F422702
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 362 | 169 | 362 | 224 |
Family's Representative Sequence
| Representative Sequence | 3300044842|Ga0466957_0117370|Ga0466957_0117370_483_1169 |
| Length | 228 |
| Sequence | MMRAKPMLWGAAIAIALSSTAAMANVVVVKSLGPSAKAYPPGKTLPSNTKITLQGGDVLTVLGPSSAQTLRGPGNFDASQMSLASASSQRGRFSALRAAEVAHNPSVWDIDVTQSGKVCVANPSKLQLWRPDTTDASSVQISSPDGKTQKLEWAAGKALAAWPTALPIQTGAQYQIEWAETGDKSSLDLVTVSAPADLVGTAQVLIQNGCQNQLDLLVSSASKTGSGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 74 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 119 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 120 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 121 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 122 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 123 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 124 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 125 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 128 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 129 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 130 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 131 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 132 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 133 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 134 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 135 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 136 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 137 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 138 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 139 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 151 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 152 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 153 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 154 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 157 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 158 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 159 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 160 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 161 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 162 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.07 |
| Metatranscriptomes | 1.93 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.63 |
| Rhizosphere | 92.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1001923 | 3300001915 | Bacteria | 5607 |
| 2 | JGI24740J21852_10000589 | 3300001979 | Bacteria | 15669 |
| 3 | JGI24740J21852_10032811 | 3300001979 | Bacteria | 1656 |
| 4 | JGI24737J22298_10000717 | 3300001990 | Bacteria | 11659 |
| 5 | JGI24737J22298_10007191 | 3300001990 | Bacteria | 3766 |
| 6 | JGI24743J22301_10019866 | 3300001991 | Bacteria | 1277 |
| 7 | JGI24735J21928_10005017 | 3300002067 | Bacteria | 4406 |
| 8 | JGI24735J21928_10011173 | 3300002067 | Bacteria | 2852 |
| 9 | JGI24738J21930_10003360 | 3300002075 | Bacteria | 4056 |
| 10 | rootH2_10242183 | 3300003320 | Bacteria | 1985 |
| 11 | Ga0065715_10162571 | 3300005293 | Unclassified | 1615 |
| 12 | Ga0070658_10000205 | 3300005327 | Bacteria | 52211 |
| 13 | Ga0070658_10049126 | 3300005327 | Bacteria | 3417 |
| 14 | Ga0070658_10083456 | 3300005327 | Bacteria | 2626 |
| 15 | Ga0070658_10108640 | 3300005327 | Bacteria | 2296 |
| 16 | Ga0070658_10363748 | 3300005327 | Bacteria | 1239 |
| 17 | Ga0070676_10215632 | 3300005328 | Bacteria | 1265 |
| 18 | Ga0070676_10253939 | 3300005328 | Unclassified | 1174 |
| 19 | Ga0070683_100002492 | 3300005329 | Bacteria | 14662 |
| 20 | Ga0070683_100066511 | 3300005329 | Bacteria | 3357 |
| 21 | Ga0070666_10000168 | 3300005335 | Bacteria | 45111 |
| 22 | Ga0070666_10122415 | 3300005335 | Bacteria | 1804 |
| 23 | Ga0070680_100003746 | 3300005336 | Bacteria | 11362 |
| 24 | Ga0070680_100033201 | 3300005336 | Bacteria | 4158 |
| 25 | Ga0070680_100037371 | 3300005336 | Bacteria | 3923 |
| 26 | Ga0070680_100735750 | 3300005336 | Unclassified | 849 |
| 27 | Ga0070682_100011208 | 3300005337 | Bacteria | 5115 |
| 28 | Ga0070682_100171628 | 3300005337 | Bacteria | 1508 |
| 29 | Ga0068868_100002054 | 3300005338 | Bacteria | 13835 |
| 30 | Ga0068868_100071906 | 3300005338 | Bacteria | 2759 |
| 31 | Ga0070660_100000009 | 3300005339 | Bacteria | 145691 |
| 32 | Ga0070660_100001509 | 3300005339 | Bacteria | 15957 |
| 33 | Ga0070660_100039562 | 3300005339 | Bacteria | 3585 |
| 34 | Ga0070660_100066742 | 3300005339 | Bacteria | 2802 |
| 35 | Ga0070660_100100670 | 3300005339 | Unclassified | 2289 |
| 36 | Ga0070691_10316393 | 3300005341 | Bacteria | 857 |
| 37 | Ga0070661_100000100 | 3300005344 | Bacteria | 70585 |
| 38 | Ga0070661_100004554 | 3300005344 | Bacteria | 9537 |
| 39 | Ga0070661_100070084 | 3300005344 | Bacteria | 2578 |
| 40 | Ga0070661_100090190 | 3300005344 | Bacteria | 2270 |
| 41 | Ga0070661_100170285 | 3300005344 | Bacteria | 1653 |
| 42 | Ga0070661_100243868 | 3300005344 | Unclassified | 1384 |
| 43 | Ga0070661_100246670 | 3300005344 | Unclassified | 1377 |
| 44 | Ga0070692_10005766 | 3300005345 | Bacteria | 5321 |
| 45 | Ga0070692_10150752 | 3300005345 | Bacteria | 1324 |
| 46 | Ga0070668_100696416 | 3300005347 | Bacteria | 896 |
| 47 | Ga0070669_100241891 | 3300005353 | Bacteria | 1434 |
| 48 | Ga0070671_100003268 | 3300005355 | Bacteria | 12653 |
| 49 | Ga0070671_100027694 | 3300005355 | Bacteria | 4666 |
| 50 | Ga0070671_100036477 | 3300005355 | Bacteria | 4077 |
| 51 | Ga0070671_100245719 | 3300005355 | Unclassified | 1519 |
| 52 | Ga0070671_100275099 | 3300005355 | Bacteria | 1431 |
| 53 | Ga0070673_100024937 | 3300005364 | Bacteria | 4393 |
| 54 | Ga0070673_100075351 | 3300005364 | Bacteria | 2721 |
| 55 | Ga0070673_100143721 | 3300005364 | Bacteria | 2015 |
| 56 | Ga0070673_100148638 | 3300005364 | Bacteria | 1982 |
| 57 | Ga0070673_100711903 | 3300005364 | Bacteria | 922 |
| 58 | Ga0070688_100586940 | 3300005365 | Bacteria | 851 |
| 59 | Ga0070659_100000048 | 3300005366 | Bacteria | 98245 |
| 60 | Ga0070659_100017735 | 3300005366 | Bacteria | 5362 |
| 61 | Ga0070659_100026112 | 3300005366 | Bacteria | 4492 |
| 62 | Ga0070659_100031354 | 3300005366 | Bacteria | 4116 |
| 63 | Ga0070659_100093470 | 3300005366 | Bacteria | 2413 |
| 64 | Ga0070659_100135269 | 3300005366 | Bacteria | 2004 |
| 65 | Ga0070667_100003299 | 3300005367 | Bacteria | 13798 |
| 66 | Ga0070667_100003776 | 3300005367 | Bacteria | 12872 |
| 67 | Ga0070714_100005427 | 3300005435 | Bacteria | 9730 |
| 68 | Ga0070714_100005785 | 3300005435 | Bacteria | 9481 |
