F422702

General Info

Members Datasets Scaffolds Average Seq Length
362 169 362 224

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0117370|Ga0466957_0117370_483_1169
Length 228
Sequence MMRAKPMLWGAAIAIALSSTAAMANVVVVKSLGPSAKAYPPGKTLPSNTKITLQGGDVLTVLGPSSAQTLRGPGNFDASQMSLASASSQRGRFSALRAAEVAHNPSVWDIDVTQSGKVCVANPSKLQLWRPDTTDASSVQISSPDGKTQKLEWAAGKALAAWPTALPIQTGAQYQIEWAETGDKSSLDLVTVSAPADLVGTAQVLIQNGCQNQLDLLVSSASKTGSGQ

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
120 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
121 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
142 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
167 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.07
Metatranscriptomes 1.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.63
Rhizosphere 92.82
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001923 3300001915 Bacteria 5607
2 JGI24740J21852_10000589 3300001979 Bacteria 15669
3 JGI24740J21852_10032811 3300001979 Bacteria 1656
4 JGI24737J22298_10000717 3300001990 Bacteria 11659
5 JGI24737J22298_10007191 3300001990 Bacteria 3766
6 JGI24743J22301_10019866 3300001991 Bacteria 1277
7 JGI24735J21928_10005017 3300002067 Bacteria 4406
8 JGI24735J21928_10011173 3300002067 Bacteria 2852
9 JGI24738J21930_10003360 3300002075 Bacteria 4056
10 rootH2_10242183 3300003320 Bacteria 1985
11 Ga0065715_10162571 3300005293 Unclassified 1615
12 Ga0070658_10000205 3300005327 Bacteria 52211
13 Ga0070658_10049126 3300005327 Bacteria 3417
14 Ga0070658_10083456 3300005327 Bacteria 2626
15 Ga0070658_10108640 3300005327 Bacteria 2296
16 Ga0070658_10363748 3300005327 Bacteria 1239
17 Ga0070676_10215632 3300005328 Bacteria 1265
18 Ga0070676_10253939 3300005328 Unclassified 1174
19 Ga0070683_100002492 3300005329 Bacteria 14662
20 Ga0070683_100066511 3300005329 Bacteria 3357
21 Ga0070666_10000168 3300005335 Bacteria 45111
22 Ga0070666_10122415 3300005335 Bacteria 1804
23 Ga0070680_100003746 3300005336 Bacteria 11362
24 Ga0070680_100033201 3300005336 Bacteria 4158
25 Ga0070680_100037371 3300005336 Bacteria 3923
26 Ga0070680_100735750 3300005336 Unclassified 849
27 Ga0070682_100011208 3300005337 Bacteria 5115
28 Ga0070682_100171628 3300005337 Bacteria 1508
29 Ga0068868_100002054 3300005338 Bacteria 13835
30 Ga0068868_100071906 3300005338 Bacteria 2759
31 Ga0070660_100000009 3300005339 Bacteria 145691
32 Ga0070660_100001509 3300005339 Bacteria 15957
33 Ga0070660_100039562 3300005339 Bacteria 3585
34 Ga0070660_100066742 3300005339 Bacteria 2802
35 Ga0070660_100100670 3300005339 Unclassified 2289
36 Ga0070691_10316393 3300005341 Bacteria 857
37 Ga0070661_100000100 3300005344 Bacteria 70585
38 Ga0070661_100004554 3300005344 Bacteria 9537
39 Ga0070661_100070084 3300005344 Bacteria 2578
40 Ga0070661_100090190 3300005344 Bacteria 2270
41 Ga0070661_100170285 3300005344 Bacteria 1653
42 Ga0070661_100243868 3300005344 Unclassified 1384
43 Ga0070661_100246670 3300005344 Unclassified 1377
44 Ga0070692_10005766 3300005345 Bacteria 5321
45 Ga0070692_10150752 3300005345 Bacteria 1324
46 Ga0070668_100696416 3300005347 Bacteria 896
47 Ga0070669_100241891 3300005353 Bacteria 1434
48 Ga0070671_100003268 3300005355 Bacteria 12653
49 Ga0070671_100027694 3300005355 Bacteria 4666
50 Ga0070671_100036477 3300005355 Bacteria 4077
51 Ga0070671_100245719 3300005355 Unclassified 1519
52 Ga0070671_100275099 3300005355 Bacteria 1431
53 Ga0070673_100024937 3300005364 Bacteria 4393
54 Ga0070673_100075351 3300005364 Bacteria 2721
55 Ga0070673_100143721 3300005364 Bacteria 2015
56 Ga0070673_100148638 3300005364 Bacteria 1982
57 Ga0070673_100711903 3300005364 Bacteria 922
58 Ga0070688_100586940 3300005365 Bacteria 851
59 Ga0070659_100000048 3300005366 Bacteria 98245
60 Ga0070659_100017735 3300005366 Bacteria 5362
61 Ga0070659_100026112 3300005366 Bacteria 4492
62 Ga0070659_100031354 3300005366 Bacteria 4116
63 Ga0070659_100093470 3300005366 Bacteria 2413
64 Ga0070659_100135269 3300005366 Bacteria 2004
65 Ga0070667_100003299 3300005367 Bacteria 13798
66 Ga0070667_100003776 3300005367 Bacteria 12872
67 Ga0070714_100005427 3300005435 Bacteria 9730
68 Ga0070714_100005785 3300005435 Bacteria 9481
69 Ga0070714_100190852 3300005435 Unclassified 1869
70 Ga0070713_100026248 3300005436 Bacteria 4571
71 Ga0070713_100033070 3300005436 Bacteria 4139
72 Ga0070663_100003985 3300005455 Bacteria 8618
73 Ga0070663_100009479 3300005455 Bacteria 6030
74 Ga0070678_100108128 3300005456 Bacteria 2170
75 Ga0070678_100316012 3300005456 Bacteria 1332
76 Ga0070678_100617857 3300005456 Unclassified 969
77 Ga0070662_100000035 3300005457 Bacteria 77342
78 Ga0070662_100006246 3300005457 Bacteria 7674
79 Ga0070662_100100460 3300005457 Bacteria 2189
80 Ga0070662_100149286 3300005457 Unclassified 1818
81 Ga0070662_100342669 3300005457 Bacteria 1223
82 Ga0070662_100581071 3300005457 Bacteria 941
83 Ga0070681_10086088 3300005458 Bacteria 3095
84 Ga0070679_100067129 3300005530 Unclassified 3576
85 Ga0070679_100164690 3300005530 Bacteria 2191
86 Ga0070684_100034504 3300005535 Bacteria 4326
87 Ga0068853_100001248 3300005539 Bacteria 18175
88 Ga0068853_100044091 3300005539 Bacteria 3818
89 Ga0068853_100134039 3300005539 Bacteria 2219
90 Ga0068853_100543871 3300005539 Unclassified 1099
