F422795

General Info

Members Datasets Scaffolds Average Seq Length
362 207 724 215

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_51080_c1|nmdc:mga0n895_51080_c1_282_1031
Length 249
Sequence MPPGSRTTDFRDAIARVPSARWLESDRKGGTLTTAIIGVGNIGSAVARHLVDGGEAVVLAAKDESHAQALAAELGSLARASSIEDAIDGAETVVLALWLDTIRELVAEHAHVLVNKVVVDPSNPLGFDETGGMIRTLPEGQSSGSIVAALLPASAHYVKAFGTLSAEALASSSKREPRVALFYATDDDIAGTTAERLIRTAGFEPVRAGGVAAAVRIEMPGGDLHQYGLNGELLDVDQARMAIAEEVRA

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
151 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
152 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
153 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 11.33
Rhizosphere 87.57
Stem 0
Stem Tuber 0
Unclassified 14.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_51080_c1 3300050512 Bacteria 4055
2 JGI25406J46586_10007211 3300003203 Bacteria 5086
3 JGI25406J46586_10010499 3300003203 Bacteria 4107
4 JGI25407J50210_10006527 3300003373 Bacteria 2908
5 Ga0070658_10049707 3300005327 Bacteria 3397
6 Ga0070683_100008585 3300005329 Bacteria 8685
7 Ga0070690_100159978 3300005330 Bacteria 1542
8 Ga0068869_100043428 3300005334 Bacteria 3228
9 Ga0070682_100377960 3300005337 Bacteria 1064
10 Ga0068868_100121378 3300005338 Bacteria 2132
11 Ga0070689_100342809 3300005340 Bacteria 1251
12 Ga0070691_10237488 3300005341 Bacteria 972
13 Ga0070691_10256529 3300005341 Unclassified 940
14 Ga0070661_100083079 3300005344 Bacteria 2365
15 Ga0070668_100170070 3300005347 Bacteria 1774
16 Ga0070675_100342433 3300005354 Bacteria 1324
17 Ga0070674_100042041 3300005356 Bacteria 3102
18 Ga0070673_100024875 3300005364 Bacteria 4397
19 Ga0070659_100246650 3300005366 Unclassified 1479
20 Ga0070667_100312908 3300005367 Bacteria 1416
21 Ga0070703_10023850 3300005406 Bacteria 1804
22 Ga0070709_10031689 3300005434 Bacteria 3182
23 Ga0070709_10265662 3300005434 Unclassified 1241
24 Ga0070714_100031686 3300005435 Bacteria 4413
25 Ga0070714_100041108 3300005435 Bacteria 3900
26 Ga0070714_100156561 3300005435 Bacteria 2057
27 Ga0070713_100399302 3300005436 Bacteria 1284
28 Ga0070713_100431802 3300005436 Bacteria 1234
29 Ga0070713_100561409 3300005436 Bacteria 1082
30 Ga0070713_100773536 3300005436 Bacteria 919
31 Ga0070710_10007267 3300005437 Bacteria 5357
32 Ga0070710_10057535 3300005437 Bacteria 2204
33 Ga0070710_10091425 3300005437 Bacteria 1796
34 Ga0070701_10236299 3300005438 Bacteria 1097
35 Ga0070711_100033062 3300005439 Bacteria 3443
36 Ga0070711_100067986 3300005439 Bacteria 2502
37 Ga0070711_100093803 3300005439 Bacteria 2168
38 Ga0070711_100139923 3300005439 Unclassified 1813
39 Ga0070705_100788814 3300005440 Unclassified 755
40 Ga0070663_100014985 3300005455 Bacteria 4987
41 Ga0070678_100068092 3300005456 Bacteria 2652
42 Ga0070678_100570171 3300005456 Unclassified 1007
43 Ga0070662_100177903 3300005457 Bacteria 1675
44 Ga0070706_100320223 3300005467 Bacteria 1446
45 Ga0070706_100345712 3300005467 Bacteria 1387
46 Ga0070706_100812065 3300005467 Unclassified 866
47 Ga0070707_100061520 3300005468 Unclassified 3601
48 Ga0070707_100139260 3300005468 Bacteria 2361
49 Ga0070707_100219177 3300005468 Bacteria 1854
50 Ga0070707_100541269 3300005468 Unclassified 1126
51 Ga0070698_100087582 3300005471 Bacteria 3100
52 Ga0070698_100125193 3300005471 Bacteria 2527
53 Ga0070698_100697046 3300005471 Unclassified 957
54 Ga0070698_100835775 3300005471 Unclassified 865
55 Ga0070698_100893968 3300005471 Bacteria 834
56 Ga0070699_100006071 3300005518 Bacteria 10562
57 Ga0070684_100006631 3300005535 Bacteria 8967
58 Ga0070697_100002595 3300005536 Bacteria 13900
59 Ga0070697_100188428 3300005536 Bacteria 1750
60 Ga0070697_100316573 3300005536 Unclassified 1343
61 Ga0068853_100253847 3300005539 Bacteria 1615
62 Ga0070672_100863308 3300005543 Bacteria 798
63 Ga0070686_100041911 3300005544 Bacteria 2864
64 Ga0070695_100059413 3300005545 Bacteria 2475
65 Ga0070695_100068688 3300005545 Bacteria 2314
66 Ga0070696_100539924 3300005546 Bacteria 933
67 Ga0070693_100017542 3300005547 Bacteria 3723
68 Ga0070704_100055235 3300005549 Bacteria 2814
69 Ga0068855_100056910 3300005563 Bacteria 4585
70 Ga0070664_100045503 3300005564 Bacteria 3706
71 Ga0068857_100035304 3300005577 Bacteria 4428
72 Ga0068854_100034724 3300005578 Bacteria 3524
73 Ga0068856_100003642 3300005614 Bacteria 15479
74 Ga0070702_100124362 3300005615 Bacteria 1619
75 Ga0070702_100313998 3300005615 Unclassified 1089
76 Ga0068852_100097894 3300005616 Bacteria 2640
77 Ga0068852_100270516 3300005616 Unclassified 1635
78 Ga0068864_100130292 3300005618 Bacteria 2258
79 Ga0068864_100498175 3300005618 Bacteria 1171
80 Ga0068861_100030794 3300005719 Bacteria 3935
81 Ga0068870_10046540 3300005840 Bacteria 2275
82 Ga0068870_10475669 3300005840 Bacteria 828
83 Ga0068858_100013537 3300005842 Bacteria 7697
84 Ga0068860_100026706 3300005843 Bacteria 5565
85 Ga0081455_10083118 3300005937 Bacteria 2617
86 Ga0081538_10000327 3300005981 Bacteria 54457
87 Ga0081538_10006682 3300005981 Bacteria 10103
88 Ga0081538_10009190 3300005981 Bacteria 8285
89 Ga0081538_10011876 3300005981 Bacteria 7031
90 Ga0081538_10017968 3300005981 Bacteria 5338
91 Ga0081538_10039819 3300005981 Bacteria 3008
92 Ga0081538_10076674 3300005981 Bacteria 1805
93 Ga0081538_10122029 3300005981 Unclassified 1249
94 Ga0081539_10000181 3300005985 Bacteria 148250
95 Ga0081539_10001909 3300005985 Bacteria 32287
96 Ga0081539_10097742 3300005985 Bacteria 1503
97 Ga0070717_10061829 3300006028 Bacteria 3104
98 Ga0070717_10166682 3300006028 Bacteria 1914
99 Ga0075432_10032352 3300006058 Bacteria 1812
100 Ga0075432_10037294 3300006058 Bacteria 1692
101 Ga0075432_10215249 3300006058 Unclassified 766
102 Ga0070715_10000821 3300006163 Bacteria 8497
103 Ga0070715_10095330 3300006163 Bacteria 1378
104 Ga0070715_10159674 3300006163 Bacteria 1113
105 Ga0070716_100206529 3300006173 Bacteria 1309
106 Ga0070716_100321057 3300006173 Unclassified 1085
107 Ga0070716_100410437 3300006173 Unclassified 976
108 Ga0070712_100014642 3300006175 Bacteria 5035
109 Ga0070712_100036565 3300006175 Bacteria 3342
110 Ga0070712_100057717 3300006175 Bacteria 2728
111 Ga0070712_100659585 3300006175 Bacteria 889
112 Ga0070712_100669500 3300006175 Bacteria 883
113 Ga0097621_100105063 3300006237 Bacteria 2380
114 Ga0097621_100522584 3300006237 Bacteria 1077
115 Ga0068871_100030521 3300006358 Bacteria 4245
116 Ga0068871_100040632 3300006358 Bacteria 3726
117 Ga0075428_100253361 3300006844 Bacteria 1896
118 Ga0075430_100523248 3300006846 Unclassified 979
119 Ga0075431_100270617 3300006847 Bacteria 1721
120 Ga0075431_100711141 3300006847 Bacteria 982
121 Ga0075433_10387188 3300006852 Bacteria 1234
122 Ga0075433_10567436 3300006852 Bacteria 997
123 Ga0075434_100072395 3300006871 Bacteria 3438
124 Ga0075434_100538072 3300006871 Bacteria 1188
125 Ga0068865_100395187 3300006881 Bacteria 1131
126 Ga0075436_100288910 3300006914 Bacteria 1174
127 Ga0075435_100022610 3300007076 Bacteria 4851
128 Ga0075435_100142927 3300007076 Bacteria 2008
129 Ga0075435_100344056 3300007076 Bacteria 1278
130 Ga0075435_100547898 3300007076 Unclassified 1001
131 Ga0075435_100874171 3300007076 Unclassified 784
132 Ga0099794_10020454 3300007265 Bacteria 2996
133 Ga0099795_10028120 3300007788 Unclassified 1908
134 Ga0099795_10117476 3300007788 Unclassified 1060
135 Ga0105251_10020832 3300009011 Bacteria 3437
136 Ga0105244_10146686 3300009036 Bacteria 1132
137 Ga0111539_10034199 3300009094 Bacteria 6166
138 Ga0111539_10086921 3300009094 Bacteria 3674
139 Ga0111539_10132801 3300009094 Bacteria 2915
140 Ga0111539_10259965 3300009094 Bacteria 2021
141 Ga0105247_10232591 3300009101 Bacteria 1252
142 Ga0114129_10048181 3300009147 Bacteria 5988
143 Ga0114129_10386612 3300009147 Unclassified 1847
144 Ga0114129_10908583 3300009147 Bacteria 1115
145 Ga0105243_10026687 3300009148 Bacteria 4423
146 Ga0105243_10576790 3300009148 Bacteria 1079
147 Ga0105242_10122973 3300009176 Bacteria 2230
148 Ga0105242_10179376 3300009176 Bacteria 1867
149 Ga0105248_10108303 3300009177 Bacteria 3133
150 Ga0105248_10457590 3300009177 Bacteria 1438
151 Ga0105249_10030603 3300009553 Bacteria 4867
152 Ga0105246_10332499 3300011119 Unclassified 1239
153 Ga0157373_10028471 3300013100 Bacteria 4031
154 Ga0157369_10248944 3300013105 Unclassified 1855
155 Ga0157374_10134416 3300013296 Bacteria 2396
156 Ga0157378_10462416 3300013297 Unclassified 1261
157 Ga0163162_10042625 3300013306 Bacteria 4543
158 Ga0163162_10544558 3300013306 Bacteria 1289
159 Ga0157375_10087439 3300013308 Bacteria 3169
160 Ga0157375_10111435 3300013308 Bacteria 2835
161 Ga0157375_10242491 3300013308 Bacteria 1962
162 Ga0163163_10212534 3300014325 Bacteria 1983
163 Ga0157377_10058829 3300014745 Bacteria 2189
164 Ga0157379_10657554 3300014968 Bacteria 981
165 Ga0157376_10004696 3300014969 Bacteria 9521
166 Ga0157376_10221710 3300014969 Bacteria 1752
167 Ga0157376_10711308 3300014969 Bacteria 1010
168 Ga0206356_10948663 3300020070 Unclassified 1069
169 Ga0206354_11094621 3300020081 Bacteria 1578
170 Ga0224712_10199794 3300022467 Bacteria 908
171 Ga0209759_1009652 3300025256 Bacteria 2900
172 Ga0207713_1139991 3300025735 Unclassified 791
173 Ga0207653_10008802 3300025885 Bacteria 3147
174 Ga0207692_10001460 3300025898 Bacteria 8848
175 Ga0207692_10070281 3300025898 Bacteria 1842
176 Ga0207692_10214166 3300025898 Bacteria 1139
177 Ga0207692_10421783 3300025898 Unclassified 835
178 Ga0207642_10105138 3300025899 Bacteria 1426
179 Ga0207688_10027730 3300025901 Bacteria 3115
180 Ga0207680_10224746 3300025903 Unclassified 1288
181 Ga0207647_10045599 3300025904 Bacteria 2735
182 Ga0207647_10099790 3300025904 Bacteria 1724
183 Ga0207647_10406587 3300025904 Bacteria 766
184 Ga0207685_10169018 3300025905 Bacteria 1005
185 Ga0207699_10001199 3300025906 Bacteria 12291
186 Ga0207699_10074523 3300025906 Bacteria 2085
187 Ga0207643_10238517 3300025908 Bacteria 1117
188 Ga0207705_10523387 3300025909 Bacteria 921
189 Ga0207684_10000391 3300025910 Bacteria 58641
190 Ga0207684_10081964 3300025910 Bacteria 2746
191 Ga0207684_10942901 3300025910 Unclassified 724
192 Ga0207695_10247132 3300025913 Bacteria 1684
193 Ga0207693_10003744 3300025915 Bacteria 12961
194 Ga0207693_10032035 3300025915 Bacteria 4151
195 Ga0207693_10043506 3300025915 Bacteria 3533
196 Ga0207693_10046692 3300025915 Bacteria 3402
197 Ga0207693_10047736 3300025915 Bacteria 3363
198 Ga0207693_10047888 3300025915 Bacteria 3358
199 Ga0207693_10228609 3300025915 Bacteria 1461
200 Ga0207663_10013314 3300025916 Bacteria 4467
201 Ga0207663_10026371 3300025916 Unclassified 3372
202 Ga0207663_10037540 3300025916 Bacteria 2921
203 Ga0207663_10052925 3300025916 Unclassified 2534
204 Ga0207660_10075257 3300025917 Bacteria 2466
205 Ga0207662_10015627 3300025918 Bacteria 4273
206 Ga0207657_10109489 3300025919 Bacteria 2283
207 Ga0207646_10019137 3300025922 Bacteria 6367
208 Ga0207646_10134260 3300025922 Bacteria 2228
209 Ga0207646_10395637 3300025922 Bacteria 1248
210 Ga0207694_10152647 3300025924 Bacteria 1861
211 Ga0207659_10163979 3300025926 Bacteria 1747
212 Ga0207700_10089589 3300025928 Bacteria 2425
213 Ga0207700_10300433 3300025928 Unclassified 1386
214 Ga0207700_10563993 3300025928 Bacteria 1011
215 Ga0207664_10006224 3300025929 Bacteria 8196
216 Ga0207664_10019179 3300025929 Bacteria 5050
217 Ga0207664_10110917 3300025929 Bacteria 2282
218 Ga0207664_10160471 3300025929 Unclassified 1917
219 Ga0207664_10192453 3300025929 Unclassified 1756
220 Ga0207644_10122027 3300025931 Bacteria 1985
221 Ga0207644_10351792 3300025931 Bacteria 1196
222 Ga0207644_10514697 3300025931 Unclassified 988
223 Ga0207690_10075047 3300025932 Bacteria 2344
224 Ga0207706_10551213 3300025933 Unclassified 992
225 Ga0207709_10433709 3300025935 Bacteria 1012
226 Ga0207670_10206258 3300025936 Bacteria 1496
227 Ga0207704_10100308 3300025938 Bacteria 1928
228 Ga0207665_10002881 3300025939 Bacteria 11539
229 Ga0207665_10020330 3300025939 Bacteria 4361
230 Ga0207665_10217308 3300025939 Bacteria 1399
231 Ga0207691_10044933 3300025940 Bacteria 4064
232 Ga0207711_10319080 3300025941 Bacteria 1435
233 Ga0207689_10015334 3300025942 Bacteria 6486
234 Ga0207651_10765410 3300025960 Bacteria 854
235 Ga0207712_10111469 3300025961 Bacteria 2053
236 Ga0207712_10191617 3300025961 Unclassified 1614
237 Ga0207640_10027893 3300025981 Bacteria 3445
238 Ga0207658_10149353 3300025986 Bacteria 1902
239 Ga0207677_10042739 3300026023 Bacteria 3007
240 Ga0207677_10462445 3300026023 Unclassified 1089
241 Ga0207703_10054094 3300026035 Bacteria 3264
242 Ga0207678_10117602 3300026067 Bacteria 2268
243 Ga0207702_10091658 3300026078 Bacteria 2661
244 Ga0207702_10246389 3300026078 Bacteria 1676
245 Ga0207641_10393991 3300026088 Bacteria 1328
246 Ga0207641_10624076 3300026088 Bacteria 1057
247 Ga0207674_10012279 3300026116 Bacteria 9579
248 Ga0207674_10331433 3300026116 Bacteria 1472
249 Ga0207675_100011736 3300026118 Bacteria 8192
250 Ga0207675_100031498 3300026118 Bacteria 4940
251 Ga0207683_10020174 3300026121 Bacteria 5698
252 Ga0207683_10484360 3300026121 Bacteria 1142
253 Ga0207698_10782349 3300026142 Unclassified 955
254 Ga0209588_1000068 3300027671 Bacteria 35839
255 Ga0207428_10051699 3300027907 Bacteria 3284
256 Ga0207428_10062836 3300027907 Bacteria 2935
257 Ga0207428_10078336 3300027907 Bacteria 2586
258 Ga0207428_10282100 3300027907 Bacteria 1233
259 Ga0307514_10015326 3300031649 Bacteria 6329
260 Ga0307516_10014469 3300031730 Bacteria 8344
261 Ga0307415_100047887 3300032126 Bacteria 2880
262 Ga0373930_0073970 3300034816 Bacteria 779
263 Ga0373948_0031562 3300034817 Bacteria 1071
264 Ga0373958_0061510 3300034819 Bacteria 814
265 Ga0373959_0028604 3300034820 Bacteria 1113
266 Ga0373926_0041087 3300035083 Bacteria 1652
267 Ga0373951_0033171 3300035091 Bacteria 1223
268 Ga0373932_0053452 3300035112 Bacteria 1205
269 Ga0373941_0131704 3300035115 Unclassified 901
270 Ga0373946_0100892 3300035171 Bacteria 1294
271 Ga0373942_0055494 3300035207 Bacteria 1122
272 Ga0373931_0025987 3300035691 Bacteria 2975
273 Ga0373931_0121971 3300035691 Unclassified 1491
274 Ga0373947_0043551 3300035725 Bacteria 2682
275 Ga0373925_0000141 3300037068 Bacteria 77138
276 Ga0395899_0107162 3300037312 Unclassified 2011
277 Ga0395900_0007091 3300037418 Bacteria 11613
278 Ga0395900_0129548 3300037418 Bacteria 2586
279 Ga0395898_0002695 3300037466 Bacteria 20534
280 Ga0395898_0112895 3300037466 Bacteria 2604
281 Ga0395898_0264909 3300037466 Bacteria 1639
282 Ga0395905_0002929 3300037471 Bacteria 18582
283 Ga0395905_0119930 3300037471 Bacteria 2472
284 Ga0395905_0141941 3300037471 Bacteria 2259
285 Ga0395901_0003239 3300038443 Bacteria 16375
286 Ga0395901_0037804 3300038443 Bacteria 4992
287 Ga0395901_0083779 3300038443 Bacteria 3333
288 Ga0436360_0045547 3300039438 Bacteria 612
289 Ga0495662_0030171 3300046476 Bacteria 2617
290 Ga0495664_0169231 3300046477 Bacteria 1326
291 Ga0495607_0101447 3300046501 Bacteria 1541
292 Ga0495618_0015905 3300046514 Bacteria 4593
293 Ga0495663_0054204 3300046525 Bacteria 1248
294 Ga0495652_0118836 3300046529 Bacteria 2112
295 Ga0495621_0082940 3300046539 Bacteria 1198
296 Ga0495656_0117689 3300046615 Bacteria 1250
297 Ga0495634_0056921 3300046642 Bacteria 2611
298 Ga0495635_0170480 3300046663 Bacteria 1480
299 Ga0495657_0011188 3300046675 Bacteria 6721
300 Ga0495646_0126785 3300046680 Bacteria 1440
301 Ga0495613_0023151 3300046689 Bacteria 4629
302 Ga0495624_0205640 3300046690 Bacteria 1195
303 Ga0495670_0058505 3300046691 Unclassified 1935
304 Ga0495674_0346570 3300047319 Bacteria 1206
305 Ga0496100_0005056 3300048903 Bacteria 7058
306 Ga0496100_0091675 3300048903 Bacteria 2074
307 Ga0496100_0465968 3300048903 Bacteria 970
308 Ga0496101_0034933 3300048904 Bacteria 3553
309 Ga0496102_0003842 3300048905 Bacteria 12715
310 Ga0496102_0033558 3300048905 Bacteria 4612
311 Ga0496102_0040305 3300048905 Bacteria 4224
312 Ga0496102_0144455 3300048905 Bacteria 2232
313 Ga0496102_0751714 3300048905 Bacteria 898
314 Ga0496104_0001149 3300048907 Bacteria 22665
315 Ga0496104_0009790 3300048907 Bacteria 8545
316 Ga0496104_0075052 3300048907 Bacteria 3219
317 Ga0496105_0003771 3300048908 Bacteria 11294
318 Ga0496105_0015692 3300048908 Bacteria 6043
319 Ga0496106_0007141 3300048909 Bacteria 8249
320 Ga0496106_0094903 3300048909 Bacteria 2307
321 Ga0496106_0417343 3300048909 Bacteria 1078
322 Ga0496107_0044828 3300048910 Bacteria 3180
323 Ga0496107_0060224 3300048910 Bacteria 2748
324 Ga0496108_0028682 3300048911 Bacteria 4605
325 Ga0496108_0044473 3300048911 Bacteria 3706
326 Ga0496108_0126019 3300048911 Unclassified 2199
327 Ga0496108_0401787 3300048911 Bacteria 1196
328 Ga0496109_0007930 3300048912 Bacteria 9000
329 Ga0496109_0553173 3300048912 Bacteria 1085
330 Ga0496110_0002904 3300048913 Bacteria 12975
331 Ga0496110_0350281 3300048913 Bacteria 1345
332 Ga0496110_0365041 3300048913 Bacteria 1315
333 Ga0496111_0098382 3300048914 Bacteria 2148
334 Ga0496112_0010845 3300048915 Bacteria 8292
335 Ga0496112_0182483 3300048915 Bacteria 2062
336 Ga0496113_0013791 3300048916 Bacteria 5491
337 Ga0496113_0067380 3300048916 Bacteria 2714
338 Ga0496114_0039111 3300048917 Bacteria 3925
339 Ga0496114_0090151 3300048917 Bacteria 2603
340 Ga0496114_0144700 3300048917 Bacteria 2060
341 Ga0496114_0358219 3300048917 Bacteria 1290
342 Ga0496115_0029451 3300048918 Bacteria 4312
343 Ga0496115_0034405 3300048918 Bacteria 4004
344 Ga0496115_0159245 3300048918 Bacteria 1865
345 Ga0496115_0355931 3300048918 Bacteria 1193
346 nmdc:mga0yw44_188010_c1 3300050492 Bacteria 1361
347 nmdc:mga05p37_566152_c1 3300050507 Bacteria 1290
348 nmdc:mga0qj67_193696_c1 3300050509 Bacteria 1651
349 nmdc:mga08y16_149076_c1 3300050511 Bacteria 2432
350 nmdc:mga08y16_399530_c1 3300050511 Unclassified 1407
351 nmdc:mga08y16_57498_c1 3300050511 Bacteria 4064
352 nmdc:mga0n895_213755_c1 3300050512 Unclassified 1958
353 nmdc:mga0n895_270665_c1 3300050512 Bacteria 1723
354 nmdc:mga0n895_99766_c1 3300050512 Bacteria 2912
355 nmdc:mga0rr50_173541_c1 3300050513 Unclassified 1758
356 nmdc:mga0rr50_352897_c1 3300050513 Bacteria 1237
357 nmdc:mga0rr50_675465_c1 3300050513 Unclassified 881
358 nmdc:mga08x19_168297_c1 3300050514 Bacteria 1491
359 nmdc:mga08x19_23109_c1 3300050514 Bacteria 3856
360 nmdc:mga08x19_239846_c1 3300050514 Bacteria 1249
361 nmdc:mga0a205_139510_c1 3300050515 Bacteria 2324
362 Ga0495601_0001111 3300053077 Bacteria 14751
363 nmdc:mga0n895_51080_c1
364 JGI25406J46586_10007211
365 JGI25406J46586_10010499
366 JGI25407J50210_10006527
367 Ga0070658_10049707
368 Ga0070683_100008585
369 Ga0070690_100159978
370 Ga0068869_100043428
371 Ga0070682_100377960
372 Ga0068868_100121378
373 Ga0070689_100342809
374 Ga0070691_10237488
375 Ga0070691_10256529
376 Ga0070661_100083079
377 Ga0070668_100170070
378 Ga0070675_100342433
379 Ga0070674_100042041
380 Ga0070673_100024875
381 Ga0070659_100246650
382 Ga0070667_100312908
383 Ga0070703_10023850
384 Ga0070709_10031689
385 Ga0070709_10265662
386 Ga0070714_100031686
387 Ga0070714_100041108
388 Ga0070714_100156561
389 Ga0070713_100399302
390 Ga0070713_100431802
391 Ga0070713_100561409
392 Ga0070713_100773536
393 Ga0070710_10007267
394 Ga0070710_10057535
395 Ga0070710_10091425
396 Ga0070701_10236299
397 Ga0070711_100033062
398 Ga0070711_100067986
399 Ga0070711_100093803
400 Ga0070711_100139923
401 Ga0070705_100788814
402 Ga0070663_100014985
403 Ga0070678_100068092
404 Ga0070678_100570171
405 Ga0070662_100177903
406 Ga0070706_100320223
407 Ga0070706_100345712
408 Ga0070706_100812065
409 Ga0070707_100061520
410 Ga0070707_100139260
411 Ga0070707_100219177
412 Ga0070707_100541269
413 Ga0070698_100087582
414 Ga0070698_100125193
415 Ga0070698_100697046
416 Ga0070698_100835775
417 Ga0070698_100893968
418 Ga0070699_100006071
419 Ga0070684_100006631
420 Ga0070697_100002595
421 Ga0070697_100188428
422 Ga0070697_100316573
423 Ga0068853_100253847
424 Ga0070672_100863308
425 Ga0070686_100041911
426 Ga0070695_100059413
427 Ga0070695_100068688
428 Ga0070696_100539924
429 Ga0070693_100017542
430 Ga0070704_100055235
431 Ga0068855_100056910
432 Ga0070664_100045503
433 Ga0068857_100035304
434 Ga0068854_100034724
435 Ga0068856_100003642
436 Ga0070702_100124362
437 Ga0070702_100313998
438 Ga0068852_100097894
439 Ga0068852_100270516
440 Ga0068864_100130292
441 Ga0068864_100498175
442 Ga0068861_100030794
443 Ga0068870_10046540
444 Ga0068870_10475669
445 Ga0068858_100013537
446 Ga0068860_100026706
447 Ga0081455_10083118
448 Ga0081538_10000327
449 Ga0081538_10006682
450 Ga0081538_10009190
451 Ga0081538_10011876
452 Ga0081538_10017968
453 Ga0081538_10039819
454 Ga0081538_10076674
455 Ga0081538_10122029
456 Ga0081539_10000181
457 Ga0081539_10001909
458 Ga0081539_10097742
459 Ga0070717_10061829
460 Ga0070717_10166682
461 Ga0075432_10032352
462 Ga0075432_10037294
463 Ga0075432_10215249
464 Ga0070715_10000821
465 Ga0070715_10095330
466 Ga0070715_10159674
467 Ga0070716_100206529
468 Ga0070716_100321057
469 Ga0070716_100410437
470 Ga0070712_100014642
471 Ga0070712_100036565
472 Ga0070712_100057717
473 Ga0070712_100659585
474 Ga0070712_100669500
475 Ga0097621_100105063
476 Ga0097621_100522584
477 Ga0068871_100030521
478 Ga0068871_100040632
479 Ga0075428_100253361
480 Ga0075430_100523248
481 Ga0075431_100270617
482 Ga0075431_100711141
483 Ga0075433_10387188
484 Ga0075433_10567436
485 Ga0075434_100072395
486 Ga0075434_100538072
487 Ga0068865_100395187
488 Ga0075436_100288910
489 Ga0075435_100022610
490 Ga0075435_100142927
491 Ga0075435_100344056
492 Ga0075435_100547898
493 Ga0075435_100874171
494 Ga0099794_10020454
495 Ga0099795_10028120
496 Ga0099795_10117476
497 Ga0105251_10020832
498 Ga0105244_10146686
499 Ga0111539_10034199
500 Ga0111539_10086921
501 Ga0111539_10132801
502 Ga0111539_10259965
503 Ga0105247_10232591
504 Ga0114129_10048181
505 Ga0114129_10386612
506 Ga0114129_10908583
507 Ga0105243_10026687
508 Ga0105243_10576790
509 Ga0105242_10122973
510 Ga0105242_10179376
511 Ga0105248_10108303
512 Ga0105248_10457590
513 Ga0105249_10030603
514 Ga0105246_10332499
515 Ga0157373_10028471
516 Ga0157369_10248944
517 Ga0157374_10134416
518 Ga0157378_10462416
519 Ga0163162_10042625
520 Ga0163162_10544558
521 Ga0157375_10087439
522 Ga0157375_10111435
523 Ga0157375_10242491
524 Ga0163163_10212534
525 Ga0157377_10058829
526 Ga0157379_10657554
527 Ga0157376_10004696
528 Ga0157376_10221710
529 Ga0157376_10711308
530 Ga0206356_10948663
531 Ga0206354_11094621
532 Ga0224712_10199794
533 Ga0209759_1009652
534 Ga0207713_1139991
535 Ga0207653_10008802
536 Ga0207692_10001460
537 Ga0207692_10070281
538 Ga0207692_10214166
539 Ga0207692_10421783
540 Ga0207642_10105138
541 Ga0207688_10027730
542 Ga0207680_10224746
543 Ga0207647_10045599
544 Ga0207647_10099790
545 Ga0207647_10406587
546 Ga0207685_10169018
547 Ga0207699_10001199
548 Ga0207699_10074523
549 Ga0207643_10238517
550 Ga0207705_10523387
551 Ga0207684_10000391
552 Ga0207684_10081964
553 Ga0207684_10942901
554 Ga0207695_10247132
555 Ga0207693_10003744
556 Ga0207693_10032035
557 Ga0207693_10043506
558 Ga0207693_10046692
559 Ga0207693_10047736
560 Ga0207693_10047888
561 Ga0207693_10228609
562 Ga0207663_10013314
563 Ga0207663_10026371
564 Ga0207663_10037540
565 Ga0207663_10052925
566 Ga0207660_10075257
567 Ga0207662_10015627
568 Ga0207657_10109489
569 Ga0207646_10019137
570 Ga0207646_10134260
571 Ga0207646_10395637
572 Ga0207694_10152647
573 Ga0207659_10163979
574 Ga0207700_10089589
575 Ga0207700_10300433
576 Ga0207700_10563993
577 Ga0207664_10006224
578 Ga0207664_10019179
579 Ga0207664_10110917
580 Ga0207664_10160471
581 Ga0207664_10192453
582 Ga0207644_10122027
583 Ga0207644_10351792
584 Ga0207644_10514697
585 Ga0207690_10075047
586 Ga0207706_10551213
587 Ga0207709_10433709
588 Ga0207670_10206258
589 Ga0207704_10100308
590 Ga0207665_10002881
591 Ga0207665_10020330
592 Ga0207665_10217308
593 Ga0207691_10044933
594 Ga0207711_10319080
595 Ga0207689_10015334
596 Ga0207651_10765410
597 Ga0207712_10111469
598 Ga0207712_10191617
599 Ga0207640_10027893
600 Ga0207658_10149353
601 Ga0207677_10042739
602 Ga0207677_10462445
603 Ga0207703_10054094
604 Ga0207678_10117602
605 Ga0207702_10091658
606 Ga0207702_10246389
607 Ga0207641_10393991
608 Ga0207641_10624076
609 Ga0207674_10012279
610 Ga0207674_10331433
611 Ga0207675_100011736
612 Ga0207675_100031498
613 Ga0207683_10020174
614 Ga0207683_10484360
615 Ga0207698_10782349
616 Ga0209588_1000068
617 Ga0207428_10051699
618 Ga0207428_10062836
619 Ga0207428_10078336
620 Ga0207428_10282100
621 Ga0307514_10015326
622 Ga0307516_10014469
623 Ga0307415_100047887
624 Ga0373930_0073970
625 Ga0373948_0031562
626 Ga0373958_0061510
627 Ga0373959_0028604
628 Ga0373926_0041087
629 Ga0373951_0033171
630 Ga0373932_0053452
631 Ga0373941_0131704
632 Ga0373946_0100892
633 Ga0373942_0055494
634 Ga0373931_0025987
635 Ga0373931_0121971
636 Ga0373947_0043551
637 Ga0373925_0000141
638 Ga0395899_0107162
639 Ga0395900_0007091
640 Ga0395900_0129548
641 Ga0395898_0002695
642 Ga0395898_0112895
643 Ga0395898_0264909
644 Ga0395905_0002929
645 Ga0395905_0119930
646 Ga0395905_0141941
647 Ga0395901_0003239
648 Ga0395901_0037804
649 Ga0395901_0083779
650 Ga0436360_0045547
651 Ga0495662_0030171
652 Ga0495664_0169231
653 Ga0495607_0101447
654 Ga0495618_0015905
655 Ga0495663_0054204
656 Ga0495652_0118836
657 Ga0495621_0082940
658 Ga0495656_0117689
659 Ga0495634_0056921
660 Ga0495635_0170480
661 Ga0495657_0011188
662 Ga0495646_0126785
663 Ga0495613_0023151
664 Ga0495624_0205640
665 Ga0495670_0058505
666 Ga0495674_0346570
667 Ga0496100_0005056
668 Ga0496100_0091675
669 Ga0496100_0465968
670 Ga0496101_0034933
671 Ga0496102_0003842
672 Ga0496102_0033558
673 Ga0496102_0040305
674 Ga0496102_0144455
675 Ga0496102_0751714
676 Ga0496104_0001149
677 Ga0496104_0009790
678 Ga0496104_0075052
679 Ga0496105_0003771
680 Ga0496105_0015692
681 Ga0496106_0007141
682 Ga0496106_0094903
683 Ga0496106_0417343
684 Ga0496107_0044828
685 Ga0496107_0060224
686 Ga0496108_0028682
687 Ga0496108_0044473
688 Ga0496108_0126019
689 Ga0496108_0401787
690 Ga0496109_0007930
691 Ga0496109_0553173
692 Ga0496110_0002904
693 Ga0496110_0350281
694 Ga0496110_0365041
695 Ga0496111_0098382
696 Ga0496112_0010845
697 Ga0496112_0182483
698 Ga0496113_0013791
699 Ga0496113_0067380
700 Ga0496114_0039111
701 Ga0496114_0090151
702 Ga0496114_0144700
703 Ga0496114_0358219
704 Ga0496115_0029451
705 Ga0496115_0034405
706 Ga0496115_0159245
707 Ga0496115_0355931
708 nmdc:mga0yw44_188010_c1
709 nmdc:mga05p37_566152_c1
710 nmdc:mga0qj67_193696_c1
711 nmdc:mga08y16_149076_c1
712 nmdc:mga08y16_399530_c1
713 nmdc:mga08y16_57498_c1
714 nmdc:mga0n895_213755_c1
715 nmdc:mga0n895_270665_c1
716 nmdc:mga0n895_99766_c1
717 nmdc:mga0rr50_173541_c1
718 nmdc:mga0rr50_352897_c1
719 nmdc:mga0rr50_675465_c1
720 nmdc:mga08x19_168297_c1
721 nmdc:mga08x19_23109_c1
722 nmdc:mga08x19_239846_c1
723 nmdc:mga0a205_139510_c1
724 Ga0495601_0001111

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

33

124

0.97

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

33

130

0.84

PF07991

IlvN

Acetohydroxy acid isomeroreductase, NADPH-binding domain

30

120

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6foz-assembly1.cif.gz_A the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 13 0.9866 2 29
3hdq-assembly1.cif.gz_A crystal structure of udp-galactopyranose mutase (oxidized form) in complex with substrate 0.984 3 30
2vvm-assembly1.cif.gz_B the structure of mao-n-d5, a variant of monoamine oxidase from aspergillus niger. 0.9821 2 30
2vvl-assembly2.cif.gz_B the structure of mao-n-d3, a variant of monoamine oxidase from aspergillus niger. 0.981 2 29
2vvl-assembly4.cif.gz_F the structure of mao-n-d3, a variant of monoamine oxidase from aspergillus niger. 0.9809 2 30
ID Description Score Start End Superfamily
af_P75728_4_256_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9955 2 28 3.50.50.60
5nahA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9813 2 29 3.50.50.60
af_Q54BK7_6_401_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.979 3 32 3.50.50.60
af_F1QDN5_95_460_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9789 3 32 3.50.50.60
2gqfA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9764 3 30 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A536MJ71-F1-model_v4 NADP oxidoreductase coenzyme F420-dependent 0.9888 1 218
AF-A0A2V7JNM5-F1-model_v4 Uncharacterized protein 0.982 129 217
AF-A0A0S7CXR3-F1-model_v4 Metalloreductase STEAP3 0.9767 1 212
AF-A0A2U3P2T6-F1-model_v4 Predicted dinucleotide-binding enzyme 0.9737 1 216
AF-A0A4V1U9H5-F1-model_v4 deleted 0.9688 1 221

Map