| 69 | Ga0070714_100190852 | 3300005435 | Unclassified | 1869 |
| 70 | Ga0070713_100026248 | 3300005436 | Bacteria | 4571 |
| 71 | Ga0070713_100033070 | 3300005436 | Bacteria | 4139 |
| 72 | Ga0070663_100003985 | 3300005455 | Bacteria | 8618 |
| 73 | Ga0070663_100009479 | 3300005455 | Bacteria | 6030 |
| 74 | Ga0070678_100108128 | 3300005456 | Bacteria | 2170 |
| 75 | Ga0070678_100316012 | 3300005456 | Bacteria | 1332 |
| 76 | Ga0070678_100617857 | 3300005456 | Unclassified | 969 |
| 77 | Ga0070662_100000035 | 3300005457 | Bacteria | 77342 |
| 78 | Ga0070662_100006246 | 3300005457 | Bacteria | 7674 |
| 79 | Ga0070662_100100460 | 3300005457 | Bacteria | 2189 |
| 80 | Ga0070662_100149286 | 3300005457 | Unclassified | 1818 |
| 81 | Ga0070662_100342669 | 3300005457 | Bacteria | 1223 |
| 82 | Ga0070662_100581071 | 3300005457 | Bacteria | 941 |
| 83 | Ga0070681_10086088 | 3300005458 | Bacteria | 3095 |
| 84 | Ga0070679_100067129 | 3300005530 | Unclassified | 3576 |
| 85 | Ga0070679_100164690 | 3300005530 | Bacteria | 2191 |
| 86 | Ga0070684_100034504 | 3300005535 | Bacteria | 4326 |
| 87 | Ga0068853_100001248 | 3300005539 | Bacteria | 18175 |
| 88 | Ga0068853_100044091 | 3300005539 | Bacteria | 3818 |
| 89 | Ga0068853_100134039 | 3300005539 | Bacteria | 2219 |
| 90 | Ga0068853_100543871 | 3300005539 | Unclassified | 1099 |
| 91 | Ga0070672_100222193 | 3300005543 | Bacteria | 1584 |
| 92 | Ga0070696_100183274 | 3300005546 | Bacteria | 1554 |
| 93 | Ga0070696_100301114 | 3300005546 | Bacteria | 1228 |
| 94 | Ga0070693_100003192 | 3300005547 | Bacteria | 7608 |
| 95 | Ga0070693_100066300 | 3300005547 | Bacteria | 2113 |
| 96 | Ga0070665_100008493 | 3300005548 | Bacteria | 10388 |
| 97 | Ga0070665_100140271 | 3300005548 | Bacteria | 2420 |
| 98 | Ga0070665_100381689 | 3300005548 | Unclassified | 1416 |
| 99 | Ga0068855_100001487 | 3300005563 | Bacteria | 29322 |
| 100 | Ga0068855_100022719 | 3300005563 | Bacteria | 7516 |
| 101 | Ga0068855_100083532 | 3300005563 | Bacteria | 3699 |
| 102 | Ga0068855_100504855 | 3300005563 | Bacteria | 1314 |
| 103 | Ga0070664_100000025 | 3300005564 | Bacteria | 93173 |
| 104 | Ga0070664_100178265 | 3300005564 | Unclassified | 1888 |
| 105 | Ga0070664_100356564 | 3300005564 | Unclassified | 1331 |
| 106 | Ga0068857_100074968 | 3300005577 | Bacteria | 3016 |
| 107 | Ga0068854_100009160 | 3300005578 | Bacteria | 6384 |
| 108 | Ga0068854_100019115 | 3300005578 | Bacteria | 4612 |
| 109 | Ga0068854_100161568 | 3300005578 | Bacteria | 1735 |
| 110 | Ga0068856_100000124 | 3300005614 | Bacteria | 77469 |
| 111 | Ga0068856_100024186 | 3300005614 | Bacteria | 5910 |
| 112 | Ga0068856_100101544 | 3300005614 | Bacteria | 2869 |
| 113 | Ga0068852_100013177 | 3300005616 | Bacteria | 6319 |
| 114 | Ga0068852_100090579 | 3300005616 | Bacteria | 2735 |
| 115 | Ga0068852_100235166 | 3300005616 | Bacteria | 1748 |
| 116 | Ga0068864_100015927 | 3300005618 | Bacteria | 6258 |
| 117 | Ga0068864_100037788 | 3300005618 | Bacteria | 4122 |
| 118 | Ga0068864_100062062 | 3300005618 | Bacteria | 3238 |
| 119 | Ga0068864_100186813 | 3300005618 | Unclassified | 1897 |
| 120 | Ga0068851_10050683 | 3300005834 | Unclassified | 2108 |
| 121 | Ga0068858_100020174 | 3300005842 | Bacteria | 6232 |
| 122 | Ga0068858_100128157 | 3300005842 | Bacteria | 2378 |
| 123 | Ga0068860_100679816 | 3300005843 | Unclassified | 1038 |
| 124 | Ga0070717_10019960 | 3300006028 | Bacteria | 5264 |
| 125 | Ga0070712_100076491 | 3300006175 | Bacteria | 2410 |
| 126 | Ga0097621_100045720 | 3300006237 | Bacteria | 3538 |
| 127 | Ga0097621_100135322 | 3300006237 | Bacteria | 2101 |
| 128 | Ga0097621_100221949 | 3300006237 | Bacteria | 1647 |
| 129 | Ga0068871_100066679 | 3300006358 | Bacteria | 2951 |
| 130 | Ga0068871_100316022 | 3300006358 | Bacteria | 1374 |
| 131 | Ga0068871_100874855 | 3300006358 | Bacteria | 832 |
| 132 | Ga0068865_100361639 | 3300006881 | Bacteria | 1179 |
| 133 | Ga0105245_10723711 | 3300009098 | Bacteria | 1030 |
| 134 | Ga0105241_10007654 | 3300009174 | Bacteria | 7941 |
| 135 | Ga0105248_10000163 | 3300009177 | Bacteria | 77658 |
| 136 | Ga0105248_10056241 | 3300009177 | Bacteria | 4414 |
| 137 | Ga0105248_10060179 | 3300009177 | Bacteria | 4264 |
| 138 | Ga0105238_10028049 | 3300009551 | Bacteria | 5736 |
| 139 | Ga0105238_10217060 | 3300009551 | Unclassified | 1889 |
| 140 | Ga0157373_10034144 | 3300013100 | Bacteria | 3654 |
| 141 | Ga0157373_10062477 | 3300013100 | Bacteria | 2638 |
| 142 | Ga0157373_10076702 | 3300013100 | Bacteria | 2359 |
| 143 | Ga0157373_10115569 | 3300013100 | Bacteria | 1886 |
| 144 | Ga0157373_10132260 | 3300013100 | Bacteria | 1754 |
| 145 | Ga0157373_10136420 | 3300013100 | Bacteria | 1725 |
| 146 | Ga0157373_10236479 | 3300013100 | Bacteria | 1291 |
| 147 | Ga0157371_10002007 | 3300013102 | Bacteria | 20125 |
| 148 | Ga0157371_10010911 | 3300013102 | Bacteria | 7045 |
| 149 | Ga0157371_10018498 | 3300013102 | Bacteria | 5149 |
| 150 | Ga0157371_10339923 | 3300013102 | Bacteria | 1092 |
| 151 | Ga0157370_10032261 | 3300013104 | Bacteria | 5115 |
| 152 | Ga0157369_10010201 | 3300013105 | Bacteria | 10718 |
| 153 | Ga0157374_10009045 | 3300013296 | Bacteria | 8537 |
| 154 | Ga0157374_10068057 | 3300013296 | Bacteria | 3349 |
| 155 | Ga0157374_10079852 | 3300013296 | Bacteria | 3101 |
| 156 | Ga0163162_10064370 | 3300013306 | Bacteria | 3712 |
| 157 | Ga0157372_10016123 | 3300013307 | Bacteria | 8017 |
| 158 | Ga0163163_10000173 | 3300014325 | Bacteria | 67717 |
| 159 | Ga0157377_10214291 | 3300014745 | Bacteria | 1229 |
| 160 | Ga0157379_10027263 | 3300014968 | Bacteria | 5086 |
| 161 | Ga0197907_10008173 | 3300020069 | Unclassified | 1380 |
| 162 | Ga0206352_10238308 | 3300020078 | Bacteria | 788 |
| 163 | Ga0206354_11142318 | 3300020081 | Bacteria | 1476 |
| 164 | Ga0206353_10044027 | 3300020082 | Bacteria | 1758 |
| 165 | Ga0206353_11786651 | 3300020082 | Bacteria | 1512 |
| 166 | Ga0213876_10010916 | 3300021384 | Bacteria | 4864 |
| 167 | Ga0207673_1013489 | 3300025290 | Bacteria | 1073 |
| 168 | Ga0207697_10065280 | 3300025315 | Unclassified | 1519 |
| 169 | Ga0207656_10040785 | 3300025321 | Bacteria | 1969 |
| 170 | Ga0207680_10296416 | 3300025903 | Unclassified | 1126 |
| 171 | Ga0207647_10070577 | 3300025904 | Bacteria | 2110 |
| 172 | Ga0207645_10011848 | 3300025907 | Bacteria | 5936 |
| 173 | Ga0207645_10176183 | 3300025907 | Bacteria | 1402 |
| 174 | Ga0207705_10000114 | 3300025909 | Bacteria | 90132 |
| 175 | Ga0207705_10001917 | 3300025909 | Bacteria | 16248 |
