F422853

General Info

Members Datasets Scaffolds Average Seq Length
363 226 726 138

Family's Representative Sequence

Representative Sequence 3300003911|JGI25405J52794_10091030|JGI25405J52794_100910301
Length 154
Sequence MASQNSIVEKRGDMQMNTYLSFKGECEAAFKFYEQCLGAQPGAIFRYAGSPMADDVPADWSDKVMHGNLTIGGQALMGADVRPDQYEEPKGFSLSLQIKSAADAERIFHELAKDGRVVMPLEKTFWAARFGMVVDRFGIPWLINCEESDQPPEG

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
145 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
160 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
163 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 2.75
Rhizosphere 96.14
Stem 0
Stem Tuber 0
Unclassified 19.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10091030 3300003911 Unclassified 675
2 JGI25406J46586_10207437 3300003203 Bacteria 572
3 Ga0065704_10275557 3300005289 Bacteria 933
4 Ga0065707_10009716 3300005295 Bacteria 1994
5 Ga0065707_10226512 3300005295 Bacteria 1204
6 Ga0065707_10381270 3300005295 Unclassified 877
7 Ga0070676_10047358 3300005328 Bacteria 2511
8 Ga0070676_10205075 3300005328 Bacteria 1294
9 Ga0070676_10511521 3300005328 Unclassified 854
10 Ga0070683_100375505 3300005329 Bacteria 1355
11 Ga0070683_101440142 3300005329 Unclassified 662
12 Ga0070690_100287552 3300005330 Bacteria 1175
13 Ga0070670_100039194 3300005331 Bacteria 4074
14 Ga0070677_10020990 3300005333 Bacteria 2389
15 Ga0068869_100806719 3300005334 Bacteria 807
16 Ga0068869_101863738 3300005334 Unclassified 538
17 Ga0070666_10154002 3300005335 Bacteria 1604
18 Ga0070680_100096190 3300005336 Bacteria 2455
19 Ga0070682_100203471 3300005337 Bacteria 1398
20 Ga0068868_100174873 3300005338 Bacteria 1779
21 Ga0068868_100401721 3300005338 Bacteria 1183
22 Ga0070689_100395250 3300005340 Bacteria 1167
23 Ga0070689_100573519 3300005340 Bacteria 974
24 Ga0070687_100575044 3300005343 Unclassified 770
25 Ga0070692_10231083 3300005345 Bacteria 1098
26 Ga0070668_100068673 3300005347 Bacteria 2755
27 Ga0070668_100077618 3300005347 Bacteria 2596
28 Ga0070668_100088192 3300005347 Bacteria 2442
29 Ga0070668_101784426 3300005347 Bacteria 566
30 Ga0070675_100018677 3300005354 Bacteria 5519
31 Ga0070675_100024886 3300005354 Bacteria 4797
32 Ga0070671_100231672 3300005355 Bacteria 1567
33 Ga0070671_100472220 3300005355 Unclassified 1077
34 Ga0070674_100021702 3300005356 Bacteria 4129
35 Ga0070674_100225147 3300005356 Bacteria 1461
36 Ga0070673_100029422 3300005364 Bacteria 4096
37 Ga0070673_100103295 3300005364 Bacteria 2351
38 Ga0070673_101657664 3300005364 Unclassified 605
39 Ga0070688_100392749 3300005365 Bacteria 1025
40 Ga0070688_100857064 3300005365 Bacteria 714
41 Ga0070659_100343288 3300005366 Bacteria 1251
42 Ga0070667_100160024 3300005367 Bacteria 1983
43 Ga0070713_100350143 3300005436 Bacteria 1370
44 Ga0070710_10904260 3300005437 Unclassified 637
45 Ga0070701_10049833 3300005438 Unclassified 2166
46 Ga0070701_10172615 3300005438 Unclassified 1260
47 Ga0070701_11105505 3300005438 Bacteria 558
48 Ga0070711_101215643 3300005439 Bacteria 652
49 Ga0070705_100797706 3300005440 Bacteria 751
50 Ga0070700_100059802 3300005441 Bacteria 2400
51 Ga0070694_100114134 3300005444 Bacteria 1928
52 Ga0070694_100135118 3300005444 Bacteria 1786
53 Ga0070708_100504591 3300005445 Bacteria 1141
54 Ga0070663_100091121 3300005455 Bacteria 2259
55 Ga0070678_100090405 3300005456 Bacteria 2346
56 Ga0070678_101385491 3300005456 Unclassified 656
57 Ga0070681_10009609 3300005458 Bacteria 9509
58 Ga0070681_10183719 3300005458 Bacteria 2012