91 Ga0070672_100222193 3300005543 Bacteria 1584
92 Ga0070696_100183274 3300005546 Bacteria 1554
93 Ga0070696_100301114 3300005546 Bacteria 1228
94 Ga0070693_100003192 3300005547 Bacteria 7608
95 Ga0070693_100066300 3300005547 Bacteria 2113
96 Ga0070665_100008493 3300005548 Bacteria 10388
97 Ga0070665_100140271 3300005548 Bacteria 2420
98 Ga0070665_100381689 3300005548 Unclassified 1416
99 Ga0068855_100001487 3300005563 Bacteria 29322
100 Ga0068855_100022719 3300005563 Bacteria 7516
101 Ga0068855_100083532 3300005563 Bacteria 3699
102 Ga0068855_100504855 3300005563 Bacteria 1314
103 Ga0070664_100000025 3300005564 Bacteria 93173
104 Ga0070664_100178265 3300005564 Unclassified 1888
105 Ga0070664_100356564 3300005564 Unclassified 1331
106 Ga0068857_100074968 3300005577 Bacteria 3016
107 Ga0068854_100009160 3300005578 Bacteria 6384
108 Ga0068854_100019115 3300005578 Bacteria 4612
109 Ga0068854_100161568 3300005578 Bacteria 1735
110 Ga0068856_100000124 3300005614 Bacteria 77469
111 Ga0068856_100024186 3300005614 Bacteria 5910
112 Ga0068856_100101544 3300005614 Bacteria 2869
113 Ga0068852_100013177 3300005616 Bacteria 6319
114 Ga0068852_100090579 3300005616 Bacteria 2735
115 Ga0068852_100235166 3300005616 Bacteria 1748
116 Ga0068864_100015927 3300005618 Bacteria 6258
117 Ga0068864_100037788 3300005618 Bacteria 4122
118 Ga0068864_100062062 3300005618 Bacteria 3238
119 Ga0068864_100186813 3300005618 Unclassified 1897
120 Ga0068851_10050683 3300005834 Unclassified 2108
121 Ga0068858_100020174 3300005842 Bacteria 6232
122 Ga0068858_100128157 3300005842 Bacteria 2378
123 Ga0068860_100679816 3300005843 Unclassified 1038
124 Ga0070717_10019960 3300006028 Bacteria 5264
125 Ga0070712_100076491 3300006175 Bacteria 2410
126 Ga0097621_100045720 3300006237 Bacteria 3538
127 Ga0097621_100135322 3300006237 Bacteria 2101
128 Ga0097621_100221949 3300006237 Bacteria 1647
129 Ga0068871_100066679 3300006358 Bacteria 2951
130 Ga0068871_100316022 3300006358 Bacteria 1374
131 Ga0068871_100874855 3300006358 Bacteria 832
132 Ga0068865_100361639 3300006881 Bacteria 1179
133 Ga0105245_10723711 3300009098 Bacteria 1030
134 Ga0105241_10007654 3300009174 Bacteria 7941
135 Ga0105248_10000163 3300009177 Bacteria 77658
136 Ga0105248_10056241 3300009177 Bacteria 4414
137 Ga0105248_10060179 3300009177 Bacteria 4264
138 Ga0105238_10028049 3300009551 Bacteria 5736
139 Ga0105238_10217060 3300009551 Unclassified 1889
140 Ga0157373_10034144 3300013100 Bacteria 3654
141 Ga0157373_10062477 3300013100 Bacteria 2638
142 Ga0157373_10076702 3300013100 Bacteria 2359
143 Ga0157373_10115569 3300013100 Bacteria 1886
144 Ga0157373_10132260 3300013100 Bacteria 1754
145 Ga0157373_10136420 3300013100 Bacteria 1725
146 Ga0157373_10236479 3300013100 Bacteria 1291
147 Ga0157371_10002007 3300013102 Bacteria 20125
148 Ga0157371_10010911 3300013102 Bacteria 7045
149 Ga0157371_10018498 3300013102 Bacteria 5149
150 Ga0157371_10339923 3300013102 Bacteria 1092
151 Ga0157370_10032261 3300013104 Bacteria 5115
152 Ga0157369_10010201 3300013105 Bacteria 10718
153 Ga0157374_10009045 3300013296 Bacteria 8537
154 Ga0157374_10068057 3300013296 Bacteria 3349
155 Ga0157374_10079852 3300013296 Bacteria 3101
156 Ga0163162_10064370 3300013306 Bacteria 3712
157 Ga0157372_10016123 3300013307 Bacteria 8017
158 Ga0163163_10000173 3300014325 Bacteria 67717
159 Ga0157377_10214291 3300014745 Bacteria 1229
160 Ga0157379_10027263 3300014968 Bacteria 5086
161 Ga0197907_10008173 3300020069 Unclassified 1380
162 Ga0206352_10238308 3300020078 Bacteria 788
163 Ga0206354_11142318 3300020081 Bacteria 1476
164 Ga0206353_10044027 3300020082 Bacteria 1758
165 Ga0206353_11786651 3300020082 Bacteria 1512
166 Ga0213876_10010916 3300021384 Bacteria 4864
167 Ga0207673_1013489 3300025290 Bacteria 1073
168 Ga0207697_10065280 3300025315 Unclassified 1519
169 Ga0207656_10040785 3300025321 Bacteria 1969
170 Ga0207680_10296416 3300025903 Unclassified 1126
171 Ga0207647_10070577 3300025904 Bacteria 2110
172 Ga0207645_10011848 3300025907 Bacteria 5936
173 Ga0207645_10176183 3300025907 Bacteria 1402
174 Ga0207705_10000114 3300025909 Bacteria 90132
175 Ga0207705_10001917 3300025909 Bacteria 16248
176 Ga0207705_10003511 3300025909 Bacteria 11939
177 Ga0207705_10026263 3300025909 Bacteria 4154
178 Ga0207705_10049349 3300025909 Bacteria 3029
179 Ga0207705_10054575 3300025909 Bacteria 2880
180 Ga0207705_10090915 3300025909 Bacteria 2235
181 Ga0207705_10235281 3300025909 Bacteria 1394
182 Ga0207705_10439604 3300025909 Bacteria 1011
183 Ga0207705_10741449 3300025909 Unclassified 763
184 Ga0207654_10093294 3300025911 Bacteria 1840
185 Ga0207707_10020600 3300025912 Bacteria 5760
186 Ga0207707_10071318 3300025912 Bacteria 3027
187 Ga0207693_10058924 3300025915 Bacteria 3008
188 Ga0207660_10004684 3300025917 Bacteria 8910
189 Ga0207660_10008547 3300025917 Bacteria 6625
190 Ga0207660_10111021 3300025917 Unclassified 2063
191 Ga0207657_10000071 3300025919 Bacteria 93725
192 Ga0207657_10006910 3300025919 Bacteria 11706
193 Ga0207657_10013044 3300025919 Bacteria 8167
194 Ga0207657_10051586 3300025919 Bacteria 3576
195 Ga0207657_10075695 3300025919 Bacteria 2840
196 Ga0207657_10215898 3300025919 Bacteria 1538
197 Ga0207649_10000301 3300025920 Bacteria 37967