| 176 | Ga0207705_10003511 | 3300025909 | Bacteria | 11939 |
| 177 | Ga0207705_10026263 | 3300025909 | Bacteria | 4154 |
| 178 | Ga0207705_10049349 | 3300025909 | Bacteria | 3029 |
| 179 | Ga0207705_10054575 | 3300025909 | Bacteria | 2880 |
| 180 | Ga0207705_10090915 | 3300025909 | Bacteria | 2235 |
| 181 | Ga0207705_10235281 | 3300025909 | Bacteria | 1394 |
| 182 | Ga0207705_10439604 | 3300025909 | Bacteria | 1011 |
| 183 | Ga0207705_10741449 | 3300025909 | Unclassified | 763 |
| 184 | Ga0207654_10093294 | 3300025911 | Bacteria | 1840 |
| 185 | Ga0207707_10020600 | 3300025912 | Bacteria | 5760 |
| 186 | Ga0207707_10071318 | 3300025912 | Bacteria | 3027 |
| 187 | Ga0207693_10058924 | 3300025915 | Bacteria | 3008 |
| 188 | Ga0207660_10004684 | 3300025917 | Bacteria | 8910 |
| 189 | Ga0207660_10008547 | 3300025917 | Bacteria | 6625 |
| 190 | Ga0207660_10111021 | 3300025917 | Unclassified | 2063 |
| 191 | Ga0207657_10000071 | 3300025919 | Bacteria | 93725 |
| 192 | Ga0207657_10006910 | 3300025919 | Bacteria | 11706 |
| 193 | Ga0207657_10013044 | 3300025919 | Bacteria | 8167 |
| 194 | Ga0207657_10051586 | 3300025919 | Bacteria | 3576 |
| 195 | Ga0207657_10075695 | 3300025919 | Bacteria | 2840 |
| 196 | Ga0207657_10215898 | 3300025919 | Bacteria | 1538 |
| 197 | Ga0207649_10000301 | 3300025920 | Bacteria | 37967 |
| 198 | Ga0207649_10006077 | 3300025920 | Bacteria | 6553 |
| 199 | Ga0207652_10002862 | 3300025921 | Bacteria | 14449 |
| 200 | Ga0207681_10248195 | 3300025923 | Bacteria | 1389 |
| 201 | Ga0207694_10090357 | 3300025924 | Bacteria | 2416 |
| 202 | Ga0207650_10026326 | 3300025925 | Bacteria | 4147 |
| 203 | Ga0207687_10059845 | 3300025927 | Bacteria | 2685 |
| 204 | Ga0207700_10327928 | 3300025928 | Bacteria | 1328 |
| 205 | Ga0207700_10391774 | 3300025928 | Bacteria | 1216 |
| 206 | Ga0207664_10065961 | 3300025929 | Bacteria | 2900 |
| 207 | Ga0207664_10271972 | 3300025929 | Bacteria | 1484 |
| 208 | Ga0207644_10004781 | 3300025931 | Bacteria | 8811 |
| 209 | Ga0207644_10004978 | 3300025931 | Bacteria | 8666 |
| 210 | Ga0207644_10020504 | 3300025931 | Bacteria | 4494 |
| 211 | Ga0207690_10000045 | 3300025932 | Bacteria | 116965 |
| 212 | Ga0207690_10001260 | 3300025932 | Bacteria | 16012 |
| 213 | Ga0207690_10051667 | 3300025932 | Bacteria | 2750 |
| 214 | Ga0207690_10084859 | 3300025932 | Bacteria | 2221 |
| 215 | Ga0207690_10095172 | 3300025932 | Bacteria | 2115 |
| 216 | Ga0207690_10211070 | 3300025932 | Unclassified | 1480 |
| 217 | Ga0207690_10312045 | 3300025932 | Bacteria | 1234 |
| 218 | Ga0207690_10395258 | 3300025932 | Bacteria | 1101 |
| 219 | Ga0207706_10000086 | 3300025933 | Bacteria | 95284 |
| 220 | Ga0207706_10000655 | 3300025933 | Bacteria | 36583 |
| 221 | Ga0207706_10024453 | 3300025933 | Bacteria | 5415 |
| 222 | Ga0207706_10050453 | 3300025933 | Bacteria | 3677 |
| 223 | Ga0207706_10058870 | 3300025933 | Bacteria | 3383 |
| 224 | Ga0207706_10213488 | 3300025933 | Bacteria | 1691 |
| 225 | Ga0207691_10021409 | 3300025940 | Bacteria | 6105 |
| 226 | Ga0207711_10003283 | 3300025941 | Bacteria | 14060 |
| 227 | Ga0207711_10035421 | 3300025941 | Bacteria | 4230 |
| 228 | Ga0207711_10102370 | 3300025941 | Bacteria | 2535 |
| 229 | Ga0207711_10254033 | 3300025941 | Bacteria | 1615 |
| 230 | Ga0207689_10432184 | 3300025942 | Bacteria | 1099 |
| 231 | Ga0207689_10750062 | 3300025942 | Bacteria | 824 |
| 232 | Ga0207661_10001017 | 3300025944 | Bacteria | 18588 |
| 233 | Ga0207661_10052798 | 3300025944 | Bacteria | 3249 |
| 234 | Ga0207679_10000315 | 3300025945 | Bacteria | 36328 |
| 235 | Ga0207679_10181080 | 3300025945 | Bacteria | 1743 |
| 236 | Ga0207667_10001152 | 3300025949 | Bacteria | 33245 |
| 237 | Ga0207667_10066064 | 3300025949 | Bacteria | 3771 |
| 238 | Ga0207667_10468217 | 3300025949 | Bacteria | 1280 |
| 239 | Ga0207667_11126176 | 3300025949 | Bacteria | 767 |
| 240 | Ga0207651_10407555 | 3300025960 | Bacteria | 1158 |
| 241 | Ga0207651_10550400 | 3300025960 | Unclassified | 1003 |
| 242 | Ga0207640_10027211 | 3300025981 | Bacteria | 3482 |
| 243 | Ga0207640_10286339 | 3300025981 | Bacteria | 1297 |
| 244 | Ga0207658_10020002 | 3300025986 | Bacteria | 4633 |
| 245 | Ga0207658_10035645 | 3300025986 | Bacteria | 3565 |
| 246 | Ga0207658_10075063 | 3300025986 | Bacteria | 2571 |
| 247 | Ga0207677_10306835 | 3300026023 | Bacteria | 1313 |
| 248 | Ga0207703_10050253 | 3300026035 | Bacteria | 3374 |
| 249 | Ga0207639_10000330 | 3300026041 | Bacteria | 32864 |
| 250 | Ga0207639_10005870 | 3300026041 | Bacteria | 8319 |
| 251 | Ga0207639_10011769 | 3300026041 | Bacteria | 6085 |
| 252 | Ga0207639_10113305 | 3300026041 | Bacteria | 2215 |
| 253 | Ga0207639_10243286 | 3300026041 | Bacteria | 1565 |
| 254 | Ga0207678_10000311 | 3300026067 | Bacteria | 43860 |
| 255 | Ga0207678_10000860 | 3300026067 | Bacteria | 27872 |
| 256 | Ga0207678_10002439 | 3300026067 | Bacteria | 16899 |
| 257 | Ga0207678_10016206 | 3300026067 | Bacteria | 6540 |
| 258 | Ga0207702_10000254 | 3300026078 | Bacteria | 61680 |
| 259 | Ga0207641_10309020 | 3300026088 | Unclassified | 1496 |
| 260 | Ga0207648_10128530 | 3300026089 | Bacteria | 2229 |
| 261 | Ga0207676_10064832 | 3300026095 | Unclassified | 2907 |
| 262 | Ga0207676_11251460 | 3300026095 | Bacteria | 736 |
| 263 | Ga0207674_10003121 | 3300026116 | Bacteria | 20439 |
| 264 | Ga0207674_10005100 | 3300026116 | Bacteria | 15681 |
| 265 | Ga0207674_10628419 | 3300026116 | Bacteria | 1037 |
| 266 | Ga0207683_10654398 | 3300026121 | Bacteria | 973 |
| 267 | Ga0207698_10000709 | 3300026142 | Bacteria | 19311 |
| 268 | Ga0207698_10008119 | 3300026142 | Bacteria | 6617 |
| 269 | Ga0207698_10047293 | 3300026142 | Bacteria | 3258 |
| 270 | Ga0207698_10135458 | 3300026142 | Unclassified | 2112 |
| 271 | Ga0207698_11087628 | 3300026142 | Bacteria | 812 |
| 272 | Ga0268266_10009531 | 3300028379 | Bacteria | 8546 |
| 273 | Ga0268266_10118004 | 3300028379 | Bacteria | 2358 |
| 274 | Ga0268266_10506322 | 3300028379 | Unclassified | 1153 |
| 275 | Ga0268266_10541306 | 3300028379 | Bacteria | 1115 |
| 276 | Ga0307409_100635766 | 3300031995 | Unclassified | 1059 |
| 277 | Ga0373930_0017291 | 3300034816 | Bacteria | 1373 |
| 278 | Ga0373928_0018897 | 3300035084 | Bacteria | 1433 |
| 279 | Ga0373960_0022629 | 3300035121 | Bacteria | 1685 |
| 280 | Ga0373931_0000615 | 3300035691 | Bacteria | 14756 |
| 281 | Ga0395899_0196171 | 3300037312 | Unclassified | 1410 |
| 282 | Ga0395900_0164258 | 3300037418 | Bacteria | 2263 |
| 283 | Ga0395900_0249890 | 3300037418 | Bacteria | 1775 |
| 284 | Ga0395900_0858281 | 3300037418 | Unclassified | 833 |
