F422715

General Info

Members Datasets Scaffolds Average Seq Length
362 231 257 307

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0006712|Ga0495629_0006712_3922_4968
Length 334
Sequence MSAALRSPANRSWRAATSRTPLQSPLLQPEPDMPMLLECLSHTPLAGYYDPPAEVVGQVEQVHAAARARVATFDPELVVVFAPDHYNGFFYDLMPPFCIGAAASAVGDFKSLAGPLDVPAGIALELAEAVLDSDIDVAVSYRMQVDHGCAQALELLTGGLDRYPVVPVFINSVAPPMASCRRARLLGDALGRALARMDKRVLLIGSGGISHEPPVPELAGASDEVAQRLIAGRNPSAESRAARQARTVAAARAFTAGDSRLHPLNPEWDRSFLKLLEDGDLKALDGLTDPAITRAAGKSAHEIRTWVAAFGALNAGGSYRATLDYYRRPVAANA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
7 2511231006 Pseudomonas sp. GM17 Isolate Nodule
8 2511231015 Pseudomonas sp. GM49 Isolate Nodule
9 2511231020 Pseudomonas sp. GM74 Isolate Nodule
10 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
11 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
12 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
13 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
14 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
15 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
16 2519103095 Burkholderia sp. KJ006 Isolate Nodule
17 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
18 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
19 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
20 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
21 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
22 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
23 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
24 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
25 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
26 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
27 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
28 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
29 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
30 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
31 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
32 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
33 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
34 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
35 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
36 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
37 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
38 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
39 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
40 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
41 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
42 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
43 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
44 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
45 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
46 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
47 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
48 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
49 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
50 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
51 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
52 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
53 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
54 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
55 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
56 2636415599 Klebsiella variicola DX120E Isolate Unclassified
57 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
58 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
59 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
60 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
61 2738541307 Variovorax sp. GV008 Isolate Unclassified
62 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
63 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
64 2775507074 Klebsiella sp. D5A Isolate Unclassified
65 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
66 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
67 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
68 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
69 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
70 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
71 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
72 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
73 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
74 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
75 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
76 2885266251 Ralstonia sp. SET104 Isolate Nodule
77 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
78 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
79 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
80 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
81 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
82 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
83 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
84 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
85 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
86 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
87 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
88 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
89 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
90 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
