Bacteria 10349
338 Ga0501080_0021092 3300049742 Bacteria 6031
339 Ga0501080_0077654 3300049742 Bacteria 3088
340 Ga0501083_0017574 3300049744 Bacteria 4985
341 Ga0501035_0068933 3300049822 Bacteria 3136
342 Ga0501045_0111371 3300049824 Bacteria 2030
343 Ga0501045_0291116 3300049824 Unclassified 1215
344 nmdc:mga08y16_257776_c1 3300050511 Bacteria 1801
345 nmdc:mga0n895_205330_c1 3300050512 Bacteria 2001
346 nmdc:mga0n895_28271_c1 3300050512 Bacteria 5334
347 nmdc:mga0rr50_19219_c1 3300050513 Bacteria 4606
348 nmdc:mga0rr50_735051_c1 3300050513 Bacteria 842
349 nmdc:mga08x19_21352_c1 3300050514 Bacteria 3996
350 nmdc:mga08x19_823452_c1 3300050514 Bacteria 659
351 nmdc:mga0a205_89638_c2 3300050515 Bacteria 1187
352 Ga0495601_0000183 3300053077 Bacteria 33204
353 Ga0495601_0069479 3300053077 Bacteria 2246
354 Ga0495655_0199987 3300053083 Unclassified 653
355 Ga0495595_0004479 3300053084 Bacteria 5623
356 Ga0495595_0005175 3300053084 Bacteria 5269
357 Ga0495619_0023465 3300053085 Bacteria 3955
358 Ga0495619_0152281 3300053085 Bacteria 1595
359 Ga0501082_0006759 3300060353 Bacteria 9913
360 Ga0466962_0000438 3300061719 Bacteria 18116
361 Ga0466962_0006272 3300061719 Bacteria 5713
362 Ga0466962_0013028 3300061719 Bacteria 3999
363 Ga0466962_0323033 3300061719 Bacteria 766
364 Ga0070699_100043360
365 Ga0070658_10039145
366 Ga0070658_10090003
367 Ga0070680_100049167
368 Ga0070680_100089868
369 Ga0070682_100731979
370 Ga0070660_100009546
371 Ga0070660_100191790
372 Ga0070691_10115838
373 Ga0070661_100193705
374 Ga0070661_100272008
375 Ga0070661_100508288
376 Ga0070671_100358869
377 Ga0070674_101202596
378 Ga0070709_10034416
379 Ga0070709_10123018
380 Ga0070714_100059965
381 Ga0070714_101201444
382 Ga0070713_100035410
383 Ga0070713_100102754
384 Ga0070710_10067626
385 Ga0070711_100130710
386 Ga0070694_100348941
387 Ga0070681_10046665
388 Ga0070707_100188154
389 Ga0070707_100507355
390 Ga0070679_100021888
391 Ga0070679_100046940
392 Ga0070679_100157624
393 Ga0070684_100115793
394 Ga0070684_101038047
395 Ga0070695_100000347
396 Ga0070704_100066548
397 Ga0070664_100291267
398 Ga0068856_100081777
399 Ga0068858_100547872
400 Ga0070717_10452345
401 Ga0070717_10509766
402 Ga0070715_10000160
403 Ga0070716_100002694
404 Ga0070716_100057178
405 Ga0070712_100335940
406 Ga0070712_100339400
407 Ga0097621_100756502
408 Ga0097621_100800956
409 Ga0075433_10578670
410 Ga0075434_100053127
411 Ga0075434_100302106
412 Ga0075436_100055854
413 Ga0075435_100011198
414 Ga0075435_100668714
415 Ga0105251_10150717
416 Ga0105240_10045540
417 Ga0105240_10280287
418 Ga0111539_10849591
419 Ga0105245_10698200
420 Ga0105241_11133186
421 Ga0105238_10147112
422 Ga0157370_11072308
423 Ga0157369_10133714
424 Ga0157369_10204485
425 Ga0157369_10531775
426 Ga0163162_10253562
427 Ga0157372_10028011
428 Ga0157375_10724153
429 Ga0157376_10041614
430 Ga0207692_10026166
431 Ga0207692_10052296
432 Ga0207685_10000936
433 Ga0207699_10022404
434 Ga0207699_10259522
435 Ga0207699_10516102
436 Ga0207705_10739705
437 Ga0207695_10030418
438 Ga0207695_10103558
439 Ga0207671_10059809
440 Ga0207693_10000179
441 Ga0207693_10005185
442 Ga0207663_10005108
443 Ga0207663_10479157