| 285 | Ga0395898_0335018 | 3300037466 | Bacteria | 1443 |
| 286 | Ga0395898_0670666 | 3300037466 | Bacteria | 979 |
| 287 | Ga0395905_0143225 | 3300037471 | Unclassified | 2249 |
| 288 | Ga0395905_0181796 | 3300037471 | Bacteria | 1974 |
| 289 | Ga0395905_0243670 | 3300037471 | Bacteria | 1679 |
| 290 | Ga0395905_0282076 | 3300037471 | Bacteria | 1547 |
| 291 | Ga0395905_0551681 | 3300037471 | Bacteria | 1054 |
| 292 | Ga0395905_0746626 | 3300037471 | Bacteria | 881 |
| 293 | Ga0395901_0196502 | 3300038443 | Bacteria | 2115 |
| 294 | Ga0395901_0216286 | 3300038443 | Bacteria | 2004 |
| 295 | Ga0395901_0529943 | 3300038443 | Bacteria | 1196 |
| 296 | Ga0395901_1131884 | 3300038443 | Bacteria | 752 |
| 297 | Ga0466972_0099061 | 3300044658 | Bacteria | 1380 |
| 298 | Ga0466965_0455549 | 3300044683 | Bacteria | 713 |
| 299 | Ga0466966_0021776 | 3300044684 | Bacteria | 4208 |
| 300 | Ga0466966_0077337 | 3300044684 | Bacteria | 2077 |
| 301 | Ga0466963_0024642 | 3300044694 | Bacteria | 3830 |
| 302 | Ga0466964_0061721 | 3300044706 | Bacteria | 1561 |
| 303 | Ga0466964_0112531 | 3300044706 | Bacteria | 1216 |
| 304 | Ga0466971_0099442 | 3300044719 | Bacteria | 1336 |
| 305 | Ga0466957_0004719 | 3300044842 | Bacteria | 7631 |
| 306 | Ga0466957_0052357 | 3300044842 | Bacteria | 2485 |
| 307 | Ga0466957_0117370 | 3300044842 | Bacteria | 1694 |
| 308 | Ga0466960_0304637 | 3300044901 | Unclassified | 899 |
| 309 | Ga0466959_0055897 | 3300045049 | Bacteria | 2880 |
| 310 | Ga0466959_0223053 | 3300045049 | Bacteria | 1307 |
| 311 | Ga0466958_0008138 | 3300045836 | Bacteria | 5804 |
| 312 | Ga0466958_0084393 | 3300045836 | Bacteria | 1959 |
| 313 | Ga0466958_0364371 | 3300045836 | Unclassified | 931 |
| 314 | Ga0466967_0006738 | 3300045976 | Bacteria | 8174 |
| 315 | Ga0466967_0029374 | 3300045976 | Bacteria | 4600 |
| 316 | Ga0466967_0031955 | 3300045976 | Bacteria | 4439 |
| 317 | Ga0466967_0033123 | 3300045976 | Bacteria | 4372 |
| 318 | Ga0466967_0118704 | 3300045976 | Bacteria | 2440 |
| 319 | Ga0466967_0189016 | 3300045976 | Bacteria | 1945 |
| 320 | Ga0495632_0115140 | 3300046519 | Bacteria | 1260 |
| 321 | Ga0495663_0102202 | 3300046525 | Bacteria | 945 |
| 322 | Ga0495642_0057297 | 3300046528 | Bacteria | 1611 |
| 323 | Ga0495654_0173403 | 3300046530 | Bacteria | 939 |
| 324 | Ga0495621_0095775 | 3300046539 | Bacteria | 1124 |
| 325 | Ga0495668_0039854 | 3300046616 | Bacteria | 2622 |
| 326 | Ga0495625_0542937 | 3300046660 | Bacteria | 705 |
| 327 | Ga0495669_0001528 | 3300046684 | Bacteria | 9519 |
| 328 | Ga0495669_0298315 | 3300046684 | Bacteria | 776 |
| 329 | Ga0495660_0190463 | 3300046810 | Bacteria | 986 |
| 330 | Ga0496100_0240720 | 3300048903 | Bacteria | 1335 |
| 331 | Ga0496101_0043158 | 3300048904 | Bacteria | 3222 |
| 332 | Ga0496101_0057924 | 3300048904 | Bacteria | 2804 |
| 333 | Ga0496104_0101331 | 3300048907 | Bacteria | 2757 |
| 334 | Ga0496105_0129423 | 3300048908 | Unclassified | 2082 |
| 335 | Ga0496106_0538246 | 3300048909 | Unclassified | 937 |
| 336 | Ga0496107_0012723 | 3300048910 | Bacteria | 5879 |
| 337 | Ga0496107_0191920 | 3300048910 | Bacteria | 1518 |
| 338 | Ga0496107_0276898 | 3300048910 | Bacteria | 1249 |
| 339 | Ga0496108_0013785 | 3300048911 | Bacteria | 6593 |
| 340 | Ga0496108_0721354 | 3300048911 | Bacteria | 864 |
| 341 | Ga0496109_0067720 | 3300048912 | Bacteria | 3271 |
| 342 | Ga0496109_0085712 | 3300048912 | Bacteria | 2908 |
| 343 | Ga0496110_0371224 | 3300048913 | Bacteria | 1304 |
| 344 | Ga0496111_0013433 | 3300048914 | Bacteria | 5573 |
| 345 | Ga0496111_0251021 | 3300048914 | Bacteria | 1313 |
| 346 | Ga0496112_0006500 | 3300048915 | Bacteria | 10275 |
| 347 | Ga0496112_0060913 | 3300048915 | Bacteria | 3719 |
| 348 | Ga0496112_0321072 | 3300048915 | Bacteria | 1493 |
| 349 | Ga0496112_0326053 | 3300048915 | Unclassified | 1479 |
| 350 | Ga0496113_0008437 | 3300048916 | Bacteria | 6713 |
| 351 | Ga0496114_0000023 | 3300048917 | Bacteria | 219092 |
| 352 | Ga0496114_0239763 | 3300048917 | Bacteria | 1594 |
| 353 | Ga0496115_0019641 | 3300048918 | Bacteria | 5202 |
| 354 | Ga0501067_0039008 | 3300049583 | Unclassified | 2637 |
| 355 | Ga0501074_0182797 | 3300049590 | Bacteria | 1495 |
| 356 | Ga0501080_0085319 | 3300049742 | Bacteria | 2934 |
| 357 | Ga0501044_0530617 | 3300049823 | Bacteria | 1076 |
| 358 | Ga0495655_0044801 | 3300053083 | Bacteria | 1146 |
| 359 | Ga0587075_036720 | 3300059644 | Unclassified | 804 |
| 360 | Ga0587079_069623 | 3300059647 | Unclassified | 782 |
| 361 | Ga0466962_0036454 | 3300061719 | Bacteria | 2354 |
| 362 | Ga0466962_0102580 | 3300061719 | Bacteria | 1374 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048911 | Ga0496108_0721354 | Ga0496108_0721354_215_817 | 200 |
| 2 | 3300044683 | Ga0466965_0455549 | Ga0466965_0455549_13_624 | 202 |
| 3 | 3300048915 | Ga0496112_0060913 | Ga0496112_0060913_1258_1869 | 203 |
| 4 | 3300038443 | Ga0395901_1131884 | Ga0395901_1131884_43_657 | 204 |
| 5 | 3300044684 | Ga0466966_0077337 | Ga0466966_0077337_1195_1809 | 204 |
| 6 | 3300046660 | Ga0495625_0542937 | Ga0495625_0542937_24_647 | 204 |
| 7 | 3300005539 | Ga0068853_100543871 | Ga0068853_1005438712 | 208 |
| 8 | 3300005548 | Ga0070665_100381689 | Ga0070665_1003816892 | 208 |
| 9 | 3300013102 | Ga0157371_10339923 | Ga0157371_103399231 | 208 |
| 10 | 3300025909 | Ga0207705_10049349 | Ga0207705_100493492 | 208 |
| 11 | 3300025919 | Ga0207657_10215898 | Ga0207657_102158982 | 208 |
| 12 | 3300026041 | Ga0207639_10113305 | Ga0207639_101133052 | 208 |
| 13 | 3300028379 | Ga0268266_10506322 | Ga0268266_105063222 | 208 |
| 14 | 3300005327 | Ga0070658_10083456 | Ga0070658_100834562 | 209 |
| 15 | 3300005344 | Ga0070661_100246670 | Ga0070661_1002466701 | 209 |
| 16 | 3300005353 | Ga0070669_100241891 | Ga0070669_1002418912 | 209 |
| 17 | 3300005548 | Ga0070665_100140271 | Ga0070665_1001402713 | 209 |
| 18 | 3300013100 | Ga0157373_10132260 | Ga0157373_101322601 | 209 |
| 19 | 3300025923 | Ga0207681_10248195 | Ga0207681_102481952 | 209 |
| 20 | 3300025932 | Ga0207690_10395258 | Ga0207690_103952582 | 209 |
| 21 | 3300028379 | Ga0268266_10118004 | Ga0268266_101180043 | 209 |
| 22 | 3300037418 | Ga0395900_0249890 | Ga0395900_0249890_939_1601 | 210 |
| 23 | 3300037466 | Ga0395898_0670666 | Ga0395898_0670666_216_878 | 210 |
| 24 | 3300037471 | Ga0395905_0282076 | Ga0395905_0282076_77_739 | 210 |
| 25 | 3300005457 | Ga0070662_100149286 | Ga0070662_1001492862 | 213 |
| 26 | 3300025933 | Ga0207706_10058870 | Ga0207706_100588703 | 213 |