91 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
92 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
93 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
94 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
95 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
96 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
125 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
126 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
127 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
128 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
129 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
130 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
137 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
167 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
194 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
195 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
196 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
201 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
223 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
224 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
225 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
226 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
227 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
228 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
229 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
230 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
231 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.99
Metatranscriptomes 0
Isolates 29.01

Biome Distribution

Category Percentage (%)
Aerial Root 0.55
Bulb 0
Endosphere 4.14
Nodule 4.14
Rhizoplane 11.88
Rhizosphere 67.13
Stem 0
Stem Tuber 0
Unclassified 12.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10011491 3300003187 Bacteria 4067
2 JGI25151J46595_10034289 3300003187 Bacteria 1943
3 Ga0055532_1000364 3300003758 Bacteria 23736
4 Ga0055541_1009333 3300003841 Bacteria 1521
5 Ga0065714_10002253 3300005288 Bacteria 35579
6 Ga0065704_10070526 3300005289 Bacteria 21764
7 Ga0070665_100157236 3300005548 Bacteria 2275
8 Ga0068863_100241341 3300005841 Bacteria 1744
9 Ga0075365_10077862 3300006038 Bacteria 2241
10 Ga0075365_10162856 3300006038 Bacteria 1555
11 Ga0075367_10002955 3300006178 Bacteria 7942
12 Ga0105251_10000105 3300009011 Bacteria 83319
13 Ga0105251_10007921 3300009011 Bacteria 6457
14 Ga0105251_10014262 3300009011 Bacteria 4405
15 Ga0105244_10001542 3300009036 Bacteria 18346
16 Ga0105244_10010101 3300009036 Bacteria 5748
17 Ga0105250_10000052 3300009092 Bacteria 116382
18 Ga0105250_10000053 3300009092 Bacteria 114563
19 Ga0157369_10018236 3300013105 Bacteria 7870
20 Ga0183361_10007 3300016635 Bacteria 339575
21 Ga0163161_10002299 3300017792 Bacteria 13707
22 Ga0209566_101159 3300025225 Bacteria 9649
23 Ga0209147_100156 3300025229 Bacteria 93105
24 Ga0209025_1000034 3300025294 Bacteria 413205
25 Ga0209025_1000341 3300025294 Bacteria 102793
26 Ga0207696_1000003 3300025711 Bacteria 860639
27 Ga0207696_1000116 3300025711 Bacteria 148125
28 Ga0207713_1000002 3300025735 Bacteria 1061749
29 Ga0207713_1000003 3300025735 Bacteria 860698
30 Ga0207713_1013801 3300025735 Bacteria 4234
31 Ga0207713_1041203 3300025735 Bacteria 1929
32 Ga0207676_10279727 3300026095 Bacteria 1515
33 Ga0209371_1001588 3300027312 Bacteria 14807
34 Ga0207428_10008192 3300027907 Bacteria 9454
35 Ga0268266_10125318 3300028379 Bacteria 2291
36 Ga0265338_10009351 3300028800 Bacteria 11710
37 Ga0268256_1001370 3300030500 Bacteria 14807
38 Ga0265332_10053502 3300031238 Bacteria 1732
39 Ga0265316_10246109 3300031344 Bacteria 1314
40 Ga0395900_0000474 3300037418 Bacteria 57230
41 Ga0395900_0111360 3300037418 Bacteria 2812
42 Ga0395898_0019940 3300037466 Bacteria 6817
43 Ga0395905_0000309 3300037471 Bacteria 71085
44 Ga0395905_0102849 3300037471 Bacteria 2682
45 Ga0395905_0115573 3300037471 Bacteria 2522
46 Ga0395901_0000908 3300038443 Bacteria 32498
47 Ga0436361_1007585 3300039447 Bacteria 1320
48 Ga0439438_000149 3300041405 Bacteria 31679
49 Ga0439447_005505 3300041407 Bacteria 4201
50 Ga0439466_0000599 3300041411 Bacteria 13513
51 Ga0439451_000125 3300042009 Bacteria 14064
52 Ga0439452_000130 3300042010 Bacteria 57394
53 Ga0439456_002361 3300042013 Bacteria 3805
54 Ga0450905_001475 3300042142 Bacteria 3002
55 Ga0451577_0211431 3300042876 Bacteria 1752
56 Ga0466972_0073212 3300044658 Bacteria 1633
57 Ga0466961_0020234 3300044693 Bacteria 4282
58 Ga0495592_0012713 3300046454 Bacteria 6399
59 Ga0495592_0029378 3300046454 Bacteria 4163
60 Ga0495603_0000157 3300046455 Bacteria 34309
61 Ga0495590_0006478 3300046457 Bacteria 4569
62 Ga0495591_000554 3300046458 Bacteria 28735
63 Ga0495629_0001638 3300046459 Bacteria 17603
64 Ga0495629_0006712 3300046459 Bacteria 8509
65 Ga0495638_0011558 3300046460 Bacteria 6082
66 Ga0495641_0013165 3300046461 Bacteria 4567
67 Ga0495651_0016339 3300046462 Bacteria 5748
68 Ga0495651_0017882 3300046462 Bacteria 5489
69 Ga0495651_0020138 3300046462 Bacteria 5178
70 Ga0495653_0012692 3300046463 Bacteria 6882
71 Ga0495653_0013337 3300046463 Bacteria 6696
72 Ga0495653_0067318 3300046463 Bacteria 2690
73 Ga0495650_0002221 3300046471 Bacteria 16296
74 Ga0495650_0011387 3300046471 Bacteria 4878
75 Ga0495580_0000014 3300046472 Bacteria 94756