59 Ga0070681_11581728 3300005458 Bacteria 581
60 Ga0068867_100148840 3300005459 Bacteria 1837
61 Ga0070706_101300812 3300005467 Bacteria 667
62 Ga0070707_101113313 3300005468 Unclassified 756
63 Ga0070707_101739175 3300005468 Unclassified 591
64 Ga0070698_100071035 3300005471 Bacteria 3492
65 Ga0070698_100885718 3300005471 Unclassified 838
66 Ga0070699_100065166 3300005518 Bacteria 3161
67 Ga0070699_100310985 3300005518 Unclassified 1414
68 Ga0070679_100482690 3300005530 Bacteria 1184
69 Ga0070684_100138330 3300005535 Unclassified 2201
70 Ga0070697_100171446 3300005536 Bacteria 1837
71 Ga0070697_100801038 3300005536 Bacteria 834
72 Ga0070672_100107677 3300005543 Bacteria 2268
73 Ga0070686_100017505 3300005544 Bacteria 4189
74 Ga0070686_100196267 3300005544 Bacteria 1444
75 Ga0070695_100956132 3300005545 Bacteria 695
76 Ga0070665_101472470 3300005548 Unclassified 689
77 Ga0070704_100094384 3300005549 Bacteria 2238
78 Ga0070704_100194063 3300005549 Bacteria 1634
79 Ga0070704_100491625 3300005549 Bacteria 1063
80 Ga0068855_100112420 3300005563 Bacteria 3125
81 Ga0070664_100014510 3300005564 Bacteria 6426
82 Ga0070664_100368488 3300005564 Bacteria 1309
83 Ga0068856_100172419 3300005614 Bacteria 2176
84 Ga0070702_101633842 3300005615 Unclassified 534
85 Ga0068859_100826505 3300005617 Bacteria 1013
86 Ga0068859_101224293 3300005617 Unclassified 827
87 Ga0068870_11196612 3300005840 Bacteria 550
88 Ga0068863_100518389 3300005841 Bacteria 1175
89 Ga0068863_100907507 3300005841 Bacteria 881
90 Ga0068858_100126273 3300005842 Bacteria 2396
91 Ga0068860_100070110 3300005843 Bacteria 3332
92 Ga0068860_100495301 3300005843 Unclassified 1219
93 Ga0068860_100519446 3300005843 Bacteria 1191
94 Ga0068862_100059167 3300005844 Bacteria 3290
95 Ga0081455_10006562 3300005937 Bacteria 12450
96 Ga0081455_10018871 3300005937 Bacteria 6544
97 Ga0081538_10068862 3300005981 Bacteria 1965
98 Ga0081539_10434483 3300005985 Bacteria 544
99 Ga0075365_10195143 3300006038 Bacteria 1417
100 Ga0097621_100279367 3300006237 Bacteria 1470
101 Ga0097621_100604901 3300006237 Bacteria 1002
102 Ga0068871_100087121 3300006358 Bacteria 2596
103 Ga0068871_100319445 3300006358 Bacteria 1367
104 Ga0075428_100093903 3300006844 Unclassified 3271
105 Ga0075428_101017577 3300006844 Unclassified 877
106 Ga0075430_100157425 3300006846 Unclassified 1891
107 Ga0075430_100344274 3300006846 Unclassified 1231
108 Ga0075431_100052319 3300006847 Bacteria 4211
109 Ga0075431_100192006 3300006847 Bacteria 2092
110 Ga0075431_100519244 3300006847 Bacteria 1181
111 Ga0075433_10094539 3300006852 Bacteria 2645
112 Ga0075433_10117901 3300006852 Bacteria 2356
113 Ga0075433_10123225 3300006852 Bacteria 2303
114 Ga0075433_10165232 3300006852 Bacteria 1970
115 Ga0075433_10404176 3300006852 Bacteria 1205
116 Ga0075433_10534215 3300006852 Bacteria 1031
117 Ga0075434_100020031 3300006871 Bacteria 6479
118 Ga0075434_100124323 3300006871 Bacteria 2596
119 Ga0075434_100129199 3300006871 Unclassified 2545
120 Ga0075434_100216590 3300006871 Bacteria 1935
121 Ga0075434_100357738 3300006871 Bacteria 1481
122 Ga0075429_100159693 3300006880 Bacteria 1974
123 Ga0075429_100675229 3300006880 Unclassified 905
124 Ga0068865_100024580 3300006881 Bacteria 3954
125 Ga0068865_101631957 3300006881 Unclassified 580
126 Ga0097620_100826638 3300006931 Bacteria 1013
127 Ga0097620_101224203 3300006931 Unclassified 827
128 Ga0097620_101326828 3300006931 Bacteria 793
129 Ga0075435_100122367 3300007076 Bacteria 2172
130 Ga0075435_100148045 3300007076 Bacteria 1973