| 27 | 3300038443 | Ga0395901_0529943 | Ga0395901_0529943_379_1062 | 214 |
| 28 | 3300037471 | Ga0395905_0551681 | Ga0395905_0551681_320_1000 | 215 |
| 29 | 3300005366 | Ga0070659_100000048 | Ga0070659_10000004811 | 216 |
| 30 | 3300006358 | Ga0068871_100066679 | Ga0068871_1000666792 | 216 |
| 31 | 3300013296 | Ga0157374_10009045 | Ga0157374_100090452 | 216 |
| 32 | 3300025932 | Ga0207690_10000045 | Ga0207690_1000004512 | 216 |
| 33 | 3300026035 | Ga0207703_10050253 | Ga0207703_100502531 | 216 |
| 34 | 3300048914 | Ga0496111_0251021 | Ga0496111_0251021_515_1198 | 216 |
| 35 | 3300021384 | Ga0213876_10010916 | Ga0213876_100109164 | 218 |
| 36 | 3300006028 | Ga0070717_10019960 | Ga0070717_100199603 | 219 |
| 37 | 3300009551 | Ga0105238_10217060 | Ga0105238_102170602 | 219 |
| 38 | 3300013104 | Ga0157370_10032261 | Ga0157370_100322614 | 219 |
| 39 | 3300026116 | Ga0207674_10005100 | Ga0207674_1000510012 | 219 |
| 40 | 3300037418 | Ga0395900_0164258 | Ga0395900_0164258_474_1136 | 219 |
| 41 | 3300037466 | Ga0395898_0335018 | Ga0395898_0335018_765_1427 | 219 |
| 42 | 3300037471 | Ga0395905_0143225 | Ga0395905_0143225_1539_2198 | 219 |
| 43 | 3300037471 | Ga0395905_0181796 | Ga0395905_0181796_1124_1786 | 219 |
| 44 | 3300038443 | Ga0395901_0196502 | Ga0395901_0196502_858_1517 | 219 |
| 45 | 3300038443 | Ga0395901_0216286 | Ga0395901_0216286_1075_1737 | 219 |
| 46 | 3300013100 | Ga0157373_10115569 | Ga0157373_101155692 | 220 |
| 47 | 3300046519 | Ga0495632_0115140 | Ga0495632_0115140_29_700 | 220 |
| 48 | 3300046530 | Ga0495654_0173403 | Ga0495654_0173403_224_895 | 220 |
| 49 | 3300046684 | Ga0495669_0001528 | Ga0495669_0001528_3959_4630 | 220 |
| 50 | 3300046684 | Ga0495669_0298315 | Ga0495669_0298315_80_751 | 220 |
| 51 | 3300046810 | Ga0495660_0190463 | Ga0495660_0190463_236_907 | 220 |
| 52 | 3300048915 | Ga0496112_0321072 | Ga0496112_0321072_233_895 | 220 |
| 53 | 3300053083 | Ga0495655_0044801 | Ga0495655_0044801_47_718 | 220 |
| 54 | 3300013102 | Ga0157371_10010911 | Ga0157371_100109113 | 221 |
| 55 | 3300013105 | Ga0157369_10010201 | Ga0157369_100102012 | 221 |
| 56 | 3300013296 | Ga0157374_10079852 | Ga0157374_100798522 | 221 |
| 57 | 3300037418 | Ga0395900_0858281 | Ga0395900_0858281_153_821 | 221 |
| 58 | 3300045836 | Ga0466958_0364371 | Ga0466958_0364371_173_844 | 221 |
| 59 | 3300046539 | Ga0495621_0095775 | Ga0495621_0095775_23_688 | 221 |
| 60 | 3300049583 | Ga0501067_0039008 | Ga0501067_0039008_200_865 | 221 |
| 61 | 3300005456 | Ga0070678_100617857 | Ga0070678_1006178571 | 223 |
| 62 | 3300025931 | Ga0207644_10004978 | Ga0207644_100049783 | 223 |
| 63 | 3300026121 | Ga0207683_10654398 | Ga0207683_106543982 | 223 |
| 64 | 3300044719 | Ga0466971_0099442 | Ga0466971_0099442_520_1197 | 223 |
| 65 | 3300046616 | Ga0495668_0039854 | Ga0495668_0039854_412_1086 | 223 |
| 66 | 3300048904 | Ga0496101_0057924 | Ga0496101_0057924_1255_1926 | 223 |
| 67 | 3300048910 | Ga0496107_0276898 | Ga0496107_0276898_537_1208 | 223 |
| 68 | 3300048917 | Ga0496114_0239763 | Ga0496114_0239763_33_704 | 223 |
| 69 | 3300048918 | Ga0496115_0019641 | Ga0496115_0019641_2662_3333 | 223 |
| 70 | 3300059644 | Ga0587075_036720 | Ga0587075_036720_75_746 | 223 |
| 71 | 3300059647 | Ga0587079_069623 | Ga0587079_069623_72_743 | 223 |
| 72 | 3300061719 | Ga0466962_0036454 | Ga0466962_0036454_464_1141 | 223 |
| 73 | 3300001979 | JGI24740J21852_10032811 | JGI24740J21852_100328112 | 224 |
| 74 | 3300003320 | rootH2_10242183 | rootH2_102421832 | 224 |
| 75 | 3300005327 | Ga0070658_10363748 | Ga0070658_103637481 | 224 |
| 76 | 3300005335 | Ga0070666_10122415 | Ga0070666_101224152 | 224 |
| 77 | 3300005337 | Ga0070682_100171628 | Ga0070682_1001716282 | 224 |
| 78 | 3300005344 | Ga0070661_100170285 | Ga0070661_1001702851 | 224 |
| 79 | 3300005344 | Ga0070661_100243868 | Ga0070661_1002438681 | 224 |
| 80 | 3300005355 | Ga0070671_100275099 | Ga0070671_1002750992 | 224 |
| 81 | 3300005364 | Ga0070673_100711903 | Ga0070673_1007119032 | 224 |
| 82 | 3300005366 | Ga0070659_100135269 | Ga0070659_1001352692 | 224 |
| 83 | 3300005458 | Ga0070681_10086088 | Ga0070681_100860883 | 224 |
| 84 | 3300005564 | Ga0070664_100356564 | Ga0070664_1003565641 | 224 |
| 85 | 3300005577 | Ga0068857_100074968 | Ga0068857_1000749682 | 224 |
| 86 | 3300005578 | Ga0068854_100161568 | Ga0068854_1001615682 | 224 |
| 87 | 3300005616 | Ga0068852_100090579 | Ga0068852_1000905794 | 224 |
| 88 | 3300013100 | Ga0157373_10034144 | Ga0157373_100341442 | 224 |
| 89 | 3300025907 | Ga0207645_10011848 | Ga0207645_100118486 | 224 |
| 90 | 3300025909 | Ga0207705_10001917 | Ga0207705_1000191714 | 224 |
| 91 | 3300025909 | Ga0207705_10439604 | Ga0207705_104396042 | 224 |
| 92 | 3300025919 | Ga0207657_10051586 | Ga0207657_100515862 | 224 |
| 93 | 3300025933 | Ga0207706_10024453 | Ga0207706_100244534 | 224 |
| 94 | 3300025942 | Ga0207689_10750062 | Ga0207689_107500622 | 224 |
| 95 | 3300025949 | Ga0207667_11126176 | Ga0207667_111261761 | 224 |
| 96 | 3300026067 | Ga0207678_10002439 | Ga0207678_100024396 | 224 |
| 97 | 3300026089 | Ga0207648_10128530 | Ga0207648_101285302 | 224 |
| 98 | 3300026116 | Ga0207674_10628419 | Ga0207674_106284192 | 224 |
| 99 | 3300026142 | Ga0207698_11087628 | Ga0207698_110876282 | 224 |
| 100 | 3300028379 | Ga0268266_10541306 | Ga0268266_105413062 | 224 |
| 101 | 3300037312 | Ga0395899_0196171 | Ga0395899_0196171_334_1083 | 224 |
| 102 | 3300001990 | JGI24737J22298_10007191 | JGI24737J22298_100071913 | 225 |
| 103 | 3300005327 | Ga0070658_10049126 | Ga0070658_100491263 | 225 |
| 104 | 3300005328 | Ga0070676_10215632 | Ga0070676_102156321 | 225 |
| 105 | 3300005336 | Ga0070680_100037371 | Ga0070680_1000373713 | 225 |
| 106 | 3300005338 | Ga0068868_100002054 | Ga0068868_1000020547 | 225 |
| 107 | 3300005338 | Ga0068868_100071906 | Ga0068868_1000719062 | 225 |
| 108 | 3300005339 | Ga0070660_100001509 | Ga0070660_1000015092 | 225 |
| 109 | 3300005339 | Ga0070660_100066742 | Ga0070660_1000667423 | 225 |
| 110 | 3300005344 | Ga0070661_100070084 | Ga0070661_1000700843 | 225 |
| 111 | 3300005344 | Ga0070661_100090190 | Ga0070661_1000901902 | 225 |
| 112 | 3300005345 | Ga0070692_10150752 | Ga0070692_101507522 | 225 |
| 113 | 3300005347 | Ga0070668_100696416 | Ga0070668_1006964161 | 225 |
| 114 | 3300005364 | Ga0070673_100143721 | Ga0070673_1001437211 | 225 |
| 115 | 3300005364 | Ga0070673_100148638 | Ga0070673_1001486382 | 225 |
| 116 | 3300005366 | Ga0070659_100017735 | Ga0070659_1000177354 | 225 |
| 117 | 3300005366 | Ga0070659_100031354 | Ga0070659_1000313544 | 225 |