444 Ga0207663_10807574
445 Ga0207660_10057171
446 Ga0207660_10145545
447 Ga0207660_10278786
448 Ga0207657_10002452
449 Ga0207657_10023156
450 Ga0207652_10040533
451 Ga0207652_10124235
452 Ga0207652_10179043
453 Ga0207646_10667782
454 Ga0207646_10782908
455 Ga0207694_10500661
456 Ga0207687_10507842
457 Ga0207700_10029317
458 Ga0207700_10154586
459 Ga0207664_10017250
460 Ga0207664_10057708
461 Ga0207664_10111951
462 Ga0207664_10951567
463 Ga0207644_10124419
464 Ga0207690_10196211
465 Ga0207690_10702958
466 Ga0207665_10001710
467 Ga0207665_10030957
468 Ga0207711_11309943
469 Ga0207661_10237109
470 Ga0207661_10335490
471 Ga0207667_10196305
472 Ga0207703_10511277
473 Ga0207702_10135735
474 Ga0207702_10851975
475 Ga0207674_10219384
476 Ga0209971_1054239
477 Ga0207428_10376754
478 Ga0307409_100139060
479 Ga0307409_100201061
480 Ga0307409_100265569
481 Ga0307409_100309871
482 Ga0307416_100210330
483 Ga0307411_10466371
484 Ga0373926_0071143
485 Ga0373934_0306422
486 Ga0373936_0324220
487 Ga0373956_0145576
488 Ga0373943_0087122
489 Ga0373943_0191525
490 Ga0373946_0356705
491 Ga0373935_0306758
492 Ga0373933_0048289
493 Ga0373933_0261594
494 Ga0373947_0033959
495 Ga0373937_0010535
496 Ga0373937_0631887
497 Ga0373937_1302047
498 Ga0373925_0005462
499 Ga0395899_0226681
500 Ga0395898_0567666
501 Ga0395901_0138989
502 Ga0395901_0183551
503 Ga0450896_000230
504 Ga0450906_002959
505 Ga0450918_028448
506 Ga0466965_0014097
507 Ga0466965_0060642
508 Ga0466966_0296578
509 Ga0466961_0032285
510 Ga0466961_0131517
511 Ga0466963_0005585
512 Ga0466963_0006107
513 Ga0466963_0009005
514 Ga0466963_0009560
515 Ga0466963_0020954
516 Ga0466963_0053307
517 Ga0466963_0058782
518 Ga0466963_0224644
519 Ga0466963_0259910
520 Ga0466963_0280279
521 Ga0466964_0162653
522 Ga0466964_0673546
523 Ga0466971_0001296
524 Ga0466971_0002583
525 Ga0466971_0011633
526 Ga0466968_0002555
527 Ga0466968_0012069
528 Ga0466968_0014112
529 Ga0466968_0124686
530 Ga0466970_0067421
531 Ga0466970_0405635
532 Ga0466957_0002015
533 Ga0466957_0004041
534 Ga0466957_0014491
535 Ga0466957_0061125
536 Ga0466957_0474531
537 Ga0466960_0067512
538 Ga0466959_0094476
539 Ga0466959_0515023
540 Ga0466958_0004975
541 Ga0466958_0008625
542 Ga0466958_0010752
543 Ga0466958_0056232
544 Ga0466967_0011919
545 Ga0466967_0014065
546 Ga0466967_0060565
547 Ga0466967_0063591
548 Ga0466967_0091840
549 Ga0466967_0137087
550 Ga0466967_0152909
551 Ga0466967_0166238
552 Ga0466967_0220878
553 Ga0466967_0911132
554 Ga0466967_1202106
555 Ga0495592_0000325
556 Ga0495592_0016494
557 Ga0495603_0033570
558 Ga0495603_0080959
559 Ga0495629_0251894
560 Ga0495629_0457564
561 Ga0495641_0126161
562 Ga0495651_0000001
563 Ga0495653_0000668
564 Ga0495653_0035699
565 Ga0495582_0538937
566 Ga0495605_0131170
567 Ga0495639_0118854
568 Ga0495664_0355055
569 Ga0495584_0043936
570 Ga0495585_0020696
571 Ga0495596_0045953
572 Ga0495607_0015790
573 Ga0495608_0000570
574 Ga0495608_0026228
575 Ga0495608_0173898
576 Ga0495608_0280098
577 Ga0495618_0001207
578 Ga0495628_0000810
579 Ga0495628_0071012
580 Ga0495644_0000722
581 Ga0495663_0016851
582 Ga0495666_0222270
583 Ga0495652_0000899
584 Ga0495652_0139663