76 Ga0495580_0001396 3300046472 Bacteria 21182
77 Ga0495580_0004166 3300046472 Bacteria 12159
78 Ga0495580_0010092 3300046472 Bacteria 7379
79 Ga0495580_0043242 3300046472 Bacteria 3206
80 Ga0495582_0002673 3300046473 Bacteria 9947
81 Ga0495582_0002903 3300046473 Bacteria 9585
82 Ga0495605_0000195 3300046474 Bacteria 75899
83 Ga0495664_0073716 3300046477 Bacteria 2041
84 Ga0495664_0092366 3300046477 Bacteria 1820
85 Ga0495584_0014745 3300046491 Bacteria 3981
86 Ga0495585_0000795 3300046492 Bacteria 27671
87 Ga0495594_0009498 3300046499 Bacteria 5027
88 Ga0495594_0047347 3300046499 Bacteria 2361
89 Ga0495607_0027879 3300046501 Bacteria 3487
90 Ga0495607_0113870 3300046501 Bacteria 1430
91 Ga0495583_0000169 3300046506 Bacteria 111114
92 Ga0495583_0017806 3300046506 Bacteria 3760
93 Ga0495583_0023862 3300046506 Bacteria 3085
94 Ga0495606_0015956 3300046507 Bacteria 5757
95 Ga0495608_0002225 3300046511 Bacteria 14001
96 Ga0495618_0003467 3300046514 Bacteria 9799
97 Ga0495618_0004707 3300046514 Bacteria 8343
98 Ga0495628_0016021 3300046516 Bacteria 6254
99 Ga0495628_0030572 3300046516 Bacteria 4359
100 Ga0495628_0075030 3300046516 Bacteria 2633
101 Ga0495628_0078191 3300046516 Bacteria 2573
102 Ga0495630_0004185 3300046517 Bacteria 10101
103 Ga0495630_0004863 3300046517 Bacteria 9431
104 Ga0495630_0014185 3300046517 Bacteria 5801
105 Ga0495630_0025889 3300046517 Bacteria 4340
106 Ga0495630_0112068 3300046517 Bacteria 2066
107 Ga0495632_0000983 3300046519 Bacteria 24906
108 Ga0495632_0003120 3300046519 Bacteria 11996
109 Ga0495643_0000360 3300046522 Bacteria 61894
110 Ga0495643_0042277 3300046522 Bacteria 2483
111 Ga0495648_0017805 3300046524 Bacteria 5064
112 Ga0495666_0000092 3300046526 Bacteria 36757
113 Ga0495666_0002984 3300046526 Bacteria 8492
114 Ga0495666_0007228 3300046526 Bacteria 5572
115 Ga0495666_0035963 3300046526 Bacteria 2412
116 Ga0495652_0019536 3300046529 Bacteria 6032
117 Ga0495652_0088043 3300046529 Bacteria 2545
118 Ga0495652_0235006 3300046529 Bacteria 1368
119 Ga0495665_0000824 3300046531 Bacteria 16283
120 Ga0495665_0016906 3300046531 Bacteria 3927
121 Ga0495665_0046579 3300046531 Bacteria 2301
122 Ga0495665_0118426 3300046531 Bacteria 1387
123 Ga0495640_0010589 3300046533 Bacteria 7113
124 Ga0495640_0010868 3300046533 Bacteria 7021
125 Ga0495587_0004587 3300046536 Bacteria 9077
126 Ga0495587_0007207 3300046536 Bacteria 7215
127 Ga0495609_0052788 3300046538 Bacteria 1808
128 Ga0495609_0130588 3300046538 Bacteria 1076
129 Ga0495597_0001009 3300046542 Bacteria 21585
130 Ga0495597_0104522 3300046542 Bacteria 1191
131 Ga0495645_0011206 3300046543 Bacteria 6303
132 Ga0495645_0044197 3300046543 Bacteria 3249
133 Ga0495622_0000096 3300046557 Bacteria 77784
134 Ga0495634_0017361 3300046642 Bacteria 5136
135 Ga0495625_0001135 3300046660 Bacteria 34436
136 Ga0495625_0010005 3300046660 Bacteria 7889
137 Ga0495635_0018084 3300046663 Bacteria 4922
138 Ga0495661_0006446 3300046665 Bacteria 8253
139 Ga0495599_0005605 3300046678 Bacteria 7528
140 Ga0495599_0043294 3300046678 Bacteria 2825
141 Ga0495623_0005180 3300046679 Bacteria 8551
142 Ga0495623_0008912 3300046679 Bacteria 6513
143 Ga0495623_0048377 3300046679 Bacteria 2697
144 Ga0495623_0094083 3300046679 Bacteria 1834
145 Ga0495623_0097496 3300046679 Bacteria 1795
146 Ga0495646_0004777 3300046680 Bacteria 8557
147 Ga0495646_0013450 3300046680 Bacteria 5202
148 Ga0495646_0018576 3300046680 Bacteria 4402
149 Ga0495669_0055176 3300046684 Bacteria 1789
150 Ga0495613_0001018 3300046689 Bacteria 21313
151 Ga0495613_0009035 3300046689 Bacteria 7392
152 Ga0495624_0000390 3300046690 Bacteria 34924
153 Ga0495624_0023555 3300046690 Bacteria 4060
154 Ga0495624_0037711 3300046690 Bacteria 3108
155 Ga0495624_0126486 3300046690 Bacteria 1568
156 Ga0495671_0000236 3300046692 Bacteria 47535
157 Ga0495671_0005199 3300046692 Bacteria 7654
158 Ga0495649_0010490 3300046694 Bacteria 5464
159 Ga0495649_0177411 3300046694 Bacteria 1113
160 Ga0495600_0001042 3300046809 Bacteria 15003
161 Ga0495660_0047507 3300046810 Bacteria 2350
162 Ga0495660_0056223 3300046810 Bacteria 2127
163 Ga0495604_0001098 3300047317 Bacteria 22457
164 Ga0495604_0003658 3300047317 Bacteria 12253
165 Ga0495604_0004983 3300047317 Bacteria 10517
166 Ga0495604_0009759 3300047317 Bacteria 7594
167 Ga0495604_0056082 3300047317 Bacteria 3034
168 Ga0495604_0060099 3300047317 Bacteria 2911
169 Ga0495604_0082889 3300047317 Bacteria 2397
170 Ga0495636_0002723 3300047318 Bacteria 6815
171 Ga0495674_0020309 3300047319 Bacteria 6152
172 Ga0495674_0061004 3300047319 Bacteria 3288
173 Ga0495674_0083746 3300047319 Bacteria 2733
174 Ga0495674_0122892 3300047319 Bacteria 2192
175 Ga0495674_0153746 3300047319 Bacteria 1928
176 Ga0495674_0171500 3300047319 Unclassified 1810
177 Ga0495672_0013815 3300047320 Bacteria 5554
178 Ga0495672_0060763 3300047320 Bacteria 2181
179 Ga0495676_0020139 3300047321 Bacteria 5862
180 Ga0495676_0090825 3300047321 Bacteria 2284
181 Ga0495680_0001350 3300047322 Bacteria 26630
182 Ga0495680_0011872 3300047322 Bacteria 7687
183 Ga0495680_0019830 3300047322 Bacteria 5669
184 Ga0495683_0000818 3300047323 Bacteria 22161
185 Ga0495683_0000820 3300047323 Bacteria 22124
186 Ga0495687_000308 3300047443 Bacteria 64153
187 Ga0495687_000845 3300047443 Bacteria 32633
188 Ga0495687_052362 3300047443 Bacteria 1726
189 Ga0495675_0000123 3300047444 Bacteria 55312
190 Ga0495675_0005761 3300047444 Bacteria 7576
191 Ga0495675_0016869 3300047444 Bacteria 4620
192 Ga0495675_0023844 3300047444 Bacteria 3899
193 Ga0495675_0055957 3300047444 Bacteria 2501
194 Ga0495675_0056095 3300047444 Bacteria 2498
195 Ga0495675_0086822 3300047444 Bacteria 1966
196 Ga0495679_000850 3300047446 Bacteria 19367
197 Ga0495679_003190 3300047446 Bacteria 7992
198 Ga0495685_029591 3300047447 Bacteria 1883
199 Ga0495673_0001159 3300047469 Bacteria 22299
200 Ga0495673_0002070 3300047469 Bacteria 14676
201 Ga0495673_0004857 3300047469 Bacteria 8308
202 Ga0495673_0033073 3300047469 Bacteria 2404
203 Ga0495681_0000195 3300047470 Bacteria 51032
204 Ga0495681_0000198 3300047470 Bacteria 50496
205 Ga0495686_0237489 3300047472 Bacteria 1029
206 Ga0495593_0002764 3300047673 Bacteria 10557
207 Ga0495593_0020756 3300047673 Bacteria 3674
208 Ga0495593_0167330 3300047673 Unclassified 1109
209 Ga0495593_0205432 3300047673 Bacteria 989
210 Ga0495602_0009116 3300048088 Bacteria 10330
211 Ga0495602_0019102 3300048088 Bacteria 6816
212 Ga0495602_0032049 3300048088 Bacteria 4955
213 Ga0495602_0108341 3300048088 Bacteria 2262
214 Ga0495602_0137800 3300048088 Bacteria 1936
215 Ga0495602_0199336 3300048088 Bacteria 1528
216 Ga0495602_0206301 3300048088 Bacteria 1495
217 Ga0495602_0213334 3300048088 Bacteria 1463
218 Ga0495614_0000203 3300048089 Bacteria 22918
219 Ga0495626_0022589 3300048091 Bacteria 3105
220 Ga0495626_0041593 3300048091 Bacteria 2163
221 Ga0495626_0062267 3300048091 Bacteria 1695
222 Ga0495626_0100615 3300048091 Bacteria 1260
223 Ga0496101_0049479 3300048904 Bacteria 3024
224 Ga0496104_0604697 3300048907 Bacteria 1007
225 Ga0496104_0618157 3300048907 Bacteria 993
226 Ga0496105_0007836 3300048908 Bacteria 8290
227 Ga0496105_0190340 3300048908 Bacteria 1678
228 Ga0496110_0463207 3300048913 Bacteria 1155
229 Ga0496114_0054930 3300048917 Bacteria 3321
230 Ga0496117_0002096 3300048920 Bacteria 26249
231 Ga0496118_0001782 3300048921 Bacteria 31082
232 Ga0496122_0021781 3300048925 Bacteria 5721
233 Ga0496122_0078604 3300048925 Bacteria 2310
234 Ga0496122_0142115 3300048925 Bacteria 1499
235 Ga0496123_0014785 3300048926 Bacteria 6444
236 Ga0496123_0024433 3300048926 Bacteria 4593
237 Ga0496123_0139829 3300048926 Bacteria 1326
238 Ga0496123_0176823 3300048926 Bacteria 1119
239 Ga0496124_0002199 3300048927 Bacteria 26020
240 Ga0496124_0010636 3300048927 Bacteria 9290
241 Ga0496125_0000122 3300048928 Bacteria 174898
242 Ga0496125_0001860 3300048928 Bacteria 29047
243 Ga0496126_0000073 3300048929 Bacteria 236027
244 Ga0496126_0010977 3300048929 Bacteria 9428
245 Ga0496126_0109787 3300048929 Bacteria 2404
246 Ga0495682_0000039 3300049460 Bacteria 119714
247 Ga0495682_0000410 3300049460 Bacteria 30462
248 Ga0495682_0064817 3300049460 Bacteria 1317
249 Ga0501034_0000106 3300049571 Bacteria 153523
250 Ga0501043_0294624 3300049579 Bacteria 1241
251 Ga0501083_0212178 3300049744 Bacteria 1262
252 Ga0501044_0171606 3300049823 Bacteria 2140
253 nmdc:mga0yw44_118352_c1 3300050492 Bacteria 1704
254 nmdc:mga0yw44_90863_c1 3300050492 Bacteria 1929
255 nmdc:mga06z11_7758_c1 3300050494 Bacteria 4435
256 nmdc:mga08x19_91199_c1 3300050514 Bacteria 2011
257 nmdc:mga0sz30_78541_c1 3300050516 Bacteria 1426

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046471 Ga0495650_0002221 Ga0495650_0002221_3306_4247 275
2 3300048907 Ga0496104_0604697 Ga0496104_0604697_10_846 277
3 3300027312 Ga0209371_1001588 Ga0209371_100158813 278
4 3300030500 Ga0268256_1001370 Ga0268256_100137013 278
5 iso_pu_bacteria 2802429296 2804843269 280
6 3300046519 Ga0495632_0003120 Ga0495632_0003120_9266_10210 282
7 3300046522 Ga0495643_0000360 Ga0495643_0000360_19134_20078 282
8 3300042876 Ga0451577_0211431 Ga0451577_0211431_623_1579 283
9 3300048913 Ga0496110_0463207 Ga0496110_0463207_141_1067 285
10 3300048917 Ga0496114_0054930 Ga0496114_0054930_387_1313 285
11 3300006038 Ga0075365_10077862 Ga0075365_100778622 287
12 3300048925 Ga0496122_0078604 Ga0496122_0078604_1428_2294 287
13 3300044658 Ga0466972_0073212 Ga0466972_0073212_570_1493 288
14 iso_pu_bacteria 2501025501 2501074466 288
15 3300037418 Ga0395900_0000474 Ga0395900_0000474_7888_8832 289
16 3300049823 Ga0501044_0171606 Ga0501044_0171606_931_1875 289
17 3300046491 Ga0495584_0014745 Ga0495584_0014745_519_1454 290
18 3300009011 Ga0105251_10000105 Ga0105251_100001059 293
19 3300009092 Ga0105250_10000053 Ga0105250_1000005399 293
20 3300025711 Ga0207696_1000116 Ga0207696_100011645 293
21 3300025735 Ga0207713_1000003 Ga0207713_100000342 293
22 3300009036 Ga0105244_10001542 Ga0105244_100015428 294
23 3300025735 Ga0207713_1000002 Ga0207713_1000002998 294
24 3300046810 Ga0495660_0047507 Ga0495660_0047507_430_1317 294
25 3300047470 Ga0495681_0000198 Ga0495681_0000198_22007_22894 294
26 3300048091 Ga0495626_0100615 Ga0495626_0100615_241_1128 294
27 3300048908 Ga0496105_0007836 Ga0496105_0007836_7272_8198 294
28 3300050492 nmdc:mga0yw44_90863_c1 nmdc:mga0yw44_90863_c1_14_964 294
29 3300046458 Ga0495591_000554 Ga0495591_000554_16778_17722 296
30 3300046692 Ga0495671_0000236 Ga0495671_0000236_22927_23871 296
31 3300047446 Ga0495679_003190 Ga0495679_003190_5789_6733 296
32 3300005288 Ga0065714_10002253 Ga0065714_1000225328 297
33 3300005289 Ga0065704_10070526 Ga0065704_1007052616 297
34 3300042010 Ga0439452_000130 Ga0439452_000130_34528_35481 297
35 3300042142 Ga0450905_001475 Ga0450905_001475_1131_2072 297
36 3300046460 Ga0495638_0011558 Ga0495638_0011558_4083_5024 297
37 3300046471 Ga0495650_0011387 Ga0495650_0011387_2456_3397 297
38 3300046492 Ga0495585_0000795 Ga0495585_0000795_16590_17531 297
39 3300046519 Ga0495632_0000983 Ga0495632_0000983_9770_10723 297
40 3300046526 Ga0495666_0000092 Ga0495666_0000092_26417_27358 297
41 3300047322 Ga0495680_0001350 Ga0495680_0001350_9595_10536 297
42 3300047443 Ga0495687_000845 Ga0495687_000845_22422_23363 297
43 3300048091 Ga0495626_0041593 Ga0495626_0041593_866_1813 297
44 3300009092 Ga0105250_10000052 Ga0105250_1000005230 298
45 3300025711 Ga0207696_1000003 Ga0207696_1000003171 298
46 3300046474 Ga0495605_0000195 Ga0495605_0000195_58918_59862 298
47 3300046501 Ga0495607_0113870 Ga0495607_0113870_258_1202 298
48 3300046538 Ga0495609_0052788 Ga0495609_0052788_111_1055 298
49 3300046542 Ga0495597_0001009 Ga0495597_0001009_13670_14614 298
50 3300046810 Ga0495660_0056223 Ga0495660_0056223_835_1779 298
51 3300047469 Ga0495673_0002070 Ga0495673_0002070_9884_10828 298
52 3300047470 Ga0495681_0000195 Ga0495681_0000195_38907_39851 298
53 3300048925 Ga0496122_0142115 Ga0496122_0142115_437_1381 298
54 3300048926 Ga0496123_0176823 Ga0496123_0176823_155_1099 298
55 3300048927 Ga0496124_0002199 Ga0496124_0002199_23782_24726 298
56 3300048928 Ga0496125_0000122 Ga0496125_0000122_5573_6517 298
57 3300048929 Ga0496126_0010977 Ga0496126_0010977_6500_7453 298
58 3300003841 Ga0055541_1009333 Ga0055541_10093332 299
59 3300025225 Ga0209566_101159 Ga0209566_1011595 299
60 3300046454 Ga0495592_0012713 Ga0495592_0012713_2292_3236 299
61 3300046472 Ga0495580_0043242 Ga0495580_0043242_1732_2676 299
62 3300046477 Ga0495664_0073716 Ga0495664_0073716_418_1362 299
63 3300046514 Ga0495618_0004707 Ga0495618_0004707_2220_3164 299
64 3300046536 Ga0495587_0004587 Ga0495587_0004587_5049_5993 299
65 3300046663 Ga0495635_0018084 Ga0495635_0018084_2990_3934 299
66 3300046678 Ga0495599_0043294 Ga0495599_0043294_1078_2022 299
67 3300046684 Ga0495669_0055176 Ga0495669_0055176_188_1132 299
68 3300046809 Ga0495600_0001042 Ga0495600_0001042_3391_4335 299
69 3300047444 Ga0495675_0023844 Ga0495675_0023844_17_961 299
70 3300047469 Ga0495673_0004857 Ga0495673_0004857_16_960 299
71 3300005548 Ga0070665_100157236 Ga0070665_1001572362 300
72 3300009011 Ga0105251_10014262 Ga0105251_100142622 300
73 3300025735 Ga0207713_1041203 Ga0207713_10412032 300
74 3300028379 Ga0268266_10125318 Ga0268266_101253182 300
75 3300031344 Ga0265316_10246109 Ga0265316_102461092 300
76 3300042009 Ga0439451_000125 Ga0439451_000125_7692_8636 300
77 3300042013 Ga0439456_002361 Ga0439456_002361_106_1050 300
78 3300047319 Ga0495674_0122892 Ga0495674_0122892_1029_1970 300
79 3300047443 Ga0495687_000308 Ga0495687_000308_8360_9304 300
80 3300048904 Ga0496101_0049479 Ga0496101_0049479_1980_2900 300
81 3300048920 Ga0496117_0002096 Ga0496117_0002096_14720_15664 300
82 3300048921 Ga0496118_0001782 Ga0496118_0001782_18787_19731 300
83 3300048925 Ga0496122_0021781 Ga0496122_0021781_2985_3929 300
84 3300048926 Ga0496123_0139829 Ga0496123_0139829_224_1168 300
85 3300048929 Ga0496126_0109787 Ga0496126_0109787_691_1593 300
86 3300003758 Ga0055532_1000364 Ga0055532_10003646 301
87 3300009036 Ga0105244_10010101 Ga0105244_100101012 301
88 3300025229 Ga0209147_100156 Ga0209147_10015626 301
89 3300027907 Ga0207428_10008192 Ga0207428_100081923 301
90 3300037471 Ga0395905_0000309 Ga0395905_0000309_1215_2159 301
91 3300037471 Ga0395905_0102849 Ga0395905_0102849_410_1363 301
92 3300037471 Ga0395905_0115573 Ga0395905_0115573_398_1351 301
93 3300046454 Ga0495592_0029378 Ga0495592_0029378_2285_3235 301
94 3300046459 Ga0495629_0006712 Ga0495629_0006712_3922_4968 301
95 3300046462 Ga0495651_0016339 Ga0495651_0016339_2338_3384 301
96 3300046473 Ga0495582_0002673 Ga0495582_0002673_1356_2402 301
97 3300046511 Ga0495608_0002225 Ga0495608_0002225_9783_10829 301
98 3300046529 Ga0495652_0088043 Ga0495652_0088043_539_1585 301
99 3300046531 Ga0495665_0000824 Ga0495665_0000824_6284_7330 301
100 3300046533 Ga0495640_0010589 Ga0495640_0010589_517_1563 301
101 3300046538 Ga0495609_0130588 Ga0495609_0130588_40_984 301
102 3300046660 Ga0495625_0001135 Ga0495625_0001135_28082_28990 301
103 3300046665 Ga0495661_0006446 Ga0495661_0006446_757_1803 301
104 3300046679 Ga0495623_0005180 Ga0495623_0005180_3686_4732 301
105 3300047320 Ga0495672_0013815 Ga0495672_0013815_1071_2015 301
106 3300047323 Ga0495683_0000820 Ga0495683_0000820_659_1705 301
107 3300047469 Ga0495673_0033073 Ga0495673_0033073_620_1528 301
108 3300048088 Ga0495602_0009116 Ga0495602_0009116_719_1669 301
109 3300048091 Ga0495626_0022589 Ga0495626_0022589_2013_2957 301
110 3300048927 Ga0496124_0010636 Ga0496124_0010636_5077_6021 301
111 3300049460 Ga0495682_0000410 Ga0495682_0000410_20783_21736 301
112 3300050514 nmdc:mga08x19_91199_c1 nmdc:mga08x19_91199_c1_301_1245 301
113 3300050516 nmdc:mga0sz30_78541_c1 nmdc:mga0sz30_78541_c1_165_1109 301
114 3300003187 JGI25151J46595_10034289 JGI25151J46595_100342892 302
115 3300009011 Ga0105251_10007921 Ga0105251_100079213 302
116 3300013105 Ga0157369_10018236 Ga0157369_100182363 302
117 3300016635 Ga0183361_10007 Ga0183361_1000773 302
118 3300017792 Ga0163161_10002299 Ga0163161_1000229910 302
119 3300025294 Ga0209025_1000034 Ga0209025_1000034200 302
120 3300025735 Ga0207713_1013801 Ga0207713_10138014 302
121 3300026095 Ga0207676_10279727 Ga0207676_102797273 302
122 3300039447 Ga0436361_1007585 Ga0436361_1007585_109_1059 302
123 3300044693 Ga0466961_0020234 Ga0466961_0020234_2660_3619 302
124 3300046457 Ga0495590_0006478 Ga0495590_0006478_3399_4349 302
125 3300046461 Ga0495641_0013165 Ga0495641_0013165_2506_3456 302
126 3300046462 Ga0495651_0017882 Ga0495651_0017882_2327_3277 302
127 3300046462 Ga0495651_0020138 Ga0495651_0020138_3881_4831 302
128 3300046463 Ga0495653_0012692 Ga0495653_0012692_5404_6354 302
129 3300046463 Ga0495653_0013337 Ga0495653_0013337_2756_3706 302
130 3300046463 Ga0495653_0067318 Ga0495653_0067318_729_1673 302
131 3300046472 Ga0495580_0000014 Ga0495580_0000014_1903_2853 302
132 3300046472 Ga0495580_0004166 Ga0495580_0004166_38_988 302
133 3300046473 Ga0495582_0002903 Ga0495582_0002903_1046_1996 302
134 3300046499 Ga0495594_0047347 Ga0495594_0047347_1094_2044 302
135 3300046507 Ga0495606_0015956 Ga0495606_0015956_920_1870 302
136 3300046514 Ga0495618_0003467 Ga0495618_0003467_7076_8026 302
137 3300046516 Ga0495628_0016021 Ga0495628_0016021_2303_3280 302
138 3300046516 Ga0495628_0030572 Ga0495628_0030572_2628_3578 302
139 3300046516 Ga0495628_0075030 Ga0495628_0075030_790_1740 302
140 3300046517 Ga0495630_0004185 Ga0495630_0004185_4214_5164 302
141 3300046517 Ga0495630_0014185 Ga0495630_0014185_3228_4181 302
142 3300046517 Ga0495630_0025889 Ga0495630_0025889_2827_3777 302
143 3300046526 Ga0495666_0007228 Ga0495666_0007228_4318_5268 302
144 3300046526 Ga0495666_0035963 Ga0495666_0035963_851_1801 302
145 3300046529 Ga0495652_0019536 Ga0495652_0019536_490_1440 302
146 3300046531 Ga0495665_0046579 Ga0495665_0046579_434_1384 302
147 3300046533 Ga0495640_0010868 Ga0495640_0010868_4984_5934 302
148 3300046536 Ga0495587_0007207 Ga0495587_0007207_175_1125 302
149 3300046542 Ga0495597_0104522 Ga0495597_0104522_171_1121 302
150 3300046543 Ga0495645_0044197 Ga0495645_0044197_47_997 302
151 3300046557 Ga0495622_0000096 Ga0495622_0000096_70955_71905 302
152 3300046642 Ga0495634_0017361 Ga0495634_0017361_3869_4819 302
153 3300046678 Ga0495599_0005605 Ga0495599_0005605_6157_7107 302
154 3300046679 Ga0495623_0008912 Ga0495623_0008912_5041_5991 302
155 3300046679 Ga0495623_0048377 Ga0495623_0048377_1536_2486 302
156 3300046680 Ga0495646_0004777 Ga0495646_0004777_1426_2376 302
157 3300046680 Ga0495646_0018576 Ga0495646_0018576_1947_2897 302
158 3300046689 Ga0495613_0009035 Ga0495613_0009035_4215_5165 302
159 3300046690 Ga0495624_0000390 Ga0495624_0000390_1503_2453 302
160 3300046694 Ga0495649_0010490 Ga0495649_0010490_3862_4812 302
161 3300047317 Ga0495604_0001098 Ga0495604_0001098_12123_13073 302
162 3300047317 Ga0495604_0004983 Ga0495604_0004983_2902_3852 302
163 3300047317 Ga0495604_0056082 Ga0495604_0056082_1279_2229 302
164 3300047317 Ga0495604_0060099 Ga0495604_0060099_879_1856 302
165 3300047322 Ga0495680_0011872 Ga0495680_0011872_5108_6058 302
166 3300047322 Ga0495680_0019830 Ga0495680_0019830_401_1351 302
167 3300047323 Ga0495683_0000818 Ga0495683_0000818_10970_11920 302
168 3300047444 Ga0495675_0005761 Ga0495675_0005761_1563_2513 302
169 3300047444 Ga0495675_0016869 Ga0495675_0016869_3127_4077 302
170 3300047444 Ga0495675_0055957 Ga0495675_0055957_243_1193 302
171 3300047446 Ga0495679_000850 Ga0495679_000850_17636_18586 302
172 3300047472 Ga0495686_0237489 Ga0495686_0237489_30_980 302
173 3300047673 Ga0495593_0002764 Ga0495593_0002764_6592_7542 302
174 3300048088 Ga0495602_0032049 Ga0495602_0032049_2980_3930 302
175 3300048928 Ga0496125_0001860 Ga0496125_0001860_16688_17635 302
176 3300048929 Ga0496126_0000073 Ga0496126_0000073_224023_224973 302
177 3300046472 Ga0495580_0001396 Ga0495580_0001396_15100_16011 303
178 3300046516 Ga0495628_0078191 Ga0495628_0078191_950_1861 303
179 3300046529 Ga0495652_0235006 Ga0495652_0235006_204_1115 303
180 3300046531 Ga0495665_0118426 Ga0495665_0118426_295_1206 303
181 3300046660 Ga0495625_0010005 Ga0495625_0010005_2214_3176 303
182 3300046679 Ga0495623_0094083 Ga0495623_0094083_449_1360 303
183 3300046680 Ga0495646_0013450 Ga0495646_0013450_995_1906 303
184 3300046690 Ga0495624_0023555 Ga0495624_0023555_2500_3411 303
185 3300046690 Ga0495624_0037711 Ga0495624_0037711_1612_2523 303
186 3300047317 Ga0495604_0082889 Ga0495604_0082889_1010_1921 303
187 3300047319 Ga0495674_0020309 Ga0495674_0020309_911_1822 303
188 3300047319 Ga0495674_0153746 Ga0495674_0153746_196_1107 303
189 3300047319 Ga0495674_0171500 Ga0495674_0171500_316_1227 303
190 3300047321 Ga0495676_0090825 Ga0495676_0090825_984_1895 303
191 3300047673 Ga0495593_0167330 Ga0495593_0167330_40_951 303
192 3300047673 Ga0495593_0205432 Ga0495593_0205432_14_925 303
193 3300048088 Ga0495602_0019102 Ga0495602_0019102_730_1641 303
194 3300048088 Ga0495602_0199336 Ga0495602_0199336_195_1106 303
195 3300048907 Ga0496104_0618157 Ga0496104_0618157_20_931 303
196 3300049579 Ga0501043_0294624 Ga0501043_0294624_30_989 303
197 3300046506 Ga0495583_0000169 Ga0495583_0000169_4798_5745 304
198 iso_pu_bacteria 2904765812 2904770423 304
199 3300041405 Ga0439438_000149 Ga0439438_000149_6676_7620 305
200 3300041407 Ga0439447_005505 Ga0439447_005505_2862_3806 305
201 3300041411 Ga0439466_0000599 Ga0439466_0000599_7855_8799 305
202 3300049744 Ga0501083_0212178 Ga0501083_0212178_15_935 305
203 3300047443 Ga0495687_052362 Ga0495687_052362_790_1713 306
204 3300049571 Ga0501034_0000106 Ga0501034_0000106_108719_109663 306
205 iso_pu_bacteria 2738541307 2738886480 306
206 3300046477 Ga0495664_0092366 Ga0495664_0092366_648_1658 307
207 3300046501 Ga0495607_0027879 Ga0495607_0027879_646_1635 307
208 3300046524 Ga0495648_0017805 Ga0495648_0017805_862_1824 307
209 3300046543 Ga0495645_0011206 Ga0495645_0011206_1744_2706 307
210 3300046679 Ga0495623_0097496 Ga0495623_0097496_278_1240 307
211 3300046692 Ga0495671_0005199 Ga0495671_0005199_6621_7610 307
212 3300047317 Ga0495604_0009759 Ga0495604_0009759_2896_3906 307
213 3300047319 Ga0495674_0061004 Ga0495674_0061004_1932_2894 307
214 3300047319 Ga0495674_0083746 Ga0495674_0083746_281_1243 307
215 3300047444 Ga0495675_0056095 Ga0495675_0056095_1161_2123 307
216 3300048088 Ga0495602_0206301 Ga0495602_0206301_262_1224 307
217 3300047444 Ga0495675_0086822 Ga0495675_0086822_707_1681 308
218 3300048088 Ga0495602_0137800 Ga0495602_0137800_314_1288 308
219 iso_pu_bacteria 2515154122 2515680584 308
220 iso_pu_bacteria 2515154189 2516021847 308
221 iso_pu_bacteria 2600255067 2600815089 308
222 iso_pu_bacteria 2902682994 2902687683 308
223 iso_pu_bacteria 2902682994 2902688541 308
224 3300005841 Ga0068863_100241341 Ga0068863_1002413412 309
225 iso_pu_bacteria 2511231006 2511267160 309
226 iso_pu_bacteria 2511231015 2511322666 309
227 iso_pu_bacteria 2511231020 2511348964 309
228 iso_pu_bacteria 2554235234 2555257440 309
229 iso_pu_bacteria 2599185169 2599408941 309
230 iso_pu_bacteria 2600255254 2601522542 309
231 iso_pu_bacteria 2600255255 2601527569 309
232 iso_pu_bacteria 2600255280 2601614400 309
233 iso_pu_bacteria 2600255281 2601619120 309
234 iso_pu_bacteria 2600255287 2601642260 309
235 iso_pu_bacteria 2600255288 2601647122 309
236 iso_pu_bacteria 2600255289 2601652547 309
237 iso_pu_bacteria 2600255290 2601657873 309
238 iso_pu_bacteria 2600255291 2601662083 309
239 iso_pu_bacteria 2600255298 2601695041 309
240 iso_pu_bacteria 2600255299 2601699713 309
241 iso_pu_bacteria 2600255300 2601706392 309
242 iso_pu_bacteria 2600255301 2601710698 309
243 iso_pu_bacteria 2600255302 2601715712 309
244 iso_pu_bacteria 2600255303 2601720064 309
245 iso_pu_bacteria 2600255304 2601726118 309
246 iso_pu_bacteria 2600255305 2601730659 309
247 iso_pu_bacteria 2600255306 2601735675 309
248 iso_pu_bacteria 2600255307 2601740943 309
249 iso_pu_bacteria 2600255309 2601750873 309
250 iso_pu_bacteria 2600255392 2602018127 309
251 iso_pu_bacteria 2602042052 2603659445 309
252 iso_pu_bacteria 2602042053 2603664720 309
253 iso_pu_bacteria 2602042103 2603838051 309
254 iso_pu_bacteria 2602042104 2603843129 309
255 iso_pu_bacteria 2602042105 2603848202 309
256 iso_pu_bacteria 2602042106 2603853277 309
257 iso_pu_bacteria 2602042110 2603871328 309
258 iso_pu_bacteria 2602042111 2603876259 309
259 iso_pu_bacteria 2603880178 2606048521 309
260 iso_pu_bacteria 2603880184 2606069147 309
261 iso_pu_bacteria 2603880202 2606144969 309
262 iso_pu_bacteria 2603880211 2606175922 309
263 iso_pu_bacteria 2623620443 2624479892 309
264 iso_pu_bacteria 2636415599 2637224816 309
265 iso_pu_bacteria 2675903046 2676406081 309
266 iso_pu_bacteria 2738541265 2738673133 309
267 iso_pu_bacteria 2738541282 2738751526 309
268 iso_pu_bacteria 2738541303 2738860567 309
269 iso_pu_bacteria 2738543015 2739261352 309
270 iso_pu_bacteria 2775507074 2777022159 309
271 iso_pu_bacteria 2808606418 2809145043 309
272 iso_pu_bacteria 2852103415 2852108235 309
273 iso_pu_bacteria 2884086401 2884088630 309
274 iso_pu_bacteria 2904513164 2904514296 309
275 iso_pu_bacteria 2919108558 2919108636 309
276 iso_pu_bacteria 2939573065 2939575011 309
277 iso_pu_bacteria 2969079654 2969081796 309
278 iso_pu_bacteria 2971820967 2971823204 309
279 iso_pu_bacteria 2984559226 2984564221 309
280 iso_pu_bacteria 2984595703 2984596956 309
281 iso_pu_bacteria 3007803356 3007806809 309
282 iso_pu_bacteria 8002392321 8002395201 309
283 iso_pu_bacteria 8056115690 8056119234 309
284 iso_pu_bacteria 8056172158 8056174151 309
285 iso_pu_bacteria 8057798959 8057801020 309
286 3300037418 Ga0395900_0111360 Ga0395900_0111360_1731_2717 310
287 3300037466 Ga0395898_0019940 Ga0395898_0019940_671_1657 310
288 3300038443 Ga0395901_0000908 Ga0395901_0000908_26352_27338 310
289 3300048926 Ga0496123_0024433 Ga0496123_0024433_3117_4049 310
290 iso_pu_bacteria 2501025504 2501413414 310
291 iso_pu_bacteria 2510917013 2511087674 310
292 iso_pu_bacteria 2510917014 2511101823 310
293 iso_pu_bacteria 2510917015 2511106196 310
294 iso_pu_bacteria 2513237082 2513553549 310
295 iso_pu_bacteria 2513237083 2513559524 310
296 iso_pu_bacteria 2515154189 2516023891 310
297 iso_pu_bacteria 2519103095 2519462295 310
298 iso_pu_bacteria 2582581311 2585295347 310
299 iso_pu_bacteria 2599185239 2599737546 310
300 iso_pu_bacteria 2816332253 2817258037 310
301 iso_pu_bacteria 2816332256 2817281552 310
302 iso_pu_bacteria 2816332286 2817454257 310
303 iso_pu_bacteria 2883087390 2883088250 310
304 iso_pu_bacteria 2895511927 2895513789 310
305 iso_pu_bacteria 8003955200 8003956633 310
306 iso_pu_bacteria 8018845410 8018847197 310
307 iso_pu_bacteria 8020807995 8020811830 310
308 iso_pu_bacteria 8040173305 8040177413 310
309 iso_pu_bacteria 2513237151 2513962112 311
310 iso_pu_bacteria 2513237165 2514045460 311
311 iso_pu_bacteria 2515154122 2515685807 311
312 iso_pu_bacteria 2751185846 2753568357 311
313 iso_pu_bacteria 2856287931 2856291316 311
314 iso_pu_bacteria 2857357740 2857364358 311
315 iso_pu_bacteria 2858688981 2858699059 311
316 iso_pu_bacteria 2885270888 2885276654 311
317 iso_pu_bacteria 2902682994 2902688535 311
318 iso_pu_bacteria 3000376612 3000379102 311
319 iso_pu_bacteria 8055301274 8055307175 311
320 3300006178 Ga0075367_10002955 Ga0075367_100029554 312
321 3300046517 Ga0495630_0004863 Ga0495630_0004863_2034_2981 312
322 3300047444 Ga0495675_0000123 Ga0495675_0000123_24758_25705 312
323 3300050494 nmdc:mga06z11_7758_c1 nmdc:mga06z11_7758_c1_219_1157 312
324 iso_pu_bacteria 2501025502 2501083493 312
325 iso_pu_bacteria 2513237083 2513564655 312
326 iso_pu_bacteria 8003955200 8003961077 312
327 3300031238 Ga0265332_10053502 Ga0265332_100535022 313
328 3300046455 Ga0495603_0000157 Ga0495603_0000157_2887_3831 313
329 3300046459 Ga0495629_0001638 Ga0495629_0001638_13963_14907 313
330 3300046506 Ga0495583_0017806 Ga0495583_0017806_723_1667 313
331 3300046506 Ga0495583_0023862 Ga0495583_0023862_1064_2005 313
332 3300046522 Ga0495643_0042277 Ga0495643_0042277_322_1266 313
333 3300046689 Ga0495613_0001018 Ga0495613_0001018_16695_17639 313
334 3300046694 Ga0495649_0177411 Ga0495649_0177411_57_1001 313
335 3300047318 Ga0495636_0002723 Ga0495636_0002723_2317_3261 313
336 3300047321 Ga0495676_0020139 Ga0495676_0020139_3104_4048 313
337 3300047447 Ga0495685_029591 Ga0495685_029591_331_1275 313
338 3300047673 Ga0495593_0020756 Ga0495593_0020756_100_1044 313
339 3300048089 Ga0495614_0000203 Ga0495614_0000203_3600_4544 313
340 3300048091 Ga0495626_0062267 Ga0495626_0062267_591_1532 313
341 3300048926 Ga0496123_0014785 Ga0496123_0014785_2698_3642 313
342 3300049460 Ga0495682_0000039 Ga0495682_0000039_104824_105783 313
343 iso_pu_bacteria 2885266251 2885267483 313
344 iso_pu_bacteria 2904615490 2904619295 313
345 3300028800 Ga0265338_10009351 Ga0265338_1000935110 315
346 3300046472 Ga0495580_0010092 Ga0495580_0010092_2505_3461 315
347 3300046499 Ga0495594_0009498 Ga0495594_0009498_3080_4036 315
348 3300046526 Ga0495666_0002984 Ga0495666_0002984_2433_3389 315
349 3300046531 Ga0495665_0016906 Ga0495665_0016906_1053_2009 315
350 3300046690 Ga0495624_0126486 Ga0495624_0126486_545_1501 315
351 3300047317 Ga0495604_0003658 Ga0495604_0003658_10750_11706 315
352 3300048088 Ga0495602_0108341 Ga0495602_0108341_1162_2118 315
353 3300048908 Ga0496105_0190340 Ga0496105_0190340_242_1228 315
354 3300003187 JGI25151J46595_10011491 JGI25151J46595_100114914 316
355 3300006038 Ga0075365_10162856 Ga0075365_101628561 316
356 3300025294 Ga0209025_1000341 Ga0209025_100034165 316
357 3300046517 Ga0495630_0112068 Ga0495630_0112068_801_1856 316
358 3300047320 Ga0495672_0060763 Ga0495672_0060763_474_1448 316
359 3300047469 Ga0495673_0001159 Ga0495673_0001159_6659_7609 316
360 3300048088 Ga0495602_0213334 Ga0495602_0213334_106_1161 316
361 3300049460 Ga0495682_0064817 Ga0495682_0064817_308_1258 316
362 3300050492 nmdc:mga0yw44_118352_c1 nmdc:mga0yw44_118352_c1_152_1102 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02900

LigB

Catalytic LigB subunit of aromatic ring-opening dioxygenase

36

334

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bou-assembly1.cif.gz_D three-dimensional structure of ligab 0.8367 4 312
3wku-assembly1.cif.gz_B crystal structure of the anaerobic desb-gallate complex 0.8172 4 316
3wrc-assembly1.cif.gz_A crystal structure of the anaerobic desb-protocatechuate (pca) complex 0.8154 1 313
3wpm-assembly1.cif.gz_A crystal structure of the anaerobic desb-gallate complex by co-crystallization 0.8138 1 314
3wrb-assembly1.cif.gz_A crystal structure of the anaerobic h124f desb-gallate complex 0.7868 1 316
ID Description Score Start End Superfamily
af_P0ABR9_4_309_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9786 5 307 3.40.830.10
af_P0ABR9_4_309_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.966 5 307 3.40.830.10
1bouB00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8387 4 312 3.40.830.10
3wrcA01 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8193 1 313 3.40.830.10
1bouB00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.7777 4 312 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A419ZRH4-F1-model_v4 2,3-dihydroxyphenylpropionate 1,2-dioxygenase 0.9854 1 316 GO:0008198
GO:0051213
AF-A7IDU0-F1-model_v4 2,3-dihydroxyphenylpropionate/2,3-dihydroxicinnamic acid 1,2-dioxygenase (EC 1.13.11.16) (3-carboxyethylcatechol 2,3-dioxygenase) 0.9798 1 312 GO:0008198
GO:0019380
GO:0047070
AF-A0A378BAG3-F1-model_v4 2,3-dihydroxyphenylpropionate/2,3-dihydroxicinnamic acid 1,2-dioxygenase (EC 1.13.11.16) (3-carboxyethylcatechol 2,3-dioxygenase) 0.9792 1 310 GO:0008198
GO:0019380
GO:0047070
AF-A0A1N6XV35-F1-model_v4 2,3-dihydroxyphenylpropionate/2,3-dihydroxicinnamic acid 1,2-dioxygenase (EC 1.13.11.16) (3-carboxyethylcatechol 2,3-dioxygenase) 0.9786 1 311 GO:0008198
GO:0019380
GO:0047070
AF-A0A1Y0BFT6-F1-model_v4 3-carboxyethylcatechol 2,3-dioxygenase (EC 1.13.11.16) 0.9774 1 311 GO:0008198
GO:0019380
GO:0047070

Feature Viewer

pLDDT pTM Quality
91.52 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map