| 118 | 3300005366 | Ga0070659_100093470 | Ga0070659_1000934702 | 225 |
| 119 | 3300005435 | Ga0070714_100005427 | Ga0070714_1000054272 | 225 |
| 120 | 3300005435 | Ga0070714_100005785 | Ga0070714_1000057858 | 225 |
| 121 | 3300005435 | Ga0070714_100190852 | Ga0070714_1001908522 | 225 |
| 122 | 3300005436 | Ga0070713_100026248 | Ga0070713_1000262483 | 225 |
| 123 | 3300005436 | Ga0070713_100033070 | Ga0070713_1000330704 | 225 |
| 124 | 3300005455 | Ga0070663_100009479 | Ga0070663_1000094793 | 225 |
| 125 | 3300005456 | Ga0070678_100108128 | Ga0070678_1001081282 | 225 |
| 126 | 3300005457 | Ga0070662_100100460 | Ga0070662_1001004602 | 225 |
| 127 | 3300005530 | Ga0070679_100164690 | Ga0070679_1001646902 | 225 |
| 128 | 3300005539 | Ga0068853_100044091 | Ga0068853_1000440912 | 225 |
| 129 | 3300005547 | Ga0070693_100066300 | Ga0070693_1000663003 | 225 |
| 130 | 3300005614 | Ga0068856_100101544 | Ga0068856_1001015442 | 225 |
| 131 | 3300006175 | Ga0070712_100076491 | Ga0070712_1000764913 | 225 |
| 132 | 3300006237 | Ga0097621_100045720 | Ga0097621_1000457202 | 225 |
| 133 | 3300006237 | Ga0097621_100221949 | Ga0097621_1002219494 | 225 |
| 134 | 3300006358 | Ga0068871_100316022 | Ga0068871_1003160222 | 225 |
| 135 | 3300006358 | Ga0068871_100874855 | Ga0068871_1008748552 | 225 |
| 136 | 3300006881 | Ga0068865_100361639 | Ga0068865_1003616391 | 225 |
| 137 | 3300009098 | Ga0105245_10723711 | Ga0105245_107237112 | 225 |
| 138 | 3300013100 | Ga0157373_10076702 | Ga0157373_100767022 | 225 |
| 139 | 3300025907 | Ga0207645_10176183 | Ga0207645_101761832 | 225 |
| 140 | 3300025909 | Ga0207705_10026263 | Ga0207705_100262631 | 225 |
| 141 | 3300025915 | Ga0207693_10058924 | Ga0207693_100589242 | 225 |
| 142 | 3300025919 | Ga0207657_10006910 | Ga0207657_100069104 | 225 |
| 143 | 3300025919 | Ga0207657_10075695 | Ga0207657_100756953 | 225 |
| 144 | 3300025925 | Ga0207650_10026326 | Ga0207650_100263262 | 225 |
| 145 | 3300025928 | Ga0207700_10327928 | Ga0207700_103279282 | 225 |
| 146 | 3300025928 | Ga0207700_10391774 | Ga0207700_103917741 | 225 |
| 147 | 3300025929 | Ga0207664_10065961 | Ga0207664_100659612 | 225 |
| 148 | 3300025929 | Ga0207664_10271972 | Ga0207664_102719722 | 225 |
| 149 | 3300025932 | Ga0207690_10084859 | Ga0207690_100848592 | 225 |
| 150 | 3300025932 | Ga0207690_10095172 | Ga0207690_100951721 | 225 |
| 151 | 3300025933 | Ga0207706_10050453 | Ga0207706_100504532 | 225 |
| 152 | 3300025941 | Ga0207711_10102370 | Ga0207711_101023702 | 225 |
| 153 | 3300025942 | Ga0207689_10432184 | Ga0207689_104321842 | 225 |
| 154 | 3300025945 | Ga0207679_10181080 | Ga0207679_101810802 | 225 |
| 155 | 3300025960 | Ga0207651_10407555 | Ga0207651_104075552 | 225 |
| 156 | 3300025986 | Ga0207658_10035645 | Ga0207658_100356453 | 225 |
| 157 | 3300026041 | Ga0207639_10243286 | Ga0207639_102432861 | 225 |
| 158 | 3300026067 | Ga0207678_10016206 | Ga0207678_100162063 | 225 |
| 159 | 3300026095 | Ga0207676_11251460 | Ga0207676_112514601 | 225 |
| 160 | 3300031995 | Ga0307409_100635766 | Ga0307409_1006357662 | 225 |
| 161 | 3300037471 | Ga0395905_0746626 | Ga0395905_0746626_159_836 | 225 |
| 162 | 3300044684 | Ga0466966_0021776 | Ga0466966_0021776_3364_4047 | 225 |
| 163 | 3300044694 | Ga0466963_0024642 | Ga0466963_0024642_2688_3371 | 225 |
| 164 | 3300044706 | Ga0466964_0061721 | Ga0466964_0061721_863_1546 | 225 |
| 165 | 3300044842 | Ga0466957_0004719 | Ga0466957_0004719_6035_6715 | 225 |
| 166 | 3300044842 | Ga0466957_0117370 | Ga0466957_0117370_483_1169 | 225 |
| 167 | 3300045049 | Ga0466959_0055897 | Ga0466959_0055897_2013_2696 | 225 |
| 168 | 3300045049 | Ga0466959_0223053 | Ga0466959_0223053_606_1283 | 225 |
| 169 | 3300045836 | Ga0466958_0008138 | Ga0466958_0008138_1305_1985 | 225 |
| 170 | 3300045836 | Ga0466958_0084393 | Ga0466958_0084393_1064_1747 | 225 |
| 171 | 3300045976 | Ga0466967_0006738 | Ga0466967_0006738_4127_4807 | 225 |
| 172 | 3300045976 | Ga0466967_0033123 | Ga0466967_0033123_673_1356 | 225 |
| 173 | 3300045976 | Ga0466967_0118704 | Ga0466967_0118704_355_1041 | 225 |
| 174 | 3300049590 | Ga0501074_0182797 | Ga0501074_0182797_394_1074 | 225 |
| 175 | 3300049742 | Ga0501080_0085319 | Ga0501080_0085319_1733_2413 | 225 |
| 176 | 3300049823 | Ga0501044_0530617 | Ga0501044_0530617_192_872 | 225 |
| 177 | 3300061719 | Ga0466962_0102580 | Ga0466962_0102580_87_767 | 225 |
| 178 | 3300001915 | JGI24741J21665_1001923 | JGI24741J21665_10019234 | 226 |
| 179 | 3300001979 | JGI24740J21852_10000589 | JGI24740J21852_1000058915 | 226 |
| 180 | 3300001990 | JGI24737J22298_10000717 | JGI24737J22298_100007178 | 226 |
| 181 | 3300001991 | JGI24743J22301_10019866 | JGI24743J22301_100198661 | 226 |
| 182 | 3300002067 | JGI24735J21928_10005017 | JGI24735J21928_100050174 | 226 |
| 183 | 3300002067 | JGI24735J21928_10011173 | JGI24735J21928_100111732 | 226 |
| 184 | 3300002075 | JGI24738J21930_10003360 | JGI24738J21930_100033604 | 226 |
| 185 | 3300005293 | Ga0065715_10162571 | Ga0065715_101625711 | 226 |
| 186 | 3300005327 | Ga0070658_10000205 | Ga0070658_1000020524 | 226 |
| 187 | 3300005327 | Ga0070658_10108640 | Ga0070658_101086402 | 226 |
| 188 | 3300005328 | Ga0070676_10253939 | Ga0070676_102539391 | 226 |
| 189 | 3300005329 | Ga0070683_100002492 | Ga0070683_1000024926 | 226 |
| 190 | 3300005329 | Ga0070683_100066511 | Ga0070683_1000665114 | 226 |
| 191 | 3300005335 | Ga0070666_10000168 | Ga0070666_100001687 | 226 |
| 192 | 3300005336 | Ga0070680_100003746 | Ga0070680_1000037463 | 226 |
| 193 | 3300005336 | Ga0070680_100033201 | Ga0070680_1000332014 | 226 |
| 194 | 3300005336 | Ga0070680_100735750 | Ga0070680_1007357501 | 226 |
| 195 | 3300005337 | Ga0070682_100011208 | Ga0070682_1000112084 | 226 |
| 196 | 3300005339 | Ga0070660_100000009 | Ga0070660_10000000941 | 226 |
| 197 | 3300005339 | Ga0070660_100039562 | Ga0070660_1000395623 | 226 |
| 198 | 3300005339 | Ga0070660_100100670 | Ga0070660_1001006703 | 226 |
| 199 | 3300005341 | Ga0070691_10316393 | Ga0070691_103163931 | 226 |
| 200 | 3300005344 | Ga0070661_100000100 | Ga0070661_10000010041 | 226 |
| 201 | 3300005344 | Ga0070661_100004554 | Ga0070661_1000045544 | 226 |
| 202 | 3300005345 | Ga0070692_10005766 | Ga0070692_100057664 | 226 |
| 203 | 3300005355 | Ga0070671_100003268 | Ga0070671_1000032686 | 226 |
| 204 | 3300005355 | Ga0070671_100027694 | Ga0070671_1000276944 | 226 |
| 205 | 3300005355 | Ga0070671_100036477 | Ga0070671_1000364772 | 226 |
| 206 | 3300005355 | Ga0070671_100245719 | Ga0070671_1002457192 | 226 |
| 207 | 3300005364 | Ga0070673_100024937 | Ga0070673_1000249373 | 226 |