585 Ga0495652_0495927
586 Ga0495654_0268254
587 Ga0495640_0291911
588 Ga0495640_0307072
589 Ga0495640_0418654
590 Ga0495586_0211502
591 Ga0495587_0000036
592 Ga0495587_0277483
593 Ga0495598_0094214
594 Ga0495645_0000039
595 Ga0495645_0048374
596 Ga0495645_0441354
597 Ga0495633_0249379
598 Ga0495667_0111304
599 Ga0495667_0189419
600 Ga0495656_0001133
601 Ga0495634_0058340
602 Ga0495634_0163710
603 Ga0495634_0598317
604 Ga0495611_0004771
605 Ga0495635_0139457
606 Ga0495635_0162670
607 Ga0495659_0101038
608 Ga0495588_0277166
609 Ga0495657_0055729
610 Ga0495657_0153937
611 Ga0495599_0000063
612 Ga0495599_0181585
613 Ga0495646_0000178
614 Ga0495646_0031734
615 Ga0495647_0281886
616 Ga0495647_0371416
617 Ga0495658_0127649
618 Ga0495658_0254738
619 Ga0495670_0273679
620 Ga0495589_0068819
621 Ga0495600_0033881
622 Ga0495600_0448865
623 Ga0495604_0000004
624 Ga0495604_0039478
625 Ga0495674_0189362
626 Ga0495676_0261515
627 Ga0495680_0005446
628 Ga0495675_0000075
629 Ga0495675_0462329
630 Ga0495684_0525700
631 Ga0495684_0808326
632 Ga0495602_0000159
633 Ga0495602_0044878
634 Ga0495602_0236667
635 Ga0496100_0039890
636 Ga0496100_0046388
637 Ga0496100_0065434
638 Ga0496101_0034241
639 Ga0496102_0157689
640 Ga0496102_1467317
641 Ga0496104_0090593
642 Ga0496104_0184604
643 Ga0496104_0255569
644 Ga0496104_0605766
645 Ga0496104_0605767
646 Ga0496105_0000305
647 Ga0496105_0480447
648 Ga0496106_0284561
649 Ga0496107_0015629
650 Ga0496107_0185726
651 Ga0496107_0204158
652 Ga0496108_0066740
653 Ga0496108_0255536
654 Ga0496109_0003122
655 Ga0496109_0035984
656 Ga0496109_0059350
657 Ga0496109_0084954
658 Ga0496109_0367123
659 Ga0496109_0664023
660 Ga0496110_0024635
661 Ga0496110_0108889
662 Ga0496111_0004995
663 Ga0496111_0339396
664 Ga0496112_0860682
665 Ga0496113_0003295
666 Ga0496113_0189666
667 Ga0496113_0519666
668 Ga0496114_0027427
669 Ga0496114_0396977
670 Ga0496115_0040754
671 Ga0496115_0058425
672 Ga0496115_0318058
673 Ga0496115_0550159
674 Ga0501031_0021431
675 Ga0501032_0007474
676 Ga0501034_0417812
677 Ga0501036_0022308
678 Ga0501037_0419216
679 Ga0501038_0021746
680 Ga0501039_0113677
681 Ga0501039_0810918
682 Ga0501042_0051079
683 Ga0501043_0332265
684 Ga0501046_0075279
685 Ga0501047_0034980
686 Ga0501048_0352802
687 Ga0501048_0751660
688 Ga0501067_0032803
689 Ga0501068_0098373
690 Ga0501070_0429494
691 Ga0501071_0109998
692 Ga0501072_0167493
693 Ga0501073_0005500
694 Ga0501073_0823870
695 Ga0501074_0096247
696 Ga0501074_0307497
697 Ga0501075_0027705
698 Ga0501075_0231958
699 Ga0501075_0515619
700 Ga0501076_0004060
701 Ga0501080_0021092
702 Ga0501080_0077654
703 Ga0501083_0017574
704 Ga0501035_0068933
705 Ga0501045_0111371
706 Ga0501045_0291116
707 nmdc:mga08y16_257776_c1
708 nmdc:mga0n895_205330_c1
709 nmdc:mga0n895_28271_c1
710 nmdc:mga0rr50_19219_c1
711 nmdc:mga0rr50_735051_c1
712 nmdc:mga08x19_21352_c1
713 nmdc:mga08x19_823452_c1
714 nmdc:mga0a205_89638_c2
715 Ga0495601_0000183
716 Ga0495601_0069479
717 Ga0495655_0199987
718 Ga0495595_0004479
719 Ga0495595_0005175
720 Ga0495619_0023465
721 Ga0495619_0152281
722 Ga0501082_0006759
723 Ga0466962_0000438
724 Ga0466962_0006272
725 Ga0466962_0013028
726 Ga0466962_0323033

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08808

RES

RES domain

2

169

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d0h-assembly2.cif.gz_C part: prs adp-ribosylating toxin bound to cognate antitoxin pars 0.735 2 168
6d0i-assembly2.cif.gz_C part: prs adp-ribosylating toxin bound to cognate antitoxin pars. l48m part, semet-substituted complex. 0.7292 1 170
6d0i-assembly2.cif.gz_C part: prs adp-ribosylating toxin bound to cognate antitoxin pars. l48m part, semet-substituted complex. 0.7055 1 170
6d0h-assembly2.cif.gz_C part: prs adp-ribosylating toxin bound to cognate antitoxin pars 0.699 2 168
6gw6-assembly1.cif.gz_D structure of the pseudomonas putida res-xre toxin-antitoxin complex 0.6626 1 168
ID Description Score Start End Superfamily
af_Q57805_1_214_3.90.228.10 Alpha Beta;Alpha-Beta Complex;Phosphoenolpyruvate Carboxykinase; domain 3; 0.5933 1 178 3.90.228.10
af_Q57805_1_214_3.90.228.10 Alpha Beta;Alpha-Beta Complex;Phosphoenolpyruvate Carboxykinase; domain 3; 0.5748 1 178 3.90.228.10
2bv6A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.5095 121 155 1.10.10.10
af_K7MIN2_168_375_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.4576 122 166 3.40.640.10
af_C0H4D1_9_107_3.30.70.3250 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribonuclease P, Pop5 subunit 0.4363 133 165 3.30.70.3250
ID Description Score Start End GO Terms
AF-A0A2V8FYK0-F1-model_v4 RES domain-containing protein 0.9858 1 159
AF-A0A2V8HET4-F1-model_v4 RES domain-containing protein 0.9837 1 184
AF-A0A2V8FYK0-F1-model_v4 RES domain-containing protein 0.9797 1 159
AF-A0A2V8HET4-F1-model_v4 RES domain-containing protein 0.9784 1 184
AF-A0A2A3LCK3-F1-model_v4 RES domain-containing protein 0.9686 2 181

Map