131 Ga0075435_100346698 3300007076 Bacteria 1273
132 Ga0075435_101669585 3300007076 Unclassified 559
133 Ga0111539_10008786 3300009094 Bacteria 12812
134 Ga0111539_10010878 3300009094 Bacteria 11452
135 Ga0111539_10021894 3300009094 Bacteria 7859
136 Ga0111539_10184845 3300009094 Bacteria 2434
137 Ga0111539_10351661 3300009094 Unclassified 1715
138 Ga0111539_11049332 3300009094 Bacteria 947
139 Ga0111539_11245713 3300009094 Bacteria 864
140 Ga0105245_10015761 3300009098 Bacteria 6592
141 Ga0114129_10007609 3300009147 Bacteria 15416
142 Ga0114129_10074257 3300009147 Bacteria 4736
143 Ga0114129_10302326 3300009147 Bacteria 2132
144 Ga0114129_10627672 3300009147 Bacteria 1389
145 Ga0114129_10900253 3300009147 Bacteria 1121
146 Ga0114129_11737695 3300009147 Unclassified 760
147 Ga0114129_12786175 3300009147 Unclassified 581
148 Ga0105243_10547566 3300009148 Bacteria 1105
149 Ga0105242_10005753 3300009176 Bacteria 9558
150 Ga0105242_10793191 3300009176 Unclassified 937
151 Ga0105248_10184405 3300009177 Bacteria 2352
152 Ga0105248_10463432 3300009177 Bacteria 1428
153 Ga0105248_11849423 3300009177 Unclassified 685
154 Ga0105238_10841835 3300009551 Bacteria 934
155 Ga0105249_10135164 3300009553 Bacteria 2359
156 Ga0105249_10222051 3300009553 Bacteria 1860
157 Ga0105249_10302791 3300009553 Bacteria 1604
158 Ga0105249_10747469 3300009553 Bacteria 1040
159 Ga0105249_11376378 3300009553 Bacteria 777
160 Ga0105249_11858903 3300009553 Unclassified 675
161 Ga0105239_10107127 3300010375 Bacteria 3096
162 Ga0157373_10013409 3300013100 Bacteria 6012
163 Ga0157370_10312169 3300013104 Bacteria 1451
164 Ga0157374_10009883 3300013296 Bacteria 8188
165 Ga0157374_10515253 3300013296 Unclassified 1201
166 Ga0157378_10314290 3300013297 Bacteria 1520
167 Ga0163162_10009371 3300013306 Bacteria 9523
168 Ga0157375_10056185 3300013308 Bacteria 3885
169 Ga0157375_11369383 3300013308 Unclassified 833
170 Ga0163163_10000013 3300014325 Bacteria 242522
171 Ga0157380_10043543 3300014326 Bacteria 3515
172 Ga0157380_10876266 3300014326 Bacteria 922
173 Ga0157380_12018195 3300014326 Bacteria 639
174 Ga0157377_10017473 3300014745 Bacteria 3710
175 Ga0157377_11204003 3300014745 Bacteria 587
176 Ga0157379_11209746 3300014968 Unclassified 727
177 Ga0157379_11311337 3300014968 Unclassified 699
178 Ga0182006_1118572 3300015261 Bacteria 922
179 Ga0213875_10095904 3300021388 Bacteria 1383
180 Ga0207697_10016539 3300025315 Bacteria 3038
181 Ga0207642_10515275 3300025899 Bacteria 734
182 Ga0207680_10164053 3300025903 Bacteria 1492
183 Ga0207680_10327206 3300025903 Viruses 1073
184 Ga0207645_10011667 3300025907 Bacteria 5991
185 Ga0207645_10295072 3300025907 Bacteria 1078
186 Ga0207643_10995951 3300025908 Bacteria 542
187 Ga0207705_10017451 3300025909 Bacteria 5139
188 Ga0207654_10432711 3300025911 Bacteria 920
189 Ga0207707_10790594 3300025912 Bacteria 791
190 Ga0207663_10614164 3300025916 Unclassified 855
191 Ga0207663_11114679 3300025916 Unclassified 634
192 Ga0207662_10114394 3300025918 Bacteria 1686
193 Ga0207657_10009804 3300025919 Bacteria 9599
194 Ga0207649_10095019 3300025920 Bacteria 1960
195 Ga0207652_10572202 3300025921 Bacteria 1014
196 Ga0207646_10049482 3300025922 Bacteria 3764
197 Ga0207646_10938581 3300025922 Unclassified 766
198 Ga0207646_11159451 3300025922 Unclassified 679
199 Ga0207681_10052296 3300025923 Bacteria 2770
200 Ga0207681_10161978 3300025923 Bacteria 1687
201 Ga0207650_10028869 3300025925 Bacteria 3982
202 Ga0207659_10039046 3300025926 Bacteria 3307
203 Ga0207659_10393728 3300025926 Bacteria 1157
204 Ga0207659_10892191 3300025926 Bacteria 764
205 Ga0207687_10008396 3300025927 Bacteria 6757
206 Ga0207644_10082224 3300025931 Bacteria 2382
207 Ga0207644_10284854 3300025931 Bacteria 1327
208 Ga0207690_10104624 3300025932 Bacteria 2028
209 Ga0207709_11138555 3300025935 Unclassified 642
210 Ga0207670_10422567 3300025936 Bacteria 1070
211 Ga0207669_10207843 3300025937 Bacteria 1426
212 Ga0207669_11877264 3300025937 Bacteria 512
213 Ga0207704_10079839 3300025938 Bacteria 2110
214 Ga0207704_10970722 3300025938 Unclassified 717
215 Ga0207691_10054370 3300025940 Bacteria 3652
216 Ga0207711_10040834 3300025941 Bacteria 3948
217 Ga0207711_10662762 3300025941 Bacteria 973
218 Ga0207689_10048334 3300025942 Bacteria 3509
219 Ga0207689_10346150 3300025942 Bacteria 1235
220 Ga0207661_10989328 3300025944 Bacteria 775
221 Ga0207679_10183012 3300025945 Bacteria 1735
222 Ga0207651_10033193 3300025960 Bacteria 3326
223 Ga0207712_10371797 3300025961 Unclassified 1194
224 Ga0207668_10277849 3300025972 Bacteria 1372
225 Ga0207668_10591093 3300025972 Bacteria 966
226 Ga0207668_10904271 3300025972 Bacteria 786
227 Ga0207658_10173777 3300025986 Bacteria 1777
228 Ga0207658_10688766 3300025986 Unclassified 923
229 Ga0207677_10128478 3300026023 Bacteria 1919
230 Ga0207703_10200686 3300026035 Bacteria 1772
231 Ga0207678_10041493 3300026067 Bacteria 3990
232 Ga0207708_10098764 3300026075 Bacteria 2257
233 Ga0207702_10079372 3300026078 Bacteria 2844
234 Ga0207641_10392935 3300026088 Bacteria 1330
235 Ga0207648_10163749 3300026089 Bacteria 1965
236 Ga0207675_100227751 3300026118 Bacteria 1797
237 Ga0207683_10004231 3300026121 Bacteria 12393
238 Ga0207428_10004265 3300027907 Bacteria 13689
239 Ga0207428_10023889 3300027907 Bacteria 5134
240 Ga0268266_10074113 3300028379 Bacteria 2955
241 Ga0268265_10134635 3300028380 Bacteria 2059
242 Ga0268265_10644955 3300028380 Unclassified 1017
243 Ga0268264_10066165 3300028381 Bacteria 3047
244 Ga0268264_10205735 3300028381 Bacteria 1803
245 Ga0307411_10634642 3300032005 Bacteria 923
246 Ga0373934_0007844 3300035086 Bacteria 3968
247 Ga0373945_0048454 3300035116 Bacteria 1556
248 Ga0373953_0113046 3300035117 Bacteria 1149
249 Ga0373956_0025816 3300035119 Bacteria 2541
250 Ga0373943_0024388 3300035170 Bacteria 2819
251 Ga0373955_0027044 3300035172 Bacteria 2961
252 Ga0373935_0788204 3300035692 Bacteria 701
253 Ga0373927_0218637 3300035695 Bacteria 1251
254 Ga0373933_0034556 3300035724 Bacteria 2946
255 Ga0373947_0193306 3300035725 Bacteria 1328
256 Ga0373937_0002576 3300036401 Bacteria 15085
257 Ga0373937_1151873 3300036401 Bacteria 724
258 Ga0373925_0106221 3300037068 Bacteria 2164
259 Ga0395900_0260630 3300037418 Bacteria 1732
260 Ga0395900_0337776 3300037418 Unclassified 1483
261 Ga0436364_0294406 3300037853 Bacteria 4598
262 Ga0436365_0451381 3300039437 Bacteria 1972
263 Ga0451807_0169601 3300041486 Bacteria 813
264 Ga0450923_019641 3300042125 Bacteria 1303
265 Ga0439435_0146577 3300042436 Unclassified 755
266 Ga0451576_0082196 3300045051 Bacteria 3350
267 Ga0495617_179660 3300046452 Bacteria 666
268 Ga0495627_176143 3300046453 Bacteria 593
269 Ga0495603_0048107 3300046455 Bacteria 2539
270 Ga0495629_0870032 3300046459 Bacteria 592
271 Ga0495641_0015545 3300046461 Bacteria 4056
272 Ga0495653_0737604 3300046463 Bacteria 596
273 Ga0495584_0105187 3300046491 Bacteria 1427
274 Ga0495585_0027885 3300046492 Bacteria 3223
275 Ga0495594_0109323 3300046499 Bacteria 1558
276 Ga0495594_0178292 3300046499 Bacteria 1209
277 Ga0495607_0067977 3300046501 Bacteria 2000
278 Ga0495628_0539841 3300046516 Bacteria 838
279 Ga0495630_1512735 3300046517 Unclassified 503
280 Ga0495637_0032565 3300046520 Bacteria 2295
281 Ga0495643_0502721 3300046522 Bacteria 521
282 Ga0495644_0053519 3300046523 Bacteria 1516
283 Ga0495665_0165095 3300046531 Bacteria 1154
284 Ga0495587_0004730 3300046536 Bacteria 8931
285 Ga0495645_0011711 3300046543 Bacteria 6176
286 Ga0495633_0022782 3300046558 Bacteria 3111
287 Ga0495633_0533050 3300046558 Unclassified 529
288 Ga0495667_0075737 3300046559 Bacteria 2189
289 Ga0495656_0061278 3300046615 Bacteria 1643
290 Ga0495656_0083191 3300046615 Bacteria 1449
291 Ga0495668_0323518 3300046616 Bacteria 846
292 Ga0495659_0290282 3300046664 Unclassified 689
293 Ga0495588_0239068 3300046674 Bacteria 958
294 Ga0495657_0237954 3300046675 Bacteria 1099
295 Ga0495599_0065964 3300046678 Bacteria 2261
296 Ga0495623_0005387 3300046679 Bacteria 8375
297 Ga0495647_0036908 3300046681 Bacteria 1841
298 Ga0495669_0161483 3300046684 Bacteria 1064
299 Ga0495669_0554745 3300046684 Unclassified 559
300 Ga0495624_0084889 3300046690 Bacteria 1956
301 Ga0495624_0104147 3300046690 Bacteria 1746
302 Ga0495670_0016152 3300046691 Bacteria 3670
303 Ga0495670_0311933 3300046691 Bacteria 844
304 Ga0495600_0020291 3300046809 Bacteria 4251
305 Ga0495660_0158994 3300046810 Bacteria 1110
306 Ga0495676_0136741 3300047321 Bacteria 1761
307 Ga0495675_0016862 3300047444 Bacteria 4621
308 Ga0495677_0296001 3300047445 Bacteria 636
309 Ga0495684_0485698 3300047471 Unclassified 852
310 Ga0495615_0304533 3300048090 Unclassified 517
311 Ga0496100_0730063 3300048903 Bacteria 774
312 Ga0496104_1060358 3300048907 Bacteria 714
313 Ga0496108_0118107 3300048911 Bacteria 2273
314 Ga0496108_0195523 3300048911 Unclassified 1754
315 Ga0496108_0628087 3300048911 Bacteria 935
316 Ga0496109_2009583 3300048912 Unclassified 510
317 Ga0496112_0614267 3300048915 Bacteria 1018
318 Ga0496114_0166365 3300048917 Bacteria 1920
319 Ga0496114_1163838 3300048917 Unclassified 657
320 Ga0501031_0658734 3300049568 Unclassified 673
321 Ga0501036_0011953 3300049572 Bacteria 7198
322 Ga0501048_0053085 3300049582 Bacteria 2884
323 Ga0501071_0121348 3300049587 Bacteria 1937
324 Ga0501075_0016488 3300049591 Bacteria 5323
325 Ga0501076_0068781 3300049592 Bacteria 2829
326 Ga0501076_0891643 3300049592 Bacteria 733
327 Ga0501079_0328147 3300049741 Bacteria 1198
328 Ga0501045_0037641 3300049824 Bacteria 3517
329 nmdc:mga05p37_1673475_c1 3300050507 Unclassified 622
330 nmdc:mga05p37_1708354_c1 3300050507 Unclassified 613
331 nmdc:mga05p37_31400_c1 3300050507 Bacteria 6487
332 nmdc:mga05p37_449475_c1 3300050507 Bacteria 1492
333 nmdc:mga05p37_712377_c1 3300050507 Unclassified 1113
334 nmdc:mga09592_172013_c1 3300050508 Unclassified 1873
335 nmdc:mga0qj67_169546_c1 3300050509 Unclassified 1772
336 nmdc:mga06r32_163419_c1 3300050510 Unclassified 2209
337 nmdc:mga06r32_399893_c1 3300050510 Bacteria 1356
338 nmdc:mga06r32_40674_c1 3300050510 Bacteria 4415
339 nmdc:mga08y16_1162951_c1 3300050511 Bacteria 744
340 nmdc:mga08y16_137688_c1 3300050511 Bacteria 2538
341 nmdc:mga08y16_1471_c1 3300050511 Bacteria 23637
342 nmdc:mga08y16_1860976_c1 3300050511 Unclassified 554
343 nmdc:mga0n895_142110_c1 3300050512 Bacteria 2429
344 nmdc:mga0n895_1524502_c1 3300050512 Unclassified 634
345 nmdc:mga0n895_160207_c1 3300050512 Bacteria 2282
346 nmdc:mga0n895_17833_c1 3300050512 Bacteria 6554
347 nmdc:mga0n895_1802571_c1 3300050512 Unclassified 573
348 nmdc:mga0n895_197658_c1 3300050512 Bacteria 2042