| 208 | 3300005364 | Ga0070673_100075351 | Ga0070673_1000753512 | 226 |
| 209 | 3300005365 | Ga0070688_100586940 | Ga0070688_1005869402 | 226 |
| 210 | 3300005366 | Ga0070659_100026112 | Ga0070659_1000261123 | 226 |
| 211 | 3300005367 | Ga0070667_100003299 | Ga0070667_10000329914 | 226 |
| 212 | 3300005367 | Ga0070667_100003776 | Ga0070667_10000377611 | 226 |
| 213 | 3300005455 | Ga0070663_100003985 | Ga0070663_1000039854 | 226 |
| 214 | 3300005456 | Ga0070678_100316012 | Ga0070678_1003160122 | 226 |
| 215 | 3300005457 | Ga0070662_100000035 | Ga0070662_10000003532 | 226 |
| 216 | 3300005457 | Ga0070662_100006246 | Ga0070662_1000062463 | 226 |
| 217 | 3300005457 | Ga0070662_100342669 | Ga0070662_1003426692 | 226 |
| 218 | 3300005457 | Ga0070662_100581071 | Ga0070662_1005810711 | 226 |
| 219 | 3300005530 | Ga0070679_100067129 | Ga0070679_1000671294 | 226 |
| 220 | 3300005535 | Ga0070684_100034504 | Ga0070684_1000345044 | 226 |
| 221 | 3300005539 | Ga0068853_100001248 | Ga0068853_1000012487 | 226 |
| 222 | 3300005539 | Ga0068853_100134039 | Ga0068853_1001340392 | 226 |
| 223 | 3300005543 | Ga0070672_100222193 | Ga0070672_1002221932 | 226 |
| 224 | 3300005546 | Ga0070696_100183274 | Ga0070696_1001832742 | 226 |
| 225 | 3300005546 | Ga0070696_100301114 | Ga0070696_1003011142 | 226 |
| 226 | 3300005547 | Ga0070693_100003192 | Ga0070693_1000031923 | 226 |
| 227 | 3300005548 | Ga0070665_100008493 | Ga0070665_1000084935 | 226 |
| 228 | 3300005563 | Ga0068855_100001487 | Ga0068855_10000148713 | 226 |
| 229 | 3300005563 | Ga0068855_100022719 | Ga0068855_1000227195 | 226 |
| 230 | 3300005563 | Ga0068855_100083532 | Ga0068855_1000835323 | 226 |
| 231 | 3300005563 | Ga0068855_100504855 | Ga0068855_1005048552 | 226 |
| 232 | 3300005564 | Ga0070664_100000025 | Ga0070664_10000002562 | 226 |
| 233 | 3300005564 | Ga0070664_100178265 | Ga0070664_1001782652 | 226 |
| 234 | 3300005578 | Ga0068854_100009160 | Ga0068854_1000091604 | 226 |
| 235 | 3300005578 | Ga0068854_100019115 | Ga0068854_1000191152 | 226 |
| 236 | 3300005614 | Ga0068856_100000124 | Ga0068856_10000012474 | 226 |
| 237 | 3300005614 | Ga0068856_100024186 | Ga0068856_1000241863 | 226 |
| 238 | 3300005616 | Ga0068852_100013177 | Ga0068852_1000131773 | 226 |
| 239 | 3300005616 | Ga0068852_100235166 | Ga0068852_1002351662 | 226 |
| 240 | 3300005618 | Ga0068864_100015927 | Ga0068864_1000159272 | 226 |
| 241 | 3300005618 | Ga0068864_100037788 | Ga0068864_1000377883 | 226 |
| 242 | 3300005618 | Ga0068864_100062062 | Ga0068864_1000620622 | 226 |
| 243 | 3300005618 | Ga0068864_100186813 | Ga0068864_1001868132 | 226 |
| 244 | 3300005834 | Ga0068851_10050683 | Ga0068851_100506832 | 226 |
| 245 | 3300005842 | Ga0068858_100020174 | Ga0068858_1000201744 | 226 |
| 246 | 3300005842 | Ga0068858_100128157 | Ga0068858_1001281572 | 226 |
| 247 | 3300005843 | Ga0068860_100679816 | Ga0068860_1006798162 | 226 |
| 248 | 3300006237 | Ga0097621_100135322 | Ga0097621_1001353222 | 226 |
| 249 | 3300009174 | Ga0105241_10007654 | Ga0105241_100076544 | 226 |
| 250 | 3300009177 | Ga0105248_10000163 | Ga0105248_1000016341 | 226 |
| 251 | 3300009177 | Ga0105248_10056241 | Ga0105248_100562412 | 226 |
| 252 | 3300009177 | Ga0105248_10060179 | Ga0105248_100601794 | 226 |
| 253 | 3300009551 | Ga0105238_10028049 | Ga0105238_100280492 | 226 |
| 254 | 3300013100 | Ga0157373_10062477 | Ga0157373_100624773 | 226 |
| 255 | 3300013100 | Ga0157373_10136420 | Ga0157373_101364202 | 226 |
| 256 | 3300013100 | Ga0157373_10236479 | Ga0157373_102364791 | 226 |
| 257 | 3300013102 | Ga0157371_10002007 | Ga0157371_100020076 | 226 |
| 258 | 3300013102 | Ga0157371_10018498 | Ga0157371_100184984 | 226 |
| 259 | 3300013296 | Ga0157374_10068057 | Ga0157374_100680572 | 226 |
| 260 | 3300013306 | Ga0163162_10064370 | Ga0163162_100643704 | 226 |
| 261 | 3300013307 | Ga0157372_10016123 | Ga0157372_100161236 | 226 |
| 262 | 3300014325 | Ga0163163_10000173 | Ga0163163_1000017341 | 226 |
| 263 | 3300014745 | Ga0157377_10214291 | Ga0157377_102142912 | 226 |
| 264 | 3300014968 | Ga0157379_10027263 | Ga0157379_100272632 | 226 |
| 265 | 3300020069 | Ga0197907_10008173 | Ga0197907_100081732 | 226 |
| 266 | 3300020078 | Ga0206352_10238308 | Ga0206352_102383081 | 226 |
| 267 | 3300020081 | Ga0206354_11142318 | Ga0206354_111423182 | 226 |
| 268 | 3300020082 | Ga0206353_10044027 | Ga0206353_100440272 | 226 |
| 269 | 3300020082 | Ga0206353_11786651 | Ga0206353_117866512 | 226 |
| 270 | 3300025290 | Ga0207673_1013489 | Ga0207673_10134891 | 226 |
| 271 | 3300025315 | Ga0207697_10065280 | Ga0207697_100652802 | 226 |
| 272 | 3300025321 | Ga0207656_10040785 | Ga0207656_100407851 | 226 |
| 273 | 3300025903 | Ga0207680_10296416 | Ga0207680_102964162 | 226 |
| 274 | 3300025904 | Ga0207647_10070577 | Ga0207647_100705772 | 226 |
| 275 | 3300025909 | Ga0207705_10000114 | Ga0207705_1000011429 | 226 |
| 276 | 3300025909 | Ga0207705_10003511 | Ga0207705_100035112 | 226 |
| 277 | 3300025909 | Ga0207705_10054575 | Ga0207705_100545752 | 226 |
| 278 | 3300025909 | Ga0207705_10090915 | Ga0207705_100909152 | 226 |
| 279 | 3300025909 | Ga0207705_10235281 | Ga0207705_102352812 | 226 |
| 280 | 3300025909 | Ga0207705_10741449 | Ga0207705_107414491 | 226 |
| 281 | 3300025911 | Ga0207654_10093294 | Ga0207654_100932943 | 226 |
| 282 | 3300025912 | Ga0207707_10020600 | Ga0207707_100206003 | 226 |
| 283 | 3300025912 | Ga0207707_10071318 | Ga0207707_100713182 | 226 |
| 284 | 3300025917 | Ga0207660_10004684 | Ga0207660_100046845 | 226 |
| 285 | 3300025917 | Ga0207660_10008547 | Ga0207660_100085473 | 226 |
| 286 | 3300025917 | Ga0207660_10111021 | Ga0207660_101110212 | 226 |
| 287 | 3300025919 | Ga0207657_10000071 | Ga0207657_1000007161 | 226 |
| 288 | 3300025919 | Ga0207657_10013044 | Ga0207657_100130444 | 226 |
| 289 | 3300025920 | Ga0207649_10000301 | Ga0207649_1000030134 | 226 |
| 290 | 3300025920 | Ga0207649_10006077 | Ga0207649_100060775 | 226 |
| 291 | 3300025921 | Ga0207652_10002862 | Ga0207652_1000286213 | 226 |
| 292 | 3300025924 | Ga0207694_10090357 | Ga0207694_100903572 | 226 |
| 293 | 3300025927 | Ga0207687_10059845 | Ga0207687_100598452 | 226 |
| 294 | 3300025931 | Ga0207644_10004781 | Ga0207644_100047818 | 226 |
| 295 | 3300025931 | Ga0207644_10020504 | Ga0207644_100205042 | 226 |
| 296 | 3300025932 | Ga0207690_10001260 | Ga0207690_1000126016 | 226 |
| 297 | 3300025932 | Ga0207690_10051667 | Ga0207690_100516672 | 226 |
| 298 | 3300025932 | Ga0207690_10211070 | Ga0207690_102110702 | 226 |
| 299 | 3300025932 | Ga0207690_10312045 | Ga0207690_103120452 | 226 |