198 Ga0207649_10006077 3300025920 Bacteria 6553
199 Ga0207652_10002862 3300025921 Bacteria 14449
200 Ga0207681_10248195 3300025923 Bacteria 1389
201 Ga0207694_10090357 3300025924 Bacteria 2416
202 Ga0207650_10026326 3300025925 Bacteria 4147
203 Ga0207687_10059845 3300025927 Bacteria 2685
204 Ga0207700_10327928 3300025928 Bacteria 1328
205 Ga0207700_10391774 3300025928 Bacteria 1216
206 Ga0207664_10065961 3300025929 Bacteria 2900
207 Ga0207664_10271972 3300025929 Bacteria 1484
208 Ga0207644_10004781 3300025931 Bacteria 8811
209 Ga0207644_10004978 3300025931 Bacteria 8666
210 Ga0207644_10020504 3300025931 Bacteria 4494
211 Ga0207690_10000045 3300025932 Bacteria 116965
212 Ga0207690_10001260 3300025932 Bacteria 16012
213 Ga0207690_10051667 3300025932 Bacteria 2750
214 Ga0207690_10084859 3300025932 Bacteria 2221
215 Ga0207690_10095172 3300025932 Bacteria 2115
216 Ga0207690_10211070 3300025932 Unclassified 1480
217 Ga0207690_10312045 3300025932 Bacteria 1234
218 Ga0207690_10395258 3300025932 Bacteria 1101
219 Ga0207706_10000086 3300025933 Bacteria 95284
220 Ga0207706_10000655 3300025933 Bacteria 36583
221 Ga0207706_10024453 3300025933 Bacteria 5415
222 Ga0207706_10050453 3300025933 Bacteria 3677
223 Ga0207706_10058870 3300025933 Bacteria 3383
224 Ga0207706_10213488 3300025933 Bacteria 1691
225 Ga0207691_10021409 3300025940 Bacteria 6105
226 Ga0207711_10003283 3300025941 Bacteria 14060
227 Ga0207711_10035421 3300025941 Bacteria 4230
228 Ga0207711_10102370 3300025941 Bacteria 2535
229 Ga0207711_10254033 3300025941 Bacteria 1615
230 Ga0207689_10432184 3300025942 Bacteria 1099
231 Ga0207689_10750062 3300025942 Bacteria 824
232 Ga0207661_10001017 3300025944 Bacteria 18588
233 Ga0207661_10052798 3300025944 Bacteria 3249
234 Ga0207679_10000315 3300025945 Bacteria 36328
235 Ga0207679_10181080 3300025945 Bacteria 1743
236 Ga0207667_10001152 3300025949 Bacteria 33245
237 Ga0207667_10066064 3300025949 Bacteria 3771
238 Ga0207667_10468217 3300025949 Bacteria 1280
239 Ga0207667_11126176 3300025949 Bacteria 767
240 Ga0207651_10407555 3300025960 Bacteria 1158
241 Ga0207651_10550400 3300025960 Unclassified 1003
242 Ga0207640_10027211 3300025981 Bacteria 3482
243 Ga0207640_10286339 3300025981 Bacteria 1297
244 Ga0207658_10020002 3300025986 Bacteria 4633
245 Ga0207658_10035645 3300025986 Bacteria 3565
246 Ga0207658_10075063 3300025986 Bacteria 2571
247 Ga0207677_10306835 3300026023 Bacteria 1313
248 Ga0207703_10050253 3300026035 Bacteria 3374
249 Ga0207639_10000330 3300026041 Bacteria 32864
250 Ga0207639_10005870 3300026041 Bacteria 8319
251 Ga0207639_10011769 3300026041 Bacteria 6085
252 Ga0207639_10113305 3300026041 Bacteria 2215
253 Ga0207639_10243286 3300026041 Bacteria 1565
254 Ga0207678_10000311 3300026067 Bacteria 43860
255 Ga0207678_10000860 3300026067 Bacteria 27872
256 Ga0207678_10002439 3300026067 Bacteria 16899
257 Ga0207678_10016206 3300026067 Bacteria 6540
258 Ga0207702_10000254 3300026078 Bacteria 61680
259 Ga0207641_10309020 3300026088 Unclassified 1496
260 Ga0207648_10128530 3300026089 Bacteria 2229
261 Ga0207676_10064832 3300026095 Unclassified 2907
262 Ga0207676_11251460 3300026095 Bacteria 736
263 Ga0207674_10003121 3300026116 Bacteria 20439
264 Ga0207674_10005100 3300026116 Bacteria 15681
265 Ga0207674_10628419 3300026116 Bacteria 1037
266 Ga0207683_10654398 3300026121 Bacteria 973
267 Ga0207698_10000709 3300026142 Bacteria 19311
268 Ga0207698_10008119 3300026142 Bacteria 6617
269 Ga0207698_10047293 3300026142 Bacteria 3258
270 Ga0207698_10135458 3300026142 Unclassified 2112
271 Ga0207698_11087628 3300026142 Bacteria 812
272 Ga0268266_10009531 3300028379 Bacteria 8546
273 Ga0268266_10118004 3300028379 Bacteria 2358
274 Ga0268266_10506322 3300028379 Unclassified 1153
275 Ga0268266_10541306 3300028379 Bacteria 1115
276 Ga0307409_100635766 3300031995 Unclassified 1059
277 Ga0373930_0017291 3300034816 Bacteria 1373
278 Ga0373928_0018897 3300035084 Bacteria 1433
279 Ga0373960_0022629 3300035121 Bacteria 1685
280 Ga0373931_0000615 3300035691 Bacteria 14756
281 Ga0395899_0196171 3300037312 Unclassified 1410
282 Ga0395900_0164258 3300037418 Bacteria 2263
283 Ga0395900_0249890 3300037418 Bacteria 1775
284 Ga0395900_0858281 3300037418 Unclassified 833
285 Ga0395898_0335018 3300037466 Bacteria 1443
286 Ga0395898_0670666 3300037466 Bacteria 979
287 Ga0395905_0143225 3300037471 Unclassified 2249
288 Ga0395905_0181796 3300037471 Bacteria 1974
289 Ga0395905_0243670 3300037471 Bacteria 1679
290 Ga0395905_0282076 3300037471 Bacteria 1547
291 Ga0395905_0551681 3300037471 Bacteria 1054
292 Ga0395905_0746626 3300037471 Bacteria 881
293 Ga0395901_0196502 3300038443 Bacteria 2115
294 Ga0395901_0216286 3300038443 Bacteria 2004
295 Ga0395901_0529943 3300038443 Bacteria 1196
296 Ga0395901_1131884 3300038443 Bacteria 752
297 Ga0466972_0099061 3300044658 Bacteria 1380
298 Ga0466965_0455549 3300044683 Bacteria 713
299 Ga0466966_0021776 3300044684 Bacteria 4208
300 Ga0466966_0077337 3300044684 Bacteria 2077
301 Ga0466963_0024642 3300044694 Bacteria 3830
302 Ga0466964_0061721 3300044706 Bacteria 1561
303 Ga0466964_0112531 3300044706 Bacteria 1216
304 Ga0466971_0099442 3300044719 Bacteria 1336
305 Ga0466957_0004719 3300044842 Bacteria 7631
306 Ga0466957_0052357 3300044842 Bacteria 2485
307 Ga0466957_0117370 3300044842 Bacteria 1694
308 Ga0466960_0304637 3300044901 Unclassified 899
309 Ga0466959_0055897 3300045049 Bacteria 2880
310 Ga0466959_0223053 3300045049 Bacteria 1307
311 Ga0466958_0008138 3300045836 Bacteria 5804
312 Ga0466958_0084393 3300045836 Bacteria 1959
313 Ga0466958_0364371 3300045836 Unclassified 931
314 Ga0466967_0006738 3300045976 Bacteria 8174
315 Ga0466967_0029374 3300045976 Bacteria 4600
316 Ga0466967_0031955 3300045976 Bacteria 4439
317 Ga0466967_0033123 3300045976 Bacteria 4372
318 Ga0466967_0118704 3300045976 Bacteria 2440
319 Ga0466967_0189016 3300045976 Bacteria 1945
320 Ga0495632_0115140 3300046519 Bacteria 1260
321 Ga0495663_0102202 3300046525 Bacteria 945
322 Ga0495642_0057297 3300046528 Bacteria 1611
323 Ga0495654_0173403 3300046530 Bacteria 939
324 Ga0495621_0095775 3300046539 Bacteria 1124
325 Ga0495668_0039854 3300046616 Bacteria 2622
326 Ga0495625_0542937 3300046660 Bacteria 705
327 Ga0495669_0001528 3300046684 Bacteria 9519
328 Ga0495669_0298315 3300046684 Bacteria 776
329 Ga0495660_0190463 3300046810 Bacteria 986
330 Ga0496100_0240720 3300048903 Bacteria 1335
331 Ga0496101_0043158 3300048904 Bacteria 3222
332 Ga0496101_0057924 3300048904 Bacteria 2804
333 Ga0496104_0101331 3300048907 Bacteria 2757
334 Ga0496105_0129423 3300048908 Unclassified 2082
335 Ga0496106_0538246 3300048909 Unclassified 937
336 Ga0496107_0012723 3300048910 Bacteria 5879
337 Ga0496107_0191920 3300048910 Bacteria 1518
338 Ga0496107_0276898 3300048910 Bacteria 1249
339 Ga0496108_0013785 3300048911 Bacteria 6593
340 Ga0496108_0721354 3300048911 Bacteria 864
341 Ga0496109_0067720 3300048912 Bacteria 3271
342 Ga0496109_0085712 3300048912 Bacteria 2908
343 Ga0496110_0371224 3300048913 Bacteria 1304
344 Ga0496111_0013433 3300048914 Bacteria 5573
345 Ga0496111_0251021 3300048914 Bacteria 1313
346 Ga0496112_0006500 3300048915 Bacteria 10275
347 Ga0496112_0060913 3300048915 Bacteria 3719
348 Ga0496112_0321072 3300048915 Bacteria 1493
349 Ga0496112_0326053 3300048915 Unclassified 1479
350 Ga0496113_0008437 3300048916 Bacteria 6713
351 Ga0496114_0000023 3300048917 Bacteria 219092
352 Ga0496114_0239763 3300048917 Bacteria 1594
353 Ga0496115_0019641 3300048918 Bacteria 5202
354 Ga0501067_0039008 3300049583 Unclassified 2637
355 Ga0501074_0182797 3300049590 Bacteria 1495
356 Ga0501080_0085319 3300049742 Bacteria 2934
357 Ga0501044_0530617 3300049823 Bacteria 1076
358 Ga0495655_0044801 3300053083 Bacteria 1146
359 Ga0587075_036720 3300059644 Unclassified 804
360 Ga0587079_069623 3300059647 Unclassified 782
361 Ga0466962_0036454 3300061719 Bacteria 2354
362 Ga0466962_0102580 3300061719 Bacteria 1374

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048911 Ga0496108_0721354 Ga0496108_0721354_215_817 200
2 3300044683 Ga0466965_0455549 Ga0466965_0455549_13_624 202
3 3300048915 Ga0496112_0060913 Ga0496112_0060913_1258_1869 203
4 3300038443 Ga0395901_1131884 Ga0395901_1131884_43_657 204
5 3300044684 Ga0466966_0077337 Ga0466966_0077337_1195_1809 204
6 3300046660 Ga0495625_0542937 Ga0495625_0542937_24_647 204
7 3300005539 Ga0068853_100543871 Ga0068853_1005438712 208
8 3300005548 Ga0070665_100381689 Ga0070665_1003816892 208
9 3300013102 Ga0157371_10339923 Ga0157371_103399231 208
10 3300025909 Ga0207705_10049349 Ga0207705_100493492 208
11 3300025919 Ga0207657_10215898 Ga0207657_102158982 208
12 3300026041 Ga0207639_10113305 Ga0207639_101133052 208
13 3300028379 Ga0268266_10506322 Ga0268266_105063222 208
14 3300005327 Ga0070658_10083456 Ga0070658_100834562 209
15 3300005344 Ga0070661_100246670 Ga0070661_1002466701 209
16 3300005353 Ga0070669_100241891 Ga0070669_1002418912 209
17 3300005548 Ga0070665_100140271 Ga0070665_1001402713 209
18 3300013100 Ga0157373_10132260 Ga0157373_101322601 209
19 3300025923 Ga0207681_10248195 Ga0207681_102481952 209
20 3300025932 Ga0207690_10395258 Ga0207690_103952582 209
21 3300028379 Ga0268266_10118004 Ga0268266_101180043 209
22 3300037418 Ga0395900_0249890 Ga0395900_0249890_939_1601 210
23 3300037466 Ga0395898_0670666 Ga0395898_0670666_216_878 210
24 3300037471 Ga0395905_0282076 Ga0395905_0282076_77_739 210
25 3300005457 Ga0070662_100149286 Ga0070662_1001492862 213
26 3300025933 Ga0207706_10058870 Ga0207706_100588703 213
27 3300038443 Ga0395901_0529943 Ga0395901_0529943_379_1062 214
28 3300037471 Ga0395905_0551681 Ga0395905_0551681_320_1000 215
29 3300005366 Ga0070659_100000048 Ga0070659_10000004811 216
30 3300006358 Ga0068871_100066679 Ga0068871_1000666792 216
31 3300013296 Ga0157374_10009045 Ga0157374_100090452 216
32 3300025932 Ga0207690_10000045 Ga0207690_1000004512 216
33 3300026035 Ga0207703_10050253 Ga0207703_100502531 216
34 3300048914 Ga0496111_0251021 Ga0496111_0251021_515_1198 216
35 3300021384 Ga0213876_10010916 Ga0213876_100109164 218
36 3300006028 Ga0070717_10019960 Ga0070717_100199603 219
37 3300009551 Ga0105238_10217060 Ga0105238_102170602 219
38 3300013104 Ga0157370_10032261 Ga0157370_100322614 219
39 3300026116 Ga0207674_10005100 Ga0207674_1000510012 219
40 3300037418 Ga0395900_0164258 Ga0395900_0164258_474_1136 219
41 3300037466 Ga0395898_0335018 Ga0395898_0335018_765_1427 219
42 3300037471 Ga0395905_0143225 Ga0395905_0143225_1539_2198 219
43 3300037471 Ga0395905_0181796 Ga0395905_0181796_1124_1786 219
44 3300038443 Ga0395901_0196502 Ga0395901_0196502_858_1517 219
45 3300038443 Ga0395901_0216286 Ga0395901_0216286_1075_1737 219
46 3300013100 Ga0157373_10115569 Ga0157373_101155692 220
47 3300046519 Ga0495632_0115140 Ga0495632_0115140_29_700 220
48 3300046530 Ga0495654_0173403 Ga0495654_0173403_224_895 220
49 3300046684 Ga0495669_0001528 Ga0495669_0001528_3959_4630 220
50 3300046684 Ga0495669_0298315 Ga0495669_0298315_80_751 220
51 3300046810 Ga0495660_0190463 Ga0495660_0190463_236_907 220
52 3300048915 Ga0496112_0321072 Ga0496112_0321072_233_895 220
53 3300053083 Ga0495655_0044801 Ga0495655_0044801_47_718 220
54 3300013102 Ga0157371_10010911 Ga0157371_100109113 221
55 3300013105 Ga0157369_10010201 Ga0157369_100102012 221
56 3300013296 Ga0157374_10079852 Ga0157374_100798522 221
57 3300037418 Ga0395900_0858281 Ga0395900_0858281_153_821 221
58 3300045836 Ga0466958_0364371 Ga0466958_0364371_173_844 221
59 3300046539 Ga0495621_0095775 Ga0495621_0095775_23_688 221
60 3300049583 Ga0501067_0039008 Ga0501067_0039008_200_865 221
61 3300005456 Ga0070678_100617857 Ga0070678_1006178571 223
62 3300025931 Ga0207644_10004978 Ga0207644_100049783 223
63 3300026121 Ga0207683_10654398 Ga0207683_106543982 223
64 3300044719 Ga0466971_0099442 Ga0466971_0099442_520_1197 223
65 3300046616 Ga0495668_0039854 Ga0495668_0039854_412_1086 223
66 3300048904 Ga0496101_0057924 Ga0496101_0057924_1255_1926 223
67 3300048910 Ga0496107_0276898 Ga0496107_0276898_537_1208 223
68 3300048917 Ga0496114_0239763 Ga0496114_0239763_33_704 223
69 3300048918 Ga0496115_0019641 Ga0496115_0019641_2662_3333 223
70 3300059644 Ga0587075_036720 Ga0587075_036720_75_746 223
71 3300059647 Ga0587079_069623 Ga0587079_069623_72_743 223
72 3300061719 Ga0466962_0036454 Ga0466962_0036454_464_1141 223
73 3300001979 JGI24740J21852_10032811 JGI24740J21852_100328112 224
74 3300003320 rootH2_10242183 rootH2_102421832 224
75 3300005327 Ga0070658_10363748 Ga0070658_103637481 224
76 3300005335 Ga0070666_10122415 Ga0070666_101224152 224
77 3300005337 Ga0070682_100171628 Ga0070682_1001716282 224
78 3300005344 Ga0070661_100170285 Ga0070661_1001702851 224
79 3300005344 Ga0070661_100243868 Ga0070661_1002438681 224
80 3300005355 Ga0070671_100275099 Ga0070671_1002750992 224
81 3300005364 Ga0070673_100711903 Ga0070673_1007119032 224
82 3300005366 Ga0070659_100135269 Ga0070659_1001352692 224
83 3300005458 Ga0070681_10086088 Ga0070681_100860883 224
84 3300005564 Ga0070664_100356564 Ga0070664_1003565641 224
85 3300005577 Ga0068857_100074968 Ga0068857_1000749682 224
86 3300005578 Ga0068854_100161568 Ga0068854_1001615682 224
87 3300005616 Ga0068852_100090579 Ga0068852_1000905794 224
88 3300013100 Ga0157373_10034144 Ga0157373_100341442 224
89 3300025907 Ga0207645_10011848 Ga0207645_100118486 224
90 3300025909 Ga0207705_10001917 Ga0207705_1000191714 224
91 3300025909 Ga0207705_10439604 Ga0207705_104396042 224
92 3300025919 Ga0207657_10051586 Ga0207657_100515862 224
93 3300025933 Ga0207706_10024453 Ga0207706_100244534 224
94 3300025942 Ga0207689_10750062 Ga0207689_107500622 224
95 3300025949 Ga0207667_11126176 Ga0207667_111261761 224
96 3300026067 Ga0207678_10002439 Ga0207678_100024396 224
97 3300026089 Ga0207648_10128530 Ga0207648_101285302 224
98 3300026116 Ga0207674_10628419 Ga0207674_106284192 224
99 3300026142 Ga0207698_11087628 Ga0207698_110876282 224
100 3300028379 Ga0268266_10541306 Ga0268266_105413062 224
101 3300037312 Ga0395899_0196171 Ga0395899_0196171_334_1083 224
102 3300001990 JGI24737J22298_10007191 JGI24737J22298_100071913 225
103 3300005327 Ga0070658_10049126 Ga0070658_100491263 225
104 3300005328 Ga0070676_10215632 Ga0070676_102156321 225
105 3300005336 Ga0070680_100037371 Ga0070680_1000373713 225
106 3300005338 Ga0068868_100002054 Ga0068868_1000020547 225
107 3300005338 Ga0068868_100071906 Ga0068868_1000719062 225
108 3300005339 Ga0070660_100001509 Ga0070660_1000015092 225
109 3300005339 Ga0070660_100066742 Ga0070660_1000667423 225
110 3300005344 Ga0070661_100070084 Ga0070661_1000700843 225
111 3300005344 Ga0070661_100090190 Ga0070661_1000901902 225
112 3300005345 Ga0070692_10150752 Ga0070692_101507522 225
113 3300005347 Ga0070668_100696416 Ga0070668_1006964161 225
114 3300005364 Ga0070673_100143721 Ga0070673_1001437211 225
115 3300005364 Ga0070673_100148638 Ga0070673_1001486382 225
116 3300005366 Ga0070659_100017735 Ga0070659_1000177354 225
117 3300005366 Ga0070659_100031354 Ga0070659_1000313544 225
118 3300005366 Ga0070659_100093470 Ga0070659_1000934702 225
119 3300005435 Ga0070714_100005427 Ga0070714_1000054272 225
120 3300005435 Ga0070714_100005785 Ga0070714_1000057858 225
121 3300005435 Ga0070714_100190852 Ga0070714_1001908522 225
122 3300005436 Ga0070713_100026248 Ga0070713_1000262483 225
123 3300005436 Ga0070713_100033070 Ga0070713_1000330704 225
124 3300005455 Ga0070663_100009479 Ga0070663_1000094793 225
125 3300005456 Ga0070678_100108128 Ga0070678_1001081282 225
126 3300005457 Ga0070662_100100460 Ga0070662_1001004602 225
127 3300005530 Ga0070679_100164690 Ga0070679_1001646902 225
128 3300005539 Ga0068853_100044091 Ga0068853_1000440912 225
129 3300005547 Ga0070693_100066300 Ga0070693_1000663003 225
130 3300005614 Ga0068856_100101544 Ga0068856_1001015442 225
131 3300006175 Ga0070712_100076491 Ga0070712_1000764913 225
132 3300006237 Ga0097621_100045720 Ga0097621_1000457202 225
133 3300006237 Ga0097621_100221949 Ga0097621_1002219494 225
134 3300006358 Ga0068871_100316022 Ga0068871_1003160222 225
135 3300006358 Ga0068871_100874855 Ga0068871_1008748552 225
136 3300006881 Ga0068865_100361639 Ga0068865_1003616391 225
137 3300009098 Ga0105245_10723711 Ga0105245_107237112 225
138 3300013100 Ga0157373_10076702 Ga0157373_100767022 225
139 3300025907 Ga0207645_10176183 Ga0207645_101761832 225
140 3300025909 Ga0207705_10026263 Ga0207705_100262631 225
141 3300025915 Ga0207693_10058924 Ga0207693_100589242 225
142 3300025919 Ga0207657_10006910 Ga0207657_100069104 225
143 3300025919 Ga0207657_10075695 Ga0207657_100756953 225
144 3300025925 Ga0207650_10026326 Ga0207650_100263262 225
145 3300025928 Ga0207700_10327928 Ga0207700_103279282 225
146 3300025928 Ga0207700_10391774 Ga0207700_103917741 225
147 3300025929 Ga0207664_10065961 Ga0207664_100659612 225
148 3300025929 Ga0207664_10271972 Ga0207664_102719722 225
149 3300025932 Ga0207690_10084859 Ga0207690_100848592 225
150 3300025932 Ga0207690_10095172 Ga0207690_100951721 225
151 3300025933 Ga0207706_10050453 Ga0207706_100504532 225
152 3300025941 Ga0207711_10102370 Ga0207711_101023702 225
153 3300025942 Ga0207689_10432184 Ga0207689_104321842 225
154 3300025945 Ga0207679_10181080 Ga0207679_101810802 225
155 3300025960 Ga0207651_10407555 Ga0207651_104075552 225
156 3300025986 Ga0207658_10035645 Ga0207658_100356453 225
157 3300026041 Ga0207639_10243286 Ga0207639_102432861 225
158 3300026067 Ga0207678_10016206 Ga0207678_100162063 225
159 3300026095 Ga0207676_11251460 Ga0207676_112514601 225
160 3300031995 Ga0307409_100635766 Ga0307409_1006357662 225
161 3300037471 Ga0395905_0746626 Ga0395905_0746626_159_836 225
162 3300044684 Ga0466966_0021776 Ga0466966_0021776_3364_4047 225
163 3300044694 Ga0466963_0024642 Ga0466963_0024642_2688_3371 225
164 3300044706 Ga0466964_0061721 Ga0466964_0061721_863_1546 225
165 3300044842 Ga0466957_0004719 Ga0466957_0004719_6035_6715 225
166 3300044842 Ga0466957_0117370 Ga0466957_0117370_483_1169 225
167 3300045049 Ga0466959_0055897 Ga0466959_0055897_2013_2696 225
168 3300045049 Ga0466959_0223053 Ga0466959_0223053_606_1283 225
169 3300045836 Ga0466958_0008138 Ga0466958_0008138_1305_1985 225
170 3300045836 Ga0466958_0084393 Ga0466958_0084393_1064_1747 225
171 3300045976 Ga0466967_0006738 Ga0466967_0006738_4127_4807 225
172 3300045976 Ga0466967_0033123 Ga0466967_0033123_673_1356 225
173 3300045976 Ga0466967_0118704 Ga0466967_0118704_355_1041 225
174 3300049590 Ga0501074_0182797 Ga0501074_0182797_394_1074 225
175 3300049742 Ga0501080_0085319 Ga0501080_0085319_1733_2413 225
176 3300049823 Ga0501044_0530617 Ga0501044_0530617_192_872 225
177 3300061719 Ga0466962_0102580 Ga0466962_0102580_87_767 225
178 3300001915 JGI24741J21665_1001923 JGI24741J21665_10019234 226
179 3300001979 JGI24740J21852_10000589 JGI24740J21852_1000058915 226
180 3300001990 JGI24737J22298_10000717 JGI24737J22298_100007178 226
181 3300001991 JGI24743J22301_10019866 JGI24743J22301_100198661 226
182 3300002067 JGI24735J21928_10005017 JGI24735J21928_100050174 226
183 3300002067 JGI24735J21928_10011173 JGI24735J21928_100111732 226
184 3300002075 JGI24738J21930_10003360 JGI24738J21930_100033604 226
185 3300005293 Ga0065715_10162571 Ga0065715_101625711 226
186 3300005327 Ga0070658_10000205 Ga0070658_1000020524 226
187 3300005327 Ga0070658_10108640 Ga0070658_101086402 226
188 3300005328 Ga0070676_10253939 Ga0070676_102539391 226
189 3300005329 Ga0070683_100002492 Ga0070683_1000024926 226
190 3300005329 Ga0070683_100066511 Ga0070683_1000665114 226
191 3300005335 Ga0070666_10000168 Ga0070666_100001687 226
192 3300005336 Ga0070680_100003746 Ga0070680_1000037463 226
193 3300005336 Ga0070680_100033201 Ga0070680_1000332014 226
194 3300005336 Ga0070680_100735750 Ga0070680_1007357501 226
195 3300005337 Ga0070682_100011208 Ga0070682_1000112084 226
196 3300005339 Ga0070660_100000009 Ga0070660_10000000941 226
197 3300005339 Ga0070660_100039562 Ga0070660_1000395623 226
198 3300005339 Ga0070660_100100670 Ga0070660_1001006703 226
199 3300005341 Ga0070691_10316393 Ga0070691_103163931 226
200 3300005344 Ga0070661_100000100 Ga0070661_10000010041 226
201 3300005344 Ga0070661_100004554 Ga0070661_1000045544 226
202 3300005345 Ga0070692_10005766 Ga0070692_100057664 226
203 3300005355 Ga0070671_100003268 Ga0070671_1000032686 226
204 3300005355 Ga0070671_100027694 Ga0070671_1000276944 226
205 3300005355 Ga0070671_100036477 Ga0070671_1000364772 226
206 3300005355 Ga0070671_100245719 Ga0070671_1002457192 226
207 3300005364 Ga0070673_100024937 Ga0070673_1000249373 226
208 3300005364 Ga0070673_100075351 Ga0070673_1000753512 226
209 3300005365 Ga0070688_100586940 Ga0070688_1005869402 226
210 3300005366 Ga0070659_100026112 Ga0070659_1000261123 226
211 3300005367 Ga0070667_100003299 Ga0070667_10000329914 226
212 3300005367 Ga0070667_100003776 Ga0070667_10000377611 226
213 3300005455 Ga0070663_100003985 Ga0070663_1000039854 226
214 3300005456 Ga0070678_100316012 Ga0070678_1003160122 226
215 3300005457 Ga0070662_100000035 Ga0070662_10000003532 226
216 3300005457 Ga0070662_100006246 Ga0070662_1000062463 226
217 3300005457 Ga0070662_100342669 Ga0070662_1003426692 226
218 3300005457 Ga0070662_100581071 Ga0070662_1005810711 226
219 3300005530 Ga0070679_100067129 Ga0070679_1000671294 226
220 3300005535 Ga0070684_100034504 Ga0070684_1000345044 226
221 3300005539 Ga0068853_100001248 Ga0068853_1000012487 226
222 3300005539 Ga0068853_100134039 Ga0068853_1001340392 226
223 3300005543 Ga0070672_100222193 Ga0070672_1002221932 226
224 3300005546 Ga0070696_100183274 Ga0070696_1001832742 226
225 3300005546 Ga0070696_100301114 Ga0070696_1003011142 226
226 3300005547 Ga0070693_100003192 Ga0070693_1000031923 226
227 3300005548 Ga0070665_100008493 Ga0070665_1000084935 226
228 3300005563 Ga0068855_100001487 Ga0068855_10000148713 226
229 3300005563 Ga0068855_100022719 Ga0068855_1000227195 226
230 3300005563 Ga0068855_100083532 Ga0068855_1000835323 226
231 3300005563 Ga0068855_100504855 Ga0068855_1005048552 226
232 3300005564 Ga0070664_100000025 Ga0070664_10000002562 226
233 3300005564 Ga0070664_100178265 Ga0070664_1001782652 226
234 3300005578 Ga0068854_100009160 Ga0068854_1000091604 226
235 3300005578 Ga0068854_100019115 Ga0068854_1000191152 226
236 3300005614 Ga0068856_100000124 Ga0068856_10000012474 226
237 3300005614 Ga0068856_100024186 Ga0068856_1000241863 226
238 3300005616 Ga0068852_100013177 Ga0068852_1000131773 226
239 3300005616 Ga0068852_100235166 Ga0068852_1002351662 226
240 3300005618 Ga0068864_100015927 Ga0068864_1000159272 226
241 3300005618 Ga0068864_100037788 Ga0068864_1000377883 226
242 3300005618 Ga0068864_100062062 Ga0068864_1000620622 226
243 3300005618 Ga0068864_100186813 Ga0068864_1001868132 226
244 3300005834 Ga0068851_10050683 Ga0068851_100506832 226
245 3300005842 Ga0068858_100020174 Ga0068858_1000201744 226
246 3300005842 Ga0068858_100128157 Ga0068858_1001281572 226
247 3300005843 Ga0068860_100679816 Ga0068860_1006798162 226
248 3300006237 Ga0097621_100135322 Ga0097621_1001353222 226
249 3300009174 Ga0105241_10007654 Ga0105241_100076544 226
250 3300009177 Ga0105248_10000163 Ga0105248_1000016341 226
251 3300009177 Ga0105248_10056241 Ga0105248_100562412 226
252 3300009177 Ga0105248_10060179 Ga0105248_100601794 226
253 3300009551 Ga0105238_10028049 Ga0105238_100280492 226
254 3300013100 Ga0157373_10062477 Ga0157373_100624773 226
255 3300013100 Ga0157373_10136420 Ga0157373_101364202 226
256 3300013100 Ga0157373_10236479 Ga0157373_102364791 226
257 3300013102 Ga0157371_10002007 Ga0157371_100020076 226
258 3300013102 Ga0157371_10018498 Ga0157371_100184984 226
259 3300013296 Ga0157374_10068057 Ga0157374_100680572 226
260 3300013306 Ga0163162_10064370 Ga0163162_100643704 226
261 3300013307 Ga0157372_10016123 Ga0157372_100161236 226
262 3300014325 Ga0163163_10000173 Ga0163163_1000017341 226
263 3300014745 Ga0157377_10214291 Ga0157377_102142912 226
264 3300014968 Ga0157379_10027263 Ga0157379_100272632 226
265 3300020069 Ga0197907_10008173 Ga0197907_100081732 226
266 3300020078 Ga0206352_10238308 Ga0206352_102383081 226
267 3300020081 Ga0206354_11142318 Ga0206354_111423182 226
268 3300020082 Ga0206353_10044027 Ga0206353_100440272 226
269 3300020082 Ga0206353_11786651 Ga0206353_117866512 226
270 3300025290 Ga0207673_1013489 Ga0207673_10134891 226
271 3300025315 Ga0207697_10065280 Ga0207697_100652802 226
272 3300025321 Ga0207656_10040785 Ga0207656_100407851 226
273 3300025903 Ga0207680_10296416 Ga0207680_102964162 226
274 3300025904 Ga0207647_10070577 Ga0207647_100705772 226
275 3300025909 Ga0207705_10000114 Ga0207705_1000011429 226
276 3300025909 Ga0207705_10003511 Ga0207705_100035112 226
277 3300025909 Ga0207705_10054575 Ga0207705_100545752 226
278 3300025909 Ga0207705_10090915 Ga0207705_100909152 226
279 3300025909 Ga0207705_10235281 Ga0207705_102352812 226
280 3300025909 Ga0207705_10741449 Ga0207705_107414491 226
281 3300025911 Ga0207654_10093294 Ga0207654_100932943 226
282 3300025912 Ga0207707_10020600 Ga0207707_100206003 226
283 3300025912 Ga0207707_10071318 Ga0207707_100713182 226
284 3300025917 Ga0207660_10004684 Ga0207660_100046845 226
285 3300025917 Ga0207660_10008547 Ga0207660_100085473 226
286 3300025917 Ga0207660_10111021 Ga0207660_101110212 226
287 3300025919 Ga0207657_10000071 Ga0207657_1000007161 226
288 3300025919 Ga0207657_10013044 Ga0207657_100130444 226
289 3300025920 Ga0207649_10000301 Ga0207649_1000030134 226
290 3300025920 Ga0207649_10006077 Ga0207649_100060775 226
291 3300025921 Ga0207652_10002862 Ga0207652_1000286213 226
292 3300025924 Ga0207694_10090357 Ga0207694_100903572 226
293 3300025927 Ga0207687_10059845 Ga0207687_100598452 226
294 3300025931 Ga0207644_10004781 Ga0207644_100047818 226
295 3300025931 Ga0207644_10020504 Ga0207644_100205042 226
296 3300025932 Ga0207690_10001260 Ga0207690_1000126016 226
297 3300025932 Ga0207690_10051667 Ga0207690_100516672 226
298 3300025932 Ga0207690_10211070 Ga0207690_102110702 226
299 3300025932 Ga0207690_10312045 Ga0207690_103120452 226
300 3300025933 Ga0207706_10000086 Ga0207706_1000008641 226
301 3300025933 Ga0207706_10000655 Ga0207706_100006556 226
302 3300025933 Ga0207706_10213488 Ga0207706_102134882 226
303 3300025940 Ga0207691_10021409 Ga0207691_100214093 226
304 3300025941 Ga0207711_10003283 Ga0207711_1000328313 226
305 3300025941 Ga0207711_10035421 Ga0207711_100354213 226
306 3300025941 Ga0207711_10254033 Ga0207711_102540332 226
307 3300025944 Ga0207661_10001017 Ga0207661_100010173 226
308 3300025944 Ga0207661_10052798 Ga0207661_100527984 226
309 3300025945 Ga0207679_10000315 Ga0207679_1000031513 226
310 3300025949 Ga0207667_10001152 Ga0207667_1000115213 226
311 3300025949 Ga0207667_10066064 Ga0207667_100660641 226
312 3300025949 Ga0207667_10468217 Ga0207667_104682172 226
313 3300025960 Ga0207651_10550400 Ga0207651_105504002 226
314 3300025981 Ga0207640_10027211 Ga0207640_100272113 226
315 3300025981 Ga0207640_10286339 Ga0207640_102863392 226
316 3300025986 Ga0207658_10020002 Ga0207658_100200024 226
317 3300025986 Ga0207658_10075063 Ga0207658_100750633 226
318 3300026023 Ga0207677_10306835 Ga0207677_103068352 226
319 3300026041 Ga0207639_10000330 Ga0207639_1000033015 226
320 3300026041 Ga0207639_10005870 Ga0207639_100058704 226
321 3300026041 Ga0207639_10011769 Ga0207639_100117692 226
322 3300026067 Ga0207678_10000311 Ga0207678_1000031121 226
323 3300026067 Ga0207678_10000860 Ga0207678_1000086024 226
324 3300026078 Ga0207702_10000254 Ga0207702_1000025458 226
325 3300026088 Ga0207641_10309020 Ga0207641_103090202 226
326 3300026095 Ga0207676_10064832 Ga0207676_100648322 226
327 3300026116 Ga0207674_10003121 Ga0207674_1000312116 226
328 3300026142 Ga0207698_10000709 Ga0207698_1000070910 226
329 3300026142 Ga0207698_10008119 Ga0207698_100081193 226
330 3300026142 Ga0207698_10047293 Ga0207698_100472932 226
331 3300026142 Ga0207698_10135458 Ga0207698_101354582 226
332 3300028379 Ga0268266_10009531 Ga0268266_100095318 226
333 3300034816 Ga0373930_0017291 Ga0373930_0017291_82_765 226
334 3300035084 Ga0373928_0018897 Ga0373928_0018897_629_1312 226
335 3300035121 Ga0373960_0022629 Ga0373960_0022629_743_1426 226
336 3300035691 Ga0373931_0000615 Ga0373931_0000615_5179_5862 226
337 3300037471 Ga0395905_0243670 Ga0395905_0243670_562_1245 226
338 3300044658 Ga0466972_0099061 Ga0466972_0099061_469_1149 226
339 3300044706 Ga0466964_0112531 Ga0466964_0112531_354_1034 226
340 3300044842 Ga0466957_0052357 Ga0466957_0052357_52_732 226
341 3300044901 Ga0466960_0304637 Ga0466960_0304637_89_775 226
342 3300045976 Ga0466967_0029374 Ga0466967_0029374_3832_4515 226
343 3300045976 Ga0466967_0031955 Ga0466967_0031955_582_1265 226
344 3300045976 Ga0466967_0189016 Ga0466967_0189016_78_758 226
345 3300046525 Ga0495663_0102202 Ga0495663_0102202_94_774 226
346 3300046528 Ga0495642_0057297 Ga0495642_0057297_405_1085 226
347 3300048903 Ga0496100_0240720 Ga0496100_0240720_173_853 226
348 3300048904 Ga0496101_0043158 Ga0496101_0043158_793_1476 226
349 3300048907 Ga0496104_0101331 Ga0496104_0101331_829_1512 226
350 3300048908 Ga0496105_0129423 Ga0496105_0129423_1137_1820 226
351 3300048909 Ga0496106_0538246 Ga0496106_0538246_137_817 226
352 3300048910 Ga0496107_0012723 Ga0496107_0012723_985_1665 226
353 3300048910 Ga0496107_0191920 Ga0496107_0191920_102_788 226
354 3300048911 Ga0496108_0013785 Ga0496108_0013785_1721_2404 226
355 3300048912 Ga0496109_0067720 Ga0496109_0067720_2012_2695 226
356 3300048912 Ga0496109_0085712 Ga0496109_0085712_1621_2301 226
357 3300048913 Ga0496110_0371224 Ga0496110_0371224_558_1241 226
358 3300048914 Ga0496111_0013433 Ga0496111_0013433_1179_1862 226
359 3300048915 Ga0496112_0006500 Ga0496112_0006500_4204_4884 226
360 3300048915 Ga0496112_0326053 Ga0496112_0326053_472_1155 226
361 3300048916 Ga0496113_0008437 Ga0496113_0008437_490_1173 226
362 3300048917 Ga0496114_0000023 Ga0496114_0000023_34172_34855 226

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f4n-assembly1.cif.gz_B crystal structure of protein mj1651 from methanococcus jannaschii dsm 2661, pfam duf62 0.7814 131 151
2f4n-assembly1.cif.gz_C crystal structure of protein mj1651 from methanococcus jannaschii dsm 2661, pfam duf62 0.7475 130 151
6m7c-assembly1.cif.gz_A crystal structure of c-terminal fragment of pilus adhesin spac from lactobacillus rhamnosus gg 0.7382 136 189
2yn3-assembly3.cif.gz_D structural insight into the giant calcium-binding adhesin siie: implications for the adhesion of salmonella enterica to polarized epithelial cells 0.7174 136 189
4s3r-assembly1.cif.gz_A amylomaltase malq from escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose 0.7074 113 190
ID Description Score Start End Superfamily
af_P13475_13_104_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7254 108 188 3.40.50.720
af_P15977_1_137_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7112 116 191 2.60.40.10
af_G5ECX2_917_1013_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7082 135 191 2.60.40.10
af_O50419_75_527_3.30.1490.100 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;DNA polymerase, Y-family, little finger domain 0.7054 132 153 3.30.1490.100
3pjyA00 Mainly Beta;Sandwich;Jelly Rolls;Protein of unknown function DUF192 0.6802 131 151 2.60.120.1140
ID Description Score Start End GO Terms
AF-A0A259GYR1-F1-model_v4 Uncharacterized protein 0.9394 106 224
AF-A0A0Q5VB22-F1-model_v4 SRPBCC family protein 0.8628 108 219
AF-A0A1W9WA74-F1-model_v4 Uncharacterized protein 0.8539 104 217
AF-A0A7V8RFB2-F1-model_v4 Uncharacterized protein 0.8034 23 224
AF-A0A090AHX7-F1-model_v4 Secreted protein 0.8026 106 219

Feature Viewer

pLDDT pTM Quality
77.55 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map