349 nmdc:mga0rr50_363610_c1 3300050513 Bacteria 1218
350 nmdc:mga0rr50_558957_c1 3300050513 Bacteria 974
351 nmdc:mga0a205_10909_c1 3300050515 Bacteria 8359
352 nmdc:mga0a205_304658_c1 3300050515 Bacteria 1466
353 nmdc:mga0a205_338533_c1 3300050515 Bacteria 1373
354 nmdc:mga0a205_48264_c1 3300050515 Bacteria 4109
355 nmdc:mga0a205_824224_c1 3300050515 Bacteria 775
356 Ga0495655_0004018 3300053083 Bacteria 2482
357 Ga0495655_0041696 3300053083 Bacteria 1175
358 Ga0495619_0061423 3300053085 Bacteria 2501
359 Ga0495619_0177534 3300053085 Bacteria 1473
360 Ga0495619_0995516 3300053085 Bacteria 561
361 Ga0501084_0216175 3300054114 Bacteria 1617
362 Ga0501082_0154888 3300060353 Bacteria 1991
363 Ga0530510_0453088 3300061734 Bacteria 970
364 JGI25405J52794_10091030
365 JGI25406J46586_10207437
366 Ga0065704_10275557
367 Ga0065707_10009716
368 Ga0065707_10226512
369 Ga0065707_10381270
370 Ga0070676_10047358
371 Ga0070676_10205075
372 Ga0070676_10511521
373 Ga0070683_100375505
374 Ga0070683_101440142
375 Ga0070690_100287552
376 Ga0070670_100039194
377 Ga0070677_10020990
378 Ga0068869_100806719
379 Ga0068869_101863738
380 Ga0070666_10154002
381 Ga0070680_100096190
382 Ga0070682_100203471
383 Ga0068868_100174873
384 Ga0068868_100401721
385 Ga0070689_100395250
386 Ga0070689_100573519
387 Ga0070687_100575044
388 Ga0070692_10231083
389 Ga0070668_100068673
390 Ga0070668_100077618
391 Ga0070668_100088192
392 Ga0070668_101784426
393 Ga0070675_100018677
394 Ga0070675_100024886
395 Ga0070671_100231672
396 Ga0070671_100472220
397 Ga0070674_100021702
398 Ga0070674_100225147
399 Ga0070673_100029422
400 Ga0070673_100103295
401 Ga0070673_101657664
402 Ga0070688_100392749
403 Ga0070688_100857064
404 Ga0070659_100343288
405 Ga0070667_100160024
406 Ga0070713_100350143
407 Ga0070710_10904260
408 Ga0070701_10049833
409 Ga0070701_10172615
410 Ga0070701_11105505
411 Ga0070711_101215643
412 Ga0070705_100797706
413 Ga0070700_100059802
414 Ga0070694_100114134
415 Ga0070694_100135118
416 Ga0070708_100504591
417 Ga0070663_100091121
418 Ga0070678_100090405
419 Ga0070678_101385491
420 Ga0070681_10009609
421 Ga0070681_10183719
422 Ga0070681_11581728
423 Ga0068867_100148840
424 Ga0070706_101300812
425 Ga0070707_101113313
426 Ga0070707_101739175
427 Ga0070698_100071035
428 Ga0070698_100885718
429 Ga0070699_100065166
430 Ga0070699_100310985
431 Ga0070679_100482690
432 Ga0070684_100138330
433 Ga0070697_100171446
434 Ga0070697_100801038
435 Ga0070672_100107677
436 Ga0070686_100017505
437 Ga0070686_100196267
438 Ga0070695_100956132
439 Ga0070665_101472470
440 Ga0070704_100094384
441 Ga0070704_100194063
442 Ga0070704_100491625
443 Ga0068855_100112420
444 Ga0070664_100014510
445 Ga0070664_100368488
446 Ga0068856_100172419
447 Ga0070702_101633842
448 Ga0068859_100826505
449 Ga0068859_101224293
450 Ga0068870_11196612
451 Ga0068863_100518389
452 Ga0068863_100907507
453 Ga0068858_100126273
454 Ga0068860_100070110
455 Ga0068860_100495301
456 Ga0068860_100519446
457 Ga0068862_100059167
458 Ga0081455_10006562
459 Ga0081455_10018871
460 Ga0081538_10068862
461 Ga0081539_10434483
462 Ga0075365_10195143
463 Ga0097621_100279367
464 Ga0097621_100604901
465 Ga0068871_100087121
466 Ga0068871_100319445
467 Ga0075428_100093903
468 Ga0075428_101017577
469 Ga0075430_100157425
470 Ga0075430_100344274
471 Ga0075431_100052319
472 Ga0075431_100192006
473 Ga0075431_100519244
474 Ga0075433_10094539
475 Ga0075433_10117901
476 Ga0075433_10123225
477 Ga0075433_10165232
478 Ga0075433_10404176
479 Ga0075433_10534215
480 Ga0075434_100020031
481 Ga0075434_100124323
482 Ga0075434_100129199
483 Ga0075434_100216590
484 Ga0075434_100357738
485 Ga0075429_100159693
486 Ga0075429_100675229
487 Ga0068865_100024580
488 Ga0068865_101631957
489 Ga0097620_100826638
490 Ga0097620_101224203
491 Ga0097620_101326828
492 Ga0075435_100122367
493 Ga0075435_100148045
494 Ga0075435_100346698
495 Ga0075435_101669585
496 Ga0111539_10008786
497 Ga0111539_10010878
498 Ga0111539_10021894
499 Ga0111539_10184845
500 Ga0111539_10351661
501 Ga0111539_11049332
502 Ga0111539_11245713
503 Ga0105245_10015761
504 Ga0114129_10007609
505 Ga0114129_10074257
506 Ga0114129_10302326
507 Ga0114129_10627672
508 Ga0114129_10900253
509 Ga0114129_11737695
510 Ga0114129_12786175
511 Ga0105243_10547566
512 Ga0105242_10005753
513 Ga0105242_10793191
514 Ga0105248_10184405
515 Ga0105248_10463432
516 Ga0105248_11849423
517 Ga0105238_10841835
518 Ga0105249_10135164
519 Ga0105249_10222051
520 Ga0105249_10302791
521 Ga0105249_10747469
522 Ga0105249_11376378
523 Ga0105249_11858903
524 Ga0105239_10107127
525 Ga0157373_10013409
526 Ga0157370_10312169
527 Ga0157374_10009883
528 Ga0157374_10515253
529 Ga0157378_10314290
530 Ga0163162_10009371
531 Ga0157375_10056185
532 Ga0157375_11369383
533 Ga0163163_10000013
534 Ga0157380_10043543
535 Ga0157380_10876266
536 Ga0157380_12018195
537 Ga0157377_10017473
538 Ga0157377_11204003
539 Ga0157379_11209746
540 Ga0157379_11311337
541 Ga0182006_1118572
542 Ga0213875_10095904
543 Ga0207697_10016539
544 Ga0207642_10515275
545 Ga0207680_10164053
546 Ga0207680_10327206
547 Ga0207645_10011667
548 Ga0207645_10295072
549 Ga0207643_10995951
550 Ga0207705_10017451
551 Ga0207654_10432711
552 Ga0207707_10790594
553 Ga0207663_10614164
554 Ga0207663_11114679
555 Ga0207662_10114394
556 Ga0207657_10009804
557 Ga0207649_10095019
558 Ga0207652_10572202
559 Ga0207646_10049482
560 Ga0207646_10938581
561 Ga0207646_11159451
562 Ga0207681_10052296
563 Ga0207681_10161978
564 Ga0207650_10028869
565 Ga0207659_10039046
566 Ga0207659_10393728
567 Ga0207659_10892191
568 Ga0207687_10008396
569 Ga0207644_10082224
570 Ga0207644_10284854
571 Ga0207690_10104624
572 Ga0207709_11138555
573 Ga0207670_10422567
574 Ga0207669_10207843
575 Ga0207669_11877264
576 Ga0207704_10079839
577 Ga0207704_10970722
578 Ga0207691_10054370
579 Ga0207711_10040834
580 Ga0207711_10662762
581 Ga0207689_10048334
582 Ga0207689_10346150
583 Ga0207661_10989328
584 Ga0207679_10183012
585 Ga0207651_10033193
586 Ga0207712_10371797
587 Ga0207668_10277849
588 Ga0207668_10591093
589 Ga0207668_10904271
590 Ga0207658_10173777
591 Ga0207658_10688766
592 Ga0207677_10128478
593 Ga0207703_10200686
594 Ga0207678_10041493
595 Ga0207708_10098764
596 Ga0207702_10079372
597 Ga0207641_10392935
598 Ga0207648_10163749
599 Ga0207675_100227751
600 Ga0207683_10004231
601 Ga0207428_10004265
602 Ga0207428_10023889
603 Ga0268266_10074113
604 Ga0268265_10134635
605 Ga0268265_10644955
606 Ga0268264_10066165
607 Ga0268264_10205735
608 Ga0307411_10634642
609 Ga0373934_0007844
610 Ga0373945_0048454
611 Ga0373953_0113046
612 Ga0373956_0025816
613 Ga0373943_0024388
614 Ga0373955_0027044
615 Ga0373935_0788204
616 Ga0373927_0218637
617 Ga0373933_0034556
618 Ga0373947_0193306
619 Ga0373937_0002576
620 Ga0373937_1151873
621 Ga0373925_0106221
622 Ga0395900_0260630
623 Ga0395900_0337776
624 Ga0436364_0294406
625 Ga0436365_0451381
626 Ga0451807_0169601
627 Ga0450923_019641
628 Ga0439435_0146577
629 Ga0451576_0082196
630 Ga0495617_179660
631 Ga0495627_176143
632 Ga0495603_0048107
633 Ga0495629_0870032
634 Ga0495641_0015545
635 Ga0495653_0737604
636 Ga0495584_0105187
637 Ga0495585_0027885
638 Ga0495594_0109323
639 Ga0495594_0178292
640 Ga0495607_0067977
641 Ga0495628_0539841
642 Ga0495630_1512735
643 Ga0495637_0032565
644 Ga0495643_0502721
645 Ga0495644_0053519
646 Ga0495665_0165095
647 Ga0495587_0004730
648 Ga0495645_0011711
649 Ga0495633_0022782
650 Ga0495633_0533050
651 Ga0495667_0075737
652 Ga0495656_0061278
653 Ga0495656_0083191
654 Ga0495668_0323518
655 Ga0495659_0290282
656 Ga0495588_0239068
657 Ga0495657_0237954
658 Ga0495599_0065964
659 Ga0495623_0005387
660 Ga0495647_0036908
661 Ga0495669_0161483
662 Ga0495669_0554745
663 Ga0495624_0084889
664 Ga0495624_0104147
665 Ga0495670_0016152
666 Ga0495670_0311933
667 Ga0495600_0020291
668 Ga0495660_0158994
669 Ga0495676_0136741
670 Ga0495675_0016862
671 Ga0495677_0296001
672 Ga0495684_0485698
673 Ga0495615_0304533
674 Ga0496100_0730063
675 Ga0496104_1060358
676 Ga0496108_0118107
677 Ga0496108_0195523
678 Ga0496108_0628087
679 Ga0496109_2009583
680 Ga0496112_0614267
681 Ga0496114_0166365
682 Ga0496114_1163838
683 Ga0501031_0658734
684 Ga0501036_0011953
685 Ga0501048_0053085
686 Ga0501071_0121348
687 Ga0501075_0016488
688 Ga0501076_0068781
689 Ga0501076_0891643
690 Ga0501079_0328147
691 Ga0501045_0037641
692 nmdc:mga05p37_1673475_c1
693 nmdc:mga05p37_1708354_c1
694 nmdc:mga05p37_31400_c1
695 nmdc:mga05p37_449475_c1
696 nmdc:mga05p37_712377_c1
697 nmdc:mga09592_172013_c1
698 nmdc:mga0qj67_169546_c1
699 nmdc:mga06r32_163419_c1
700 nmdc:mga06r32_399893_c1
701 nmdc:mga06r32_40674_c1
702 nmdc:mga08y16_1162951_c1
703 nmdc:mga08y16_137688_c1
704 nmdc:mga08y16_1471_c1
705 nmdc:mga08y16_1860976_c1
706 nmdc:mga0n895_142110_c1
707 nmdc:mga0n895_1524502_c1
708 nmdc:mga0n895_160207_c1
709 nmdc:mga0n895_17833_c1
710 nmdc:mga0n895_1802571_c1
711 nmdc:mga0n895_197658_c1
712 nmdc:mga0rr50_363610_c1
713 nmdc:mga0rr50_558957_c1
714 nmdc:mga0a205_10909_c1
715 nmdc:mga0a205_304658_c1
716 nmdc:mga0a205_338533_c1
717 nmdc:mga0a205_48264_c1
718 nmdc:mga0a205_824224_c1
719 Ga0495655_0004018
720 Ga0495655_0041696
721 Ga0495619_0061423
722 Ga0495619_0177534
723 Ga0495619_0995516
724 Ga0501084_0216175
725 Ga0501082_0154888
726 Ga0530510_0453088

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

15

143

0.95

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

14

144

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.9207 1 135
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.9076 1 135
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8854 1 132
1u7i-assembly1.cif.gz_B crystal structure of protein of unknown function pa1358 from pseudomonas aeruginosa 0.8744 1 133
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8725 1 132
ID Description Score Start End Superfamily
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9518 80 132 3.30.720.110
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9517 79 132 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9155 8 135 3.10.180.10
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9014 8 135 3.10.180.10
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8594 8 138 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7V8NR92-F1-model_v4 VOC family protein 0.9813 1 135
AF-A6GSA3-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9803 2 133 GO:0051213
AF-A0A2V8FAR3-F1-model_v4 VOC family protein 0.9716 1 137
AF-A0A257NPL2-F1-model_v4 Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein 0.9681 1 133
AF-A0A651DV12-F1-model_v4 VOC family protein 0.968 1 133

Map