| 300 | 3300025933 | Ga0207706_10000086 | Ga0207706_1000008641 | 226 |
| 301 | 3300025933 | Ga0207706_10000655 | Ga0207706_100006556 | 226 |
| 302 | 3300025933 | Ga0207706_10213488 | Ga0207706_102134882 | 226 |
| 303 | 3300025940 | Ga0207691_10021409 | Ga0207691_100214093 | 226 |
| 304 | 3300025941 | Ga0207711_10003283 | Ga0207711_1000328313 | 226 |
| 305 | 3300025941 | Ga0207711_10035421 | Ga0207711_100354213 | 226 |
| 306 | 3300025941 | Ga0207711_10254033 | Ga0207711_102540332 | 226 |
| 307 | 3300025944 | Ga0207661_10001017 | Ga0207661_100010173 | 226 |
| 308 | 3300025944 | Ga0207661_10052798 | Ga0207661_100527984 | 226 |
| 309 | 3300025945 | Ga0207679_10000315 | Ga0207679_1000031513 | 226 |
| 310 | 3300025949 | Ga0207667_10001152 | Ga0207667_1000115213 | 226 |
| 311 | 3300025949 | Ga0207667_10066064 | Ga0207667_100660641 | 226 |
| 312 | 3300025949 | Ga0207667_10468217 | Ga0207667_104682172 | 226 |
| 313 | 3300025960 | Ga0207651_10550400 | Ga0207651_105504002 | 226 |
| 314 | 3300025981 | Ga0207640_10027211 | Ga0207640_100272113 | 226 |
| 315 | 3300025981 | Ga0207640_10286339 | Ga0207640_102863392 | 226 |
| 316 | 3300025986 | Ga0207658_10020002 | Ga0207658_100200024 | 226 |
| 317 | 3300025986 | Ga0207658_10075063 | Ga0207658_100750633 | 226 |
| 318 | 3300026023 | Ga0207677_10306835 | Ga0207677_103068352 | 226 |
| 319 | 3300026041 | Ga0207639_10000330 | Ga0207639_1000033015 | 226 |
| 320 | 3300026041 | Ga0207639_10005870 | Ga0207639_100058704 | 226 |
| 321 | 3300026041 | Ga0207639_10011769 | Ga0207639_100117692 | 226 |
| 322 | 3300026067 | Ga0207678_10000311 | Ga0207678_1000031121 | 226 |
| 323 | 3300026067 | Ga0207678_10000860 | Ga0207678_1000086024 | 226 |
| 324 | 3300026078 | Ga0207702_10000254 | Ga0207702_1000025458 | 226 |
| 325 | 3300026088 | Ga0207641_10309020 | Ga0207641_103090202 | 226 |
| 326 | 3300026095 | Ga0207676_10064832 | Ga0207676_100648322 | 226 |
| 327 | 3300026116 | Ga0207674_10003121 | Ga0207674_1000312116 | 226 |
| 328 | 3300026142 | Ga0207698_10000709 | Ga0207698_1000070910 | 226 |
| 329 | 3300026142 | Ga0207698_10008119 | Ga0207698_100081193 | 226 |
| 330 | 3300026142 | Ga0207698_10047293 | Ga0207698_100472932 | 226 |
| 331 | 3300026142 | Ga0207698_10135458 | Ga0207698_101354582 | 226 |
| 332 | 3300028379 | Ga0268266_10009531 | Ga0268266_100095318 | 226 |
| 333 | 3300034816 | Ga0373930_0017291 | Ga0373930_0017291_82_765 | 226 |
| 334 | 3300035084 | Ga0373928_0018897 | Ga0373928_0018897_629_1312 | 226 |
| 335 | 3300035121 | Ga0373960_0022629 | Ga0373960_0022629_743_1426 | 226 |
| 336 | 3300035691 | Ga0373931_0000615 | Ga0373931_0000615_5179_5862 | 226 |
| 337 | 3300037471 | Ga0395905_0243670 | Ga0395905_0243670_562_1245 | 226 |
| 338 | 3300044658 | Ga0466972_0099061 | Ga0466972_0099061_469_1149 | 226 |
| 339 | 3300044706 | Ga0466964_0112531 | Ga0466964_0112531_354_1034 | 226 |
| 340 | 3300044842 | Ga0466957_0052357 | Ga0466957_0052357_52_732 | 226 |
| 341 | 3300044901 | Ga0466960_0304637 | Ga0466960_0304637_89_775 | 226 |
| 342 | 3300045976 | Ga0466967_0029374 | Ga0466967_0029374_3832_4515 | 226 |
| 343 | 3300045976 | Ga0466967_0031955 | Ga0466967_0031955_582_1265 | 226 |
| 344 | 3300045976 | Ga0466967_0189016 | Ga0466967_0189016_78_758 | 226 |
| 345 | 3300046525 | Ga0495663_0102202 | Ga0495663_0102202_94_774 | 226 |
| 346 | 3300046528 | Ga0495642_0057297 | Ga0495642_0057297_405_1085 | 226 |
| 347 | 3300048903 | Ga0496100_0240720 | Ga0496100_0240720_173_853 | 226 |
| 348 | 3300048904 | Ga0496101_0043158 | Ga0496101_0043158_793_1476 | 226 |
| 349 | 3300048907 | Ga0496104_0101331 | Ga0496104_0101331_829_1512 | 226 |
| 350 | 3300048908 | Ga0496105_0129423 | Ga0496105_0129423_1137_1820 | 226 |
| 351 | 3300048909 | Ga0496106_0538246 | Ga0496106_0538246_137_817 | 226 |
| 352 | 3300048910 | Ga0496107_0012723 | Ga0496107_0012723_985_1665 | 226 |
| 353 | 3300048910 | Ga0496107_0191920 | Ga0496107_0191920_102_788 | 226 |
| 354 | 3300048911 | Ga0496108_0013785 | Ga0496108_0013785_1721_2404 | 226 |
| 355 | 3300048912 | Ga0496109_0067720 | Ga0496109_0067720_2012_2695 | 226 |
| 356 | 3300048912 | Ga0496109_0085712 | Ga0496109_0085712_1621_2301 | 226 |
| 357 | 3300048913 | Ga0496110_0371224 | Ga0496110_0371224_558_1241 | 226 |
| 358 | 3300048914 | Ga0496111_0013433 | Ga0496111_0013433_1179_1862 | 226 |
| 359 | 3300048915 | Ga0496112_0006500 | Ga0496112_0006500_4204_4884 | 226 |
| 360 | 3300048915 | Ga0496112_0326053 | Ga0496112_0326053_472_1155 | 226 |
| 361 | 3300048916 | Ga0496113_0008437 | Ga0496113_0008437_490_1173 | 226 |
| 362 | 3300048917 | Ga0496114_0000023 | Ga0496114_0000023_34172_34855 | 226 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f4n-assembly1.cif.gz_B | crystal structure of protein mj1651 from methanococcus jannaschii dsm 2661, pfam duf62 | 0.7814 | 131 | 151 |
| 2f4n-assembly1.cif.gz_C | crystal structure of protein mj1651 from methanococcus jannaschii dsm 2661, pfam duf62 | 0.7475 | 130 | 151 |
| 6m7c-assembly1.cif.gz_A | crystal structure of c-terminal fragment of pilus adhesin spac from lactobacillus rhamnosus gg | 0.7382 | 136 | 189 |
| 2yn3-assembly3.cif.gz_D | structural insight into the giant calcium-binding adhesin siie: implications for the adhesion of salmonella enterica to polarized epithelial cells | 0.7174 | 136 | 189 |
| 4s3r-assembly1.cif.gz_A | amylomaltase malq from escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose | 0.7074 | 113 | 190 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P13475_13_104_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.7254 | 108 | 188 | 3.40.50.720 |
| af_P15977_1_137_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7112 | 116 | 191 | 2.60.40.10 |
| af_G5ECX2_917_1013_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7082 | 135 | 191 | 2.60.40.10 |
| af_O50419_75_527_3.30.1490.100 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;DNA polymerase, Y-family, little finger domain | 0.7054 | 132 | 153 | 3.30.1490.100 |
| 3pjyA00 | Mainly Beta;Sandwich;Jelly Rolls;Protein of unknown function DUF192 | 0.6802 | 131 | 151 | 2.60.120.1140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A259GYR1-F1-model_v4 | Uncharacterized protein | 0.9394 | 106 | 224 |
|
| AF-A0A0Q5VB22-F1-model_v4 | SRPBCC family protein | 0.8628 | 108 | 219 |
|
| AF-A0A1W9WA74-F1-model_v4 | Uncharacterized protein | 0.8539 | 104 | 217 |
|
| AF-A0A7V8RFB2-F1-model_v4 | Uncharacterized protein | 0.8034 | 23 | 224 |
|
| AF-A0A090AHX7-F1-model_v4 | Secreted protein | 0.8026 | 106 | 219 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar