F422698
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 362 | 260 | 724 | 358 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0164632|Ga0466963_0164632_221_1333 |
| Length | 370 |
| Sequence | MSRPSKAGPQHYASLDHGAACGCCTSRRGFLAAAAAFGASVALPAMPAVAQPASTKLIDTHHHFYPPEYQKAWGEWEDKRKIPHLGVQLAWTREHAFEAMDKAGITTGVLSLPSTPGVWFDAGPEAAHDMARLCSEFGAQMVRDRPGRYGLFAPLSMMDVDTTLKEIEYAFDTLKADGINLQSNYGDKWLGNPFYKPILEELNRRKAVVFVHPLVASCCDARLSVGAFPAVIEVPHDTTRTVVSLLLSGSLTRLRDITWLFSHGGGTIPFLAGRIEAFYDEKARGPNGFAPDGIEAEFRRLHYDTANATHPAAMAALQKLVPISQITYGTDYPYFALDQFSELRQLGLAPADLAAIESGNATRLLPRLKT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 42 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 43 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 44 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 48 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 73 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 74 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 75 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 115 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 117 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 118 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 119 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 122 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 123 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 124 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 125 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 126 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 127 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 128 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 129 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 130 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 131 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 132 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 133 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 136 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 137 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 138 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 139 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 140 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 141 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 142 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 143 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 144 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 145 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 146 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 147 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 184 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 185 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 186 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 187 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 190 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 191 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 192 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 193 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 194 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 195 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 196 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 197 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 198 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 199 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 202 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 203 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 204 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 205 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 213 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 214 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 215 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 216 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 217 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 218 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 219 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 220 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 221 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 222 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 223 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 224 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 225 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 226 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 227 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 228 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 229 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 230 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 231 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 232 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 233 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 234 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 235 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 236 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 237 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 238 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 239 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 240 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 241 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 242 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 243 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 244 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 245 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 246 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 247 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 248 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 249 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 250 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 251 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 252 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 253 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 254 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 255 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 256 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 257 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 258 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 259 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 260 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.95 |
| Metatranscriptomes | 0.28 |
| Isolates | 10.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.29 |
| Nodule | 9.94 |
| Rhizoplane | 9.67 |
| Rhizosphere | 64.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466963_0164632 | 3300044694 | Bacteria | 1544 |
| 2 | JGI25406J46586_10000096 | 3300003203 | Bacteria | 39663 |
| 3 | JGI25153J46596_10004898 | 3300003215 | Bacteria | 7118 |
| 4 | Ga0055543_1007118 | 3300004625 | Bacteria | 2620 |
| 5 | Ga0065165_1000747 | 3300005262 | Bacteria | 44635 |
| 6 | Ga0070683_100019365 | 3300005329 | Bacteria | 6044 |
| 7 | Ga0070661_100140668 | 3300005344 | Bacteria | 1819 |
| 8 | Ga0070675_100037262 | 3300005354 | Bacteria | 3961 |
| 9 | Ga0070675_100213891 | 3300005354 | Bacteria | 1677 |
| 10 | Ga0070674_100039292 | 3300005356 | Bacteria | 3194 |
| 11 | Ga0070673_100026328 | 3300005364 | Bacteria | 4294 |
| 12 | Ga0070673_100294525 | 3300005364 | Bacteria | 1427 |
| 13 | Ga0070688_100031745 | 3300005365 | Bacteria | 3180 |
| 14 | Ga0070667_100188574 | 3300005367 | Bacteria | 1826 |
| 15 | Ga0070709_10010219 | 3300005434 | Bacteria | 5190 |
| 16 | Ga0070709_10060951 | 3300005434 | Bacteria | 2400 |
| 17 | Ga0070713_100005705 | 3300005436 | Bacteria | 8548 |
| 18 | Ga0070713_100026587 | 3300005436 | Bacteria | 4546 |
| 19 | Ga0070713_100036922 | 3300005436 | Bacteria | 3947 |
| 20 | Ga0070713_100049563 | 3300005436 | Bacteria | 3465 |
| 21 | Ga0070713_100066135 | 3300005436 | Bacteria | 3039 |
| 22 | Ga0070713_100107245 | 3300005436 | Bacteria | 2430 |
| 23 | Ga0070713_100191389 | 3300005436 | Unclassified | 1843 |
| 24 | Ga0070710_10004305 | 3300005437 | Bacteria | 6747 |
| 25 | Ga0070710_10007679 | 3300005437 | Bacteria | 5230 |
| 26 | Ga0070711_100097582 | 3300005439 | Bacteria | 2131 |
| 27 | Ga0070700_100073851 | 3300005441 | Bacteria | 2184 |
| 28 | Ga0070694_100229138 | 3300005444 | Unclassified | 1397 |
| 29 | Ga0070708_100120290 | 3300005445 | Bacteria | 2422 |
| 30 | Ga0070678_100054614 | 3300005456 | Bacteria | 2912 |
| 31 | Ga0070678_100070687 | 3300005456 | Bacteria | 2611 |
| 32 | Ga0070707_100191025 | 3300005468 | Bacteria | 1997 |
| 33 | Ga0070699_100006567 | 3300005518 | Bacteria | 10121 |
| 34 | Ga0070699_100080498 | 3300005518 | Bacteria | 2839 |
| 35 | Ga0070699_100290219 | 3300005518 | Bacteria | 1466 |
| 36 | Ga0070679_100048368 | 3300005530 | Bacteria | 4237 |
| 37 | Ga0070679_100051421 | 3300005530 | Bacteria | 4104 |
| 38 | Ga0070697_100068409 | 3300005536 | Bacteria | 2907 |
| 39 | Ga0068853_100008408 | 3300005539 | Bacteria | 8291 |
| 40 | Ga0068853_100357299 | 3300005539 | Bacteria | 1360 |
| 41 | Ga0070695_100082436 | 3300005545 | Bacteria | 2129 |
| 42 | Ga0070696_100100217 | 3300005546 | Bacteria | 2074 |
| 43 | Ga0070696_100158881 | 3300005546 | Bacteria | 1664 |
| 44 | Ga0070693_100070832 | 3300005547 | Bacteria | 2052 |
| 45 | Ga0070665_100163032 | 3300005548 | Bacteria | 2231 |
| 46 | Ga0070704_100112804 | 3300005549 | Bacteria | 2072 |
| 47 | Ga0068857_100017665 | 3300005577 | Bacteria | 6254 |
| 48 | Ga0068856_100000513 | 3300005614 | Bacteria | 42640 |
| 49 | Ga0068859_100295236 | 3300005617 | Bacteria | 1714 |
| 50 | Ga0068866_10211894 | 3300005718 | Bacteria | 1164 |
| 51 | Ga0068851_10098545 | 3300005834 | Bacteria | 1548 |
| 52 | Ga0068863_100111051 | 3300005841 | Bacteria | 2611 |
| 53 | Ga0068858_100218066 | 3300005842 | Bacteria | 1806 |
| 54 | Ga0081455_10046233 | 3300005937 | Bacteria | 3778 |
| 55 | Ga0081539_10000051 | 3300005985 | Bacteria | 268337 |
| 56 | Ga0081539_10002070 | 3300005985 | Bacteria | 30041 |
| 57 | Ga0081539_10007181 | 3300005985 | Bacteria | 10265 |
| 58 | Ga0070717_10011028 | 3300006028 | Bacteria | 6845 |
| 59 | Ga0070717_10032501 | 3300006028 | Bacteria | 4205 |
| 60 | Ga0070717_10090108 | 3300006028 | Bacteria | 2588 |
| 61 | Ga0070717_10092932 | 3300006028 | Bacteria | 2549 |
| 62 | Ga0075365_10138358 | 3300006038 | Unclassified | 1689 |
| 63 | Ga0075363_100010423 | 3300006048 | Bacteria | 4415 |
| 64 | Ga0075364_10042097 | 3300006051 | Bacteria | 2967 |
| 65 | Ga0070715_10052141 | 3300006163 | Bacteria | 1763 |
| 66 | Ga0070716_100026573 | 3300006173 | Bacteria | 3101 |
| 67 | Ga0070716_100110035 | 3300006173 | Bacteria | 1706 |
| 68 | Ga0070712_100002530 | 3300006175 | Bacteria | 11286 |
| 69 | Ga0070712_100028801 | 3300006175 | Bacteria | 3718 |
| 70 | Ga0075362_10006794 | 3300006177 | Bacteria | 4279 |
| 71 | Ga0075366_10006973 | 3300006195 | Bacteria | 6222 |
| 72 | Ga0075366_10025979 | 3300006195 | Bacteria | 3426 |
| 73 | Ga0075366_10071222 | 3300006195 | Bacteria | 2071 |
| 74 | Ga0075428_100320526 | 3300006844 | Bacteria | 1666 |
| 75 | Ga0075433_10030356 | 3300006852 | Bacteria | 4611 |
| 76 | Ga0075434_100485294 | 3300006871 | Unclassified | 1257 |
| 77 | Ga0068865_100162266 | 3300006881 | Bacteria | 1706 |
| 78 | Ga0097620_100295229 | 3300006931 | Bacteria | 1714 |
| 79 | Ga0075435_100012731 | 3300007076 | Bacteria | 6233 |
| 80 | Ga0075435_100144047 | 3300007076 | Bacteria | 2000 |
| 81 | Ga0111539_10130754 | 3300009094 | Bacteria | 2940 |
| 82 | Ga0105245_10056492 | 3300009098 | Bacteria | 3528 |
| 83 | Ga0114129_10520984 | 3300009147 | Bacteria | 1550 |
| 84 | Ga0114129_10873185 | 3300009147 | Bacteria | 1142 |
| 85 | Ga0105243_10018773 | 3300009148 | Bacteria | 5238 |
| 86 | Ga0105243_10049545 | 3300009148 | Bacteria | 3314 |
| 87 | Ga0105242_10014951 | 3300009176 | Bacteria | 6016 |
| 88 | Ga0105248_10193045 | 3300009177 | Bacteria | 2295 |
| 89 | Ga0105237_10014994 | 3300009545 | Bacteria | 8077 |
| 90 | Ga0105238_10021143 | 3300009551 | Bacteria | 6632 |
| 91 | Ga0105238_10037311 | 3300009551 | Bacteria | 4940 |
| 92 | Ga0105249_10096789 | 3300009553 | Bacteria | 2770 |
| 93 | Ga0157370_10017428 | 3300013104 | Bacteria | 7247 |
| 94 | Ga0157370_10250161 | 3300013104 | Bacteria | 1639 |
| 95 | Ga0157369_10003783 | 3300013105 | Bacteria | 17976 |
| 96 | Ga0157369_10013058 | 3300013105 | Bacteria | 9405 |
| 97 | Ga0157369_10022737 | 3300013105 | Bacteria | 6991 |
| 98 | Ga0163162_10042467 | 3300013306 | Bacteria | 4551 |
| 99 | Ga0163162_10061161 | 3300013306 | Bacteria | 3804 |
| 100 | Ga0157375_10156871 | 3300013308 | Bacteria | 2415 |
| 101 | Ga0163163_10190988 | 3300014325 | Bacteria | 2097 |
| 102 | Ga0157380_10164858 | 3300014326 | Bacteria | 1930 |
| 103 | Ga0157376_10106644 | 3300014969 | Bacteria | 2458 |
| 104 | Ga0163161_10148891 | 3300017792 | Bacteria | 1778 |
| 105 | Ga0213876_10000894 | 3300021384 | Bacteria | 19913 |
| 106 | Ga0213876_10011185 | 3300021384 | Bacteria | 4797 |
| 107 | Ga0213876_10049291 | 3300021384 | Bacteria | 2225 |
| 108 | Ga0213876_10099843 | 3300021384 | Bacteria | 1538 |
| 109 | Ga0213875_10000009 | 3300021388 | Bacteria | 451129 |
| 110 | Ga0228598_1002312 | 3300024227 | Bacteria | 4168 |
| 111 | Ga0209148_1000677 | 3300025254 | Bacteria | 28498 |
| 112 | Ga0209233_1007084 | 3300025261 | Bacteria | 3576 |
| 113 | Ga0209455_1001837 | 3300025272 | Bacteria | 8887 |
| 114 | Ga0209455_1014485 | 3300025272 | Bacteria | 1782 |
| 115 | Ga0209758_1003090 | 3300025297 | Bacteria | 15771 |
| 116 | Ga0209758_1010708 | 3300025297 | Bacteria | 5442 |
| 117 | Ga0207426_1001355 | 3300025302 | Bacteria | 20765 |
| 118 | Ga0207688_10044337 | 3300025901 | Bacteria | 2479 |
| 119 | Ga0207707_10001607 | 3300025912 | Bacteria | 20820 |
| 120 | Ga0207707_10059267 | 3300025912 | Bacteria | 3331 |
| 121 | Ga0207695_10035524 | 3300025913 | Bacteria | 5403 |
| 122 | Ga0207671_10073149 | 3300025914 | Bacteria | 2560 |
| 123 | Ga0207693_10003777 | 3300025915 | Bacteria | 12900 |
| 124 | Ga0207693_10015214 | 3300025915 | Bacteria | 6175 |
| 125 | Ga0207693_10021329 | 3300025915 | Bacteria | 5149 |
| 126 | Ga0207693_10061176 | 3300025915 | Bacteria | 2949 |
| 127 | Ga0207693_10088248 | 3300025915 | Bacteria | 2431 |
| 128 | Ga0207693_10109861 | 3300025915 | Bacteria | 2162 |
| 129 | Ga0207663_10201198 | 3300025916 | Bacteria | 1437 |
| 130 | Ga0207660_10009667 | 3300025917 | Bacteria | 6241 |
| 131 | Ga0207662_10013187 | 3300025918 | Bacteria | 4620 |
| 132 | Ga0207657_10007233 | 3300025919 | Bacteria | 11402 |
| 133 | Ga0207652_10022823 | 3300025921 | Bacteria | 5182 |
| 134 | Ga0207652_10063432 | 3300025921 | Bacteria | 3196 |
| 135 | Ga0207646_10060961 | 3300025922 | Bacteria | 3368 |
| 136 | Ga0207681_10325197 | 3300025923 | Bacteria | 1224 |
| 137 | Ga0207694_10208260 | 3300025924 | Bacteria | 1592 |
| 138 | Ga0207659_10170347 | 3300025926 | Bacteria | 1717 |
| 139 | Ga0207687_10048405 | 3300025927 | Bacteria | 2951 |
| 140 | Ga0207687_10244018 | 3300025927 | Bacteria | 1425 |
| 141 | Ga0207700_10002812 | 3300025928 | Bacteria | 10019 |
| 142 | Ga0207700_10039246 | 3300025928 | Bacteria | 3445 |
| 143 | Ga0207700_10045067 | 3300025928 | Bacteria | 3252 |
| 144 | Ga0207700_10062716 | 3300025928 | Bacteria | 2824 |
| 145 | Ga0207700_10154204 | 3300025928 | Bacteria | 1901 |
| 146 | Ga0207664_10020657 | 3300025929 | Bacteria | 4885 |
| 147 | Ga0207664_10084855 | 3300025929 | Bacteria | 2584 |
| 148 | Ga0207686_10106819 | 3300025934 | Bacteria | 1880 |
| 149 | Ga0207669_10030731 | 3300025937 | Bacteria | 2989 |
| 150 | Ga0207665_10007368 | 3300025939 | Bacteria | 7271 |
| 151 | Ga0207665_10022416 | 3300025939 | Bacteria | 4155 |
| 152 | Ga0207665_10151550 | 3300025939 | Bacteria | 1661 |
| 153 | Ga0207691_10132551 | 3300025940 | Bacteria | 2200 |
| 154 | Ga0207711_10187412 | 3300025941 | Bacteria | 1884 |
| 155 | Ga0207689_10181199 | 3300025942 | Bacteria | 1737 |
| 156 | Ga0207667_10336410 | 3300025949 | Bacteria | 1541 |
| 157 | Ga0207712_10086259 | 3300025961 | Bacteria | 2299 |
| 158 | Ga0207658_10120550 | 3300025986 | Bacteria | 2091 |
| 159 | Ga0207639_10340670 | 3300026041 | Bacteria | 1336 |
| 160 | Ga0207678_10004235 | 3300026067 | Bacteria | 12868 |
| 161 | Ga0207678_10033573 | 3300026067 | Bacteria | 4470 |
| 162 | Ga0207702_10001780 | 3300026078 | Bacteria | 21210 |
| 163 | Ga0207676_10074063 | 3300026095 | Bacteria | 2742 |
| 164 | Ga0207674_10007559 | 3300026116 | Bacteria | 12661 |
| 165 | Ga0268266_10005119 | 3300028379 | Bacteria | 12356 |
| 166 | Ga0268265_10060694 | 3300028380 | Bacteria | 2899 |
| 167 | Ga0268265_10392202 | 3300028380 | Bacteria | 1281 |
| 168 | Ga0265338_10006282 | 3300028800 | Bacteria | 15190 |
| 169 | Ga0307511_10000019 | 3300030521 | Bacteria | 117947 |
| 170 | Ga0265760_10008551 | 3300031090 | Bacteria | 2925 |
| 171 | Ga0265325_10005403 | 3300031241 | Bacteria | 7894 |
| 172 | Ga0265325_10058116 | 3300031241 | Bacteria | 1971 |
| 173 | Ga0265339_10000084 | 3300031249 | Bacteria | 80035 |
| 174 | Ga0265327_10016124 | 3300031251 | Bacteria | 4771 |
| 175 | Ga0265327_10028019 | 3300031251 | Bacteria | 3231 |
| 176 | Ga0265313_10000011 | 3300031595 | Bacteria | 166182 |
| 177 | Ga0265314_10003957 | 3300031711 | Bacteria | 14046 |
| 178 | Ga0265342_10025808 | 3300031712 | Bacteria | 3688 |
| 179 | Ga0307510_10017164 | 3300033180 | Bacteria | 8539 |
| 180 | Ga0373923_0088430 | 3300035111 | Bacteria | 1352 |
| 181 | Ga0373945_0019651 | 3300035116 | Unclassified | 2308 |
| 182 | Ga0373954_0000211 | 3300035118 | Bacteria | 21214 |
| 183 | Ga0373956_0000624 | 3300035119 | Bacteria | 14512 |
| 184 | Ga0373943_0036894 | 3300035170 | Unclassified | 2343 |
| 185 | Ga0373931_0009045 | 3300035691 | Bacteria | 4749 |
| 186 | Ga0373935_0063324 | 3300035692 | Unclassified | 2370 |
| 187 | Ga0373927_0088836 | 3300035695 | Unclassified | 2006 |
| 188 | Ga0373933_0001889 | 3300035724 | Bacteria | 12082 |
| 189 | Ga0373933_0002626 | 3300035724 | Bacteria | 10071 |
| 190 | Ga0373947_0082513 | 3300035725 | Unclassified | 1992 |
| 191 | Ga0373947_0154533 | 3300035725 | Bacteria | 1480 |
| 192 | Ga0373937_0003544 | 3300036401 | Bacteria | 13143 |
| 193 | Ga0373937_0011676 | 3300036401 | Bacteria | 7705 |
| 194 | Ga0373925_0348267 | 3300037068 | Bacteria | 1202 |
| 195 | Ga0395900_0004389 | 3300037418 | Bacteria | 14971 |
| 196 | Ga0395898_0030232 | 3300037466 | Bacteria | 5421 |
| 197 | Ga0436364_0164328 | 3300037853 | Bacteria | 1806 |
| 198 | Ga0436364_0174146 | 3300037853 | Bacteria | 60383 |
| 199 | Ga0395901_0072567 | 3300038443 | Bacteria | 3589 |
| 200 | Ga0436365_0070962 | 3300039437 | Bacteria | 2602 |
| 201 | Ga0436365_0093274 | 3300039437 | Bacteria | 81442 |
| 202 | Ga0436365_0404766 | 3300039437 | Bacteria | 1301 |
| 203 | Ga0436365_0893985 | 3300039437 | Bacteria | 3293 |
| 204 | Ga0436365_1415392 | 3300039437 | Bacteria | 2565 |
| 205 | Ga0436365_1810429 | 3300039437 | Bacteria | 2912 |
| 206 | Ga0436360_0640162 | 3300039438 | Bacteria | 3192 |
| 207 | Ga0436362_0659930 | 3300039453 | Bacteria | 5596 |
| 208 | Ga0466963_0158199 | 3300044694 | Bacteria | 1576 |
| 209 | Ga0466964_0056960 | 3300044706 | Bacteria | 1617 |
| 210 | Ga0466968_0021948 | 3300044735 | Bacteria | 2590 |
| 211 | Ga0466957_0062741 | 3300044842 | Bacteria | 2283 |
| 212 | Ga0466959_0116917 | 3300045049 | Bacteria | 1898 |
| 213 | Ga0466967_0404202 | 3300045976 | Bacteria | 1329 |
| 214 | Ga0495629_0059637 | 3300046459 | Bacteria | 2667 |
| 215 | Ga0495638_0019138 | 3300046460 | Bacteria | 4534 |
| 216 | Ga0495651_0013345 | 3300046462 | Bacteria | 6356 |
| 217 | Ga0495651_0016873 | 3300046462 | Bacteria | 5655 |
| 218 | Ga0495653_0023914 | 3300046463 | Bacteria | 4931 |
| 219 | Ga0495639_0027455 | 3300046475 | Bacteria | 2520 |
| 220 | Ga0495662_0000302 | 3300046476 | Bacteria | 21424 |
| 221 | Ga0495664_0000860 | 3300046477 | Bacteria | 15590 |
| 222 | Ga0495608_0010208 | 3300046511 | Bacteria | 6554 |
| 223 | Ga0495610_0020393 | 3300046512 | Bacteria | 3681 |
| 224 | Ga0495618_0002304 | 3300046514 | Bacteria | 12368 |
| 225 | Ga0495648_0032030 | 3300046524 | Bacteria | 3456 |
| 226 | Ga0495666_0073292 | 3300046526 | Bacteria | 1625 |
| 227 | Ga0495652_0011068 | 3300046529 | Bacteria | 8174 |
| 228 | Ga0495665_0129593 | 3300046531 | Bacteria | 1320 |
| 229 | Ga0495640_0005371 | 3300046533 | Bacteria | 10191 |
| 230 | Ga0495640_0028164 | 3300046533 | Bacteria | 4047 |
| 231 | Ga0495640_0105233 | 3300046533 | Bacteria | 1849 |
| 232 | Ga0495587_0163404 | 3300046536 | Bacteria | 1266 |
| 233 | Ga0495645_0010934 | 3300046543 | Bacteria | 6376 |
| 234 | Ga0495667_0013229 | 3300046559 | Bacteria | 5588 |
| 235 | Ga0495634_0021724 | 3300046642 | Bacteria | 4530 |
| 236 | Ga0495634_0080605 | 3300046642 | Bacteria | 2130 |
| 237 | Ga0495611_0088727 | 3300046648 | Bacteria | 1428 |
| 238 | Ga0495635_0006160 | 3300046663 | Bacteria | 8361 |
| 239 | Ga0495635_0062636 | 3300046663 | Bacteria | 2554 |
| 240 | Ga0495657_0024259 | 3300046675 | Bacteria | 4322 |
| 241 | Ga0495599_0003706 | 3300046678 | Bacteria | 8956 |
| 242 | Ga0495623_0037018 | 3300046679 | Bacteria | 3125 |
| 243 | Ga0495646_0014297 | 3300046680 | Bacteria | 5049 |
| 244 | Ga0495624_0024817 | 3300046690 | Bacteria | 3943 |
| 245 | Ga0495600_0041009 | 3300046809 | Bacteria | 3017 |
| 246 | Ga0495604_0110894 | 3300047317 | Bacteria | 2001 |
| 247 | Ga0495674_0002679 | 3300047319 | Bacteria | 17337 |
| 248 | Ga0495674_0018280 | 3300047319 | Bacteria | 6527 |
| 249 | Ga0495676_0052544 | 3300047321 | Bacteria | 3252 |
| 250 | Ga0495676_0117254 | 3300047321 | Bacteria | 1943 |
| 251 | Ga0495680_0002674 | 3300047322 | Bacteria | 17996 |
| 252 | Ga0495673_0079080 | 3300047469 | Bacteria | 1365 |
| 253 | Ga0495684_0053284 | 3300047471 | Bacteria | 3086 |
| 254 | Ga0495602_0007206 | 3300048088 | Bacteria | 11654 |
| 255 | Ga0495602_0181284 | 3300048088 | Bacteria | 1624 |
| 256 | Ga0496100_0003963 | 3300048903 | Bacteria | 7781 |
| 257 | Ga0496100_0019355 | 3300048903 | Bacteria | 4059 |
| 258 | Ga0496100_0039030 | 3300048903 | Bacteria | 3013 |
| 259 | Ga0496101_0005181 | 3300048904 | Bacteria | 8293 |
| 260 | Ga0496101_0012282 | 3300048904 | Bacteria | 5711 |
| 261 | Ga0496102_0067919 | 3300048905 | Bacteria | 3270 |
| 262 | Ga0496102_0185254 | 3300048905 | Bacteria | 1962 |
| 263 | Ga0496102_0330801 | 3300048905 | Bacteria | 1435 |
| 264 | Ga0496104_0001623 | 3300048907 | Bacteria | 19411 |
| 265 | Ga0496104_0012032 | 3300048907 | Bacteria | 7766 |
| 266 | Ga0496104_0113810 | 3300048907 | Bacteria | 2594 |
| 267 | Ga0496105_0010690 | 3300048908 | Bacteria | 7223 |
| 268 | Ga0496105_0026382 | 3300048908 | Bacteria | 4738 |
| 269 | Ga0496105_0044819 | 3300048908 | Bacteria | 3649 |
| 270 | Ga0496106_0004886 | 3300048909 | Bacteria | 9925 |
| 271 | Ga0496106_0015145 | 3300048909 | Bacteria | 5706 |
| 272 | Ga0496106_0025167 | 3300048909 | Bacteria | 4427 |
| 273 | Ga0496106_0071831 | 3300048909 | Bacteria | 2646 |
| 274 | Ga0496108_0083927 | 3300048911 | Bacteria | 2703 |
| 275 | Ga0496108_0104781 | 3300048911 | Bacteria | 2414 |
| 276 | Ga0496108_0185946 | 3300048911 | Bacteria | 1800 |
| 277 | Ga0496108_0306439 | 3300048911 | Bacteria | 1384 |
| 278 | Ga0496109_0384873 | 3300048912 | Bacteria | 1325 |
| 279 | Ga0496110_0071397 | 3300048913 | Bacteria | 3078 |
| 280 | Ga0496111_0039233 | 3300048914 | Bacteria | 3395 |
| 281 | Ga0496113_0084026 | 3300048916 | Bacteria | 2443 |
| 282 | Ga0496114_0016535 | 3300048917 | Bacteria | 5946 |
| 283 | Ga0496114_0057858 | 3300048917 | Bacteria | 3237 |
| 284 | Ga0496114_0558654 | 3300048917 | Bacteria | 1011 |
| 285 | Ga0496115_0015400 | 3300048918 | Bacteria | 5800 |
| 286 | Ga0496115_0023853 | 3300048918 | Bacteria | 4750 |
| 287 | Ga0496115_0037240 | 3300048918 | Bacteria | 3855 |
| 288 | Ga0496115_0094398 | 3300048918 | Bacteria | 2447 |
| 289 | Ga0496115_0159803 | 3300048918 | Bacteria | 1862 |
| 290 | Ga0496115_0245640 | 3300048918 | Bacteria | 1475 |
| 291 | Ga0496116_0024097 | 3300048919 | Bacteria | 4510 |
| 292 | Ga0496117_0045899 | 3300048920 | Bacteria | 3150 |
| 293 | Ga0496118_0004841 | 3300048921 | Bacteria | 15697 |
| 294 | Ga0496121_0020084 | 3300048924 | Bacteria | 6636 |
| 295 | Ga0496121_0032051 | 3300048924 | Bacteria | 4785 |
| 296 | Ga0496121_0186502 | 3300048924 | Bacteria | 1491 |
| 297 | Ga0496126_0046121 | 3300048929 | Bacteria | 4001 |
| 298 | Ga0496126_0089222 | 3300048929 | Bacteria | 2714 |
| 299 | Ga0501080_0212550 | 3300049742 | Bacteria | 1772 |
| 300 | Ga0501083_0044891 | 3300049744 | Bacteria | 2991 |
| 301 | nmdc:mga03n38_44296_c1 | 3300050490 | Bacteria | 1954 |
| 302 | nmdc:mga00v17_85726_c1 | 3300050491 | Bacteria | 1973 |
| 303 | nmdc:mga0k408_62720_c1 | 3300050493 | Bacteria | 2162 |
| 304 | nmdc:mga06z11_264196_c1 | 3300050494 | Bacteria | 1016 |
| 305 | nmdc:mga0rr50_313050_c1 | 3300050513 | Unclassified | 1315 |
| 306 | nmdc:mga08x19_7833_c1 | 3300050514 | Bacteria | 6344 |
| 307 | nmdc:mga0a205_51285_c1 | 3300050515 | Bacteria | 3983 |
| 308 | Ga0495601_0000295 | 3300053077 | Bacteria | 26627 |
| 309 | Ga0495601_0015501 | 3300053077 | Bacteria | 4606 |
| 310 | Ga0495612_0003008 | 3300053078 | Bacteria | 6995 |
| 311 | Ga0495595_0070408 | 3300053084 | Unclassified | 1652 |
| 312 | Ga0495619_0003413 | 3300053085 | Bacteria | 10256 |
| 313 | Ga0495619_0015097 | 3300053085 | Bacteria | 4881 |
| 314 | Ga0500646_0000176 | 3300053090 | Bacteria | 19079 |
| 315 | Ga0500651_0012890 | 3300053093 | Bacteria | 5077 |
| 316 | Ga0500640_059017 | 3300053095 | Bacteria | 1666 |
| 317 | Ga0500595_015227 | 3300053119 | Bacteria | 2891 |
| 318 | Ga0500652_000006 | 3300053131 | Bacteria | 167437 |
| 319 | Ga0500590_051019 | 3300053148 | Bacteria | 2102 |
| 320 | Ga0500604_0005376 | 3300053151 | Bacteria | 3380 |
| 321 | Ga0500639_003518 | 3300053163 | Bacteria | 7901 |
| 322 | Ga0500601_000562 | 3300053737 | Bacteria | 5438 |
| 323 | Ga0501084_0116747 | 3300054114 | Bacteria | 2244 |
| 324 | 2513651162 | 2513237095 | Bacteria | 8976980 |
| 325 | 2818236759 | 2816332527 | Bacteria | 8933356 |
| 326 | 2824669161 | 2824661429 | Bacteria | 9877870 |
| 327 | 2874630130 | 2874628541 | Bacteria | 8630250 |
| 328 | 2879107911 | 2879099564 | Bacteria | 10442239 |
| 329 | 2888385681 | 2888378607 | Bacteria | 9652610 |
| 330 | 2932785183 | 2932784394 | Bacteria | 9704911 |
| 331 | 2932810210 | 2932809354 | Bacteria | 9135765 |
| 332 | 2932821783 | 2932818245 | Bacteria | 9955613 |
| 333 | 2932829019 | 2932828146 | Bacteria | 9745859 |
| 334 | 2935619561 | 2935616580 | Bacteria | 9032984 |
| 335 | 2935638541 | 2935638405 | Bacteria | 10015038 |
| 336 | 2935666607 | 2935665750 | Bacteria | 9571747 |
| 337 | 2935682209 | 2935675223 | Bacteria | 9928132 |
| 338 | 2935691135 | 2935684952 | Bacteria | 9590419 |
| 339 | 2935694434 | 2935694250 | Bacteria | 9291695 |
| 340 | 2935703547 | 2935703347 | Bacteria | 10242284 |
| 341 | 2935718516 | 2935713505 | Bacteria | 9608509 |
| 342 | 2935727504 | 2935722832 | Bacteria | 9608746 |
| 343 | 2935736207 | 2935732158 | Bacteria | 9706831 |
| 344 | 2935745587 | 2935741537 | Bacteria | 9707219 |
| 345 | 2935755968 | 2935750917 | Bacteria | 9590372 |
| 346 | 2935760770 | 2935760218 | Bacteria | 9817913 |
| 347 | 2935801684 | 2935801545 | Bacteria | 9301974 |
| 348 | 2935814900 | 2935810662 | Bacteria | 9401221 |
| 349 | 2935828035 | 2935827899 | Bacteria | 10038562 |
| 350 | 2935842241 | 2935837841 | Bacteria | 9454360 |
| 351 | 2935858123 | 2935855204 | Bacteria | 9035059 |
| 352 | 2935868028 | 2935864058 | Bacteria | 9784707 |
| 353 | 2935873949 | 2935873716 | Bacteria | 9632195 |
| 354 | 2935993127 | 2935992306 | Bacteria | 9802711 |
| 355 | 2936003064 | 2936002035 | Bacteria | 9362176 |
| 356 | 2936040457 | 2936037263 | Bacteria | 9446081 |
| 357 | 2940562057 | 2940556831 | Bacteria | 9590747 |
| 358 | 2941542289 | 2941538514 | Bacteria | 9402094 |
| 359 | 8016520442 | 8016511872 | Bacteria | 9921665 |
| 360 | 8017065133 | 8017057580 | Bacteria | 10023680 |
| 361 | 8019592293 | 8019586578 | Bacteria | 10212056 |
| 362 | 8019598991 | 8019597564 | Bacteria | 10041141 |
| 363 | Ga0466963_0164632 | |||
| 364 | JGI25406J46586_10000096 | |||
| 365 | JGI25153J46596_10004898 | |||
| 366 | Ga0055543_1007118 | |||
| 367 | Ga0065165_1000747 | |||
| 368 | Ga0070683_100019365 | |||
| 369 | Ga0070661_100140668 | |||
| 370 | Ga0070675_100037262 | |||
| 371 | Ga0070675_100213891 | |||
| 372 | Ga0070674_100039292 | |||
| 373 | Ga0070673_100026328 | |||
| 374 | Ga0070673_100294525 | |||
| 375 | Ga0070688_100031745 | |||
| 376 | Ga0070667_100188574 | |||
| 377 | Ga0070709_10010219 | |||
| 378 | Ga0070709_10060951 | |||
| 379 | Ga0070713_100005705 | |||
| 380 | Ga0070713_100026587 | |||
| 381 | Ga0070713_100036922 | |||
| 382 | Ga0070713_100049563 | |||
| 383 | Ga0070713_100066135 | |||
| 384 | Ga0070713_100107245 | |||
| 385 | Ga0070713_100191389 | |||
| 386 | Ga0070710_10004305 | |||
| 387 | Ga0070710_10007679 | |||
| 388 | Ga0070711_100097582 | |||
| 389 | Ga0070700_100073851 | |||
| 390 | Ga0070694_100229138 | |||
| 391 | Ga0070708_100120290 | |||
| 392 | Ga0070678_100054614 | |||
| 393 | Ga0070678_100070687 | |||
| 394 | Ga0070707_100191025 | |||
| 395 | Ga0070699_100006567 | |||
| 396 | Ga0070699_100080498 | |||
| 397 | Ga0070699_100290219 | |||
| 398 | Ga0070679_100048368 | |||
| 399 | Ga0070679_100051421 | |||
| 400 | Ga0070697_100068409 | |||
| 401 | Ga0068853_100008408 | |||
| 402 | Ga0068853_100357299 | |||
| 403 | Ga0070695_100082436 | |||
| 404 | Ga0070696_100100217 | |||
| 405 | Ga0070696_100158881 | |||
| 406 | Ga0070693_100070832 | |||
| 407 | Ga0070665_100163032 | |||
| 408 | Ga0070704_100112804 | |||
| 409 | Ga0068857_100017665 | |||
| 410 | Ga0068856_100000513 | |||
| 411 | Ga0068859_100295236 | |||
| 412 | Ga0068866_10211894 | |||
| 413 | Ga0068851_10098545 | |||
| 414 | Ga0068863_100111051 | |||
| 415 | Ga0068858_100218066 | |||
| 416 | Ga0081455_10046233 | |||
| 417 | Ga0081539_10000051 | |||
| 418 | Ga0081539_10002070 | |||
| 419 | Ga0081539_10007181 | |||
| 420 | Ga0070717_10011028 | |||
| 421 | Ga0070717_10032501 | |||
| 422 | Ga0070717_10090108 | |||
| 423 | Ga0070717_10092932 | |||
| 424 | Ga0075365_10138358 | |||
| 425 | Ga0075363_100010423 | |||
| 426 | Ga0075364_10042097 | |||
| 427 | Ga0070715_10052141 | |||
| 428 | Ga0070716_100026573 | |||
| 429 | Ga0070716_100110035 | |||
| 430 | Ga0070712_100002530 | |||
| 431 | Ga0070712_100028801 | |||
| 432 | Ga0075362_10006794 | |||
| 433 | Ga0075366_10006973 | |||
| 434 | Ga0075366_10025979 | |||
| 435 | Ga0075366_10071222 | |||
| 436 | Ga0075428_100320526 | |||
| 437 | Ga0075433_10030356 | |||
| 438 | Ga0075434_100485294 | |||
| 439 | Ga0068865_100162266 | |||
| 440 | Ga0097620_100295229 | |||
| 441 | Ga0075435_100012731 | |||
| 442 | Ga0075435_100144047 | |||
| 443 | Ga0111539_10130754 | |||
| 444 | Ga0105245_10056492 | |||
| 445 | Ga0114129_10520984 | |||
| 446 | Ga0114129_10873185 | |||
| 447 | Ga0105243_10018773 | |||
| 448 | Ga0105243_10049545 | |||
| 449 | Ga0105242_10014951 | |||
| 450 | Ga0105248_10193045 | |||
| 451 | Ga0105237_10014994 | |||
| 452 | Ga0105238_10021143 | |||
| 453 | Ga0105238_10037311 | |||
| 454 | Ga0105249_10096789 | |||
| 455 | Ga0157370_10017428 | |||
| 456 | Ga0157370_10250161 | |||
| 457 | Ga0157369_10003783 | |||
| 458 | Ga0157369_10013058 | |||
| 459 | Ga0157369_10022737 | |||
| 460 | Ga0163162_10042467 | |||
| 461 | Ga0163162_10061161 | |||
| 462 | Ga0157375_10156871 | |||
| 463 | Ga0163163_10190988 | |||
| 464 | Ga0157380_10164858 | |||
| 465 | Ga0157376_10106644 | |||
| 466 | Ga0163161_10148891 | |||
| 467 | Ga0213876_10000894 | |||
| 468 | Ga0213876_10011185 | |||
| 469 | Ga0213876_10049291 | |||
| 470 | Ga0213876_10099843 | |||
| 471 | Ga0213875_10000009 | |||
| 472 | Ga0228598_1002312 | |||
| 473 | Ga0209148_1000677 | |||
| 474 | Ga0209233_1007084 | |||
| 475 | Ga0209455_1001837 | |||
| 476 | Ga0209455_1014485 | |||
| 477 | Ga0209758_1003090 | |||
| 478 | Ga0209758_1010708 | |||
| 479 | Ga0207426_1001355 | |||
| 480 | Ga0207688_10044337 | |||
| 481 | Ga0207707_10001607 | |||
| 482 | Ga0207707_10059267 | |||
| 483 | Ga0207695_10035524 | |||
| 484 | Ga0207671_10073149 | |||
| 485 | Ga0207693_10003777 | |||
| 486 | Ga0207693_10015214 | |||
| 487 | Ga0207693_10021329 | |||
| 488 | Ga0207693_10061176 | |||
| 489 | Ga0207693_10088248 | |||
| 490 | Ga0207693_10109861 | |||
| 491 | Ga0207663_10201198 | |||
| 492 | Ga0207660_10009667 | |||
| 493 | Ga0207662_10013187 | |||
| 494 | Ga0207657_10007233 | |||
| 495 | Ga0207652_10022823 | |||
| 496 | Ga0207652_10063432 | |||
| 497 | Ga0207646_10060961 | |||
| 498 | Ga0207681_10325197 | |||
| 499 | Ga0207694_10208260 | |||
| 500 | Ga0207659_10170347 | |||
| 501 | Ga0207687_10048405 | |||
| 502 | Ga0207687_10244018 | |||
| 503 | Ga0207700_10002812 | |||
| 504 | Ga0207700_10039246 | |||
| 505 | Ga0207700_10045067 | |||
| 506 | Ga0207700_10062716 | |||
| 507 | Ga0207700_10154204 | |||
| 508 | Ga0207664_10020657 | |||
| 509 | Ga0207664_10084855 | |||
| 510 | Ga0207686_10106819 | |||
| 511 | Ga0207669_10030731 | |||
| 512 | Ga0207665_10007368 | |||
| 513 | Ga0207665_10022416 | |||
| 514 | Ga0207665_10151550 | |||
| 515 | Ga0207691_10132551 | |||
| 516 | Ga0207711_10187412 | |||
| 517 | Ga0207689_10181199 | |||
| 518 | Ga0207667_10336410 | |||
| 519 | Ga0207712_10086259 | |||
| 520 | Ga0207658_10120550 | |||
| 521 | Ga0207639_10340670 | |||
| 522 | Ga0207678_10004235 | |||
| 523 | Ga0207678_10033573 | |||
| 524 | Ga0207702_10001780 | |||
| 525 | Ga0207676_10074063 | |||
| 526 | Ga0207674_10007559 | |||
| 527 | Ga0268266_10005119 | |||
| 528 | Ga0268265_10060694 | |||
| 529 | Ga0268265_10392202 | |||
| 530 | Ga0265338_10006282 | |||
| 531 | Ga0307511_10000019 | |||
| 532 | Ga0265760_10008551 | |||
| 533 | Ga0265325_10005403 | |||
| 534 | Ga0265325_10058116 | |||
| 535 | Ga0265339_10000084 | |||
| 536 | Ga0265327_10016124 | |||
| 537 | Ga0265327_10028019 | |||
| 538 | Ga0265313_10000011 | |||
| 539 | Ga0265314_10003957 | |||
| 540 | Ga0265342_10025808 | |||
| 541 | Ga0307510_10017164 | |||
| 542 | Ga0373923_0088430 | |||
| 543 | Ga0373945_0019651 | |||
| 544 | Ga0373954_0000211 | |||
| 545 | Ga0373956_0000624 | |||
| 546 | Ga0373943_0036894 | |||
| 547 | Ga0373931_0009045 | |||
| 548 | Ga0373935_0063324 | |||
| 549 | Ga0373927_0088836 | |||
| 550 | Ga0373933_0001889 | |||
| 551 | Ga0373933_0002626 | |||
| 552 | Ga0373947_0082513 | |||
| 553 | Ga0373947_0154533 | |||
| 554 | Ga0373937_0003544 | |||
| 555 | Ga0373937_0011676 | |||
| 556 | Ga0373925_0348267 | |||
| 557 | Ga0395900_0004389 | |||
| 558 | Ga0395898_0030232 | |||
| 559 | Ga0436364_0164328 | |||
| 560 | Ga0436364_0174146 | |||
| 561 | Ga0395901_0072567 | |||
| 562 | Ga0436365_0070962 | |||
| 563 | Ga0436365_0093274 | |||
| 564 | Ga0436365_0404766 | |||
| 565 | Ga0436365_0893985 | |||
| 566 | Ga0436365_1415392 | |||
| 567 | Ga0436365_1810429 | |||
| 568 | Ga0436360_0640162 | |||
| 569 | Ga0436362_0659930 | |||
| 570 | Ga0466963_0158199 | |||
| 571 | Ga0466964_0056960 | |||
| 572 | Ga0466968_0021948 | |||
| 573 | Ga0466957_0062741 | |||
| 574 | Ga0466959_0116917 | |||
| 575 | Ga0466967_0404202 | |||
| 576 | Ga0495629_0059637 | |||
| 577 | Ga0495638_0019138 | |||
| 578 | Ga0495651_0013345 | |||
| 579 | Ga0495651_0016873 | |||
| 580 | Ga0495653_0023914 | |||
| 581 | Ga0495639_0027455 | |||
| 582 | Ga0495662_0000302 | |||
| 583 | Ga0495664_0000860 | |||
| 584 | Ga0495608_0010208 | |||
| 585 | Ga0495610_0020393 | |||
| 586 | Ga0495618_0002304 | |||
| 587 | Ga0495648_0032030 | |||
| 588 | Ga0495666_0073292 | |||
| 589 | Ga0495652_0011068 | |||
| 590 | Ga0495665_0129593 | |||
| 591 | Ga0495640_0005371 | |||
| 592 | Ga0495640_0028164 | |||
| 593 | Ga0495640_0105233 | |||
| 594 | Ga0495587_0163404 | |||
| 595 | Ga0495645_0010934 | |||
| 596 | Ga0495667_0013229 | |||
| 597 | Ga0495634_0021724 | |||
| 598 | Ga0495634_0080605 | |||
| 599 | Ga0495611_0088727 | |||
| 600 | Ga0495635_0006160 | |||
| 601 | Ga0495635_0062636 | |||
| 602 | Ga0495657_0024259 | |||
| 603 | Ga0495599_0003706 | |||
| 604 | Ga0495623_0037018 | |||
| 605 | Ga0495646_0014297 | |||
| 606 | Ga0495624_0024817 | |||
| 607 | Ga0495600_0041009 | |||
| 608 | Ga0495604_0110894 | |||
| 609 | Ga0495674_0002679 | |||
| 610 | Ga0495674_0018280 | |||
| 611 | Ga0495676_0052544 | |||
| 612 | Ga0495676_0117254 | |||
| 613 | Ga0495680_0002674 | |||
| 614 | Ga0495673_0079080 | |||
| 615 | Ga0495684_0053284 | |||
| 616 | Ga0495602_0007206 | |||
| 617 | Ga0495602_0181284 | |||
| 618 | Ga0496100_0003963 | |||
| 619 | Ga0496100_0019355 | |||
| 620 | Ga0496100_0039030 | |||
| 621 | Ga0496101_0005181 | |||
| 622 | Ga0496101_0012282 | |||
| 623 | Ga0496102_0067919 | |||
| 624 | Ga0496102_0185254 | |||
| 625 | Ga0496102_0330801 | |||
| 626 | Ga0496104_0001623 | |||
| 627 | Ga0496104_0012032 | |||
| 628 | Ga0496104_0113810 | |||
| 629 | Ga0496105_0010690 | |||
| 630 | Ga0496105_0026382 | |||
| 631 | Ga0496105_0044819 | |||
| 632 | Ga0496106_0004886 | |||
| 633 | Ga0496106_0015145 | |||
| 634 | Ga0496106_0025167 | |||
| 635 | Ga0496106_0071831 | |||
| 636 | Ga0496108_0083927 | |||
| 637 | Ga0496108_0104781 | |||
| 638 | Ga0496108_0185946 | |||
| 639 | Ga0496108_0306439 | |||
| 640 | Ga0496109_0384873 | |||
| 641 | Ga0496110_0071397 | |||
| 642 | Ga0496111_0039233 | |||
| 643 | Ga0496113_0084026 | |||
| 644 | Ga0496114_0016535 | |||
| 645 | Ga0496114_0057858 | |||
| 646 | Ga0496114_0558654 | |||
| 647 | Ga0496115_0015400 | |||
| 648 | Ga0496115_0023853 | |||
| 649 | Ga0496115_0037240 | |||
| 650 | Ga0496115_0094398 | |||
| 651 | Ga0496115_0159803 | |||
| 652 | Ga0496115_0245640 | |||
| 653 | Ga0496116_0024097 | |||
| 654 | Ga0496117_0045899 | |||
| 655 | Ga0496118_0004841 | |||
| 656 | Ga0496121_0020084 | |||
| 657 | Ga0496121_0032051 | |||
| 658 | Ga0496121_0186502 | |||
| 659 | Ga0496126_0046121 | |||
| 660 | Ga0496126_0089222 | |||
| 661 | Ga0501080_0212550 | |||
| 662 | Ga0501083_0044891 | |||
| 663 | nmdc:mga03n38_44296_c1 | |||
| 664 | nmdc:mga00v17_85726_c1 | |||
| 665 | nmdc:mga0k408_62720_c1 | |||
| 666 | nmdc:mga06z11_264196_c1 | |||
| 667 | nmdc:mga0rr50_313050_c1 | |||
| 668 | nmdc:mga08x19_7833_c1 | |||
| 669 | nmdc:mga0a205_51285_c1 | |||
| 670 | Ga0495601_0000295 | |||
| 671 | Ga0495601_0015501 | |||
| 672 | Ga0495612_0003008 | |||
| 673 | Ga0495595_0070408 | |||
| 674 | Ga0495619_0003413 | |||
| 675 | Ga0495619_0015097 | |||
| 676 | Ga0500646_0000176 | |||
| 677 | Ga0500651_0012890 | |||
| 678 | Ga0500640_059017 | |||
| 679 | Ga0500595_015227 | |||
| 680 | Ga0500652_000006 | |||
| 681 | Ga0500590_051019 | |||
| 682 | Ga0500604_0005376 | |||
| 683 | Ga0500639_003518 | |||
| 684 | Ga0500601_000562 | |||
| 685 | Ga0501084_0116747 | |||
| 686 | 2513651162 | |||
| 687 | 2818236759 | |||
| 688 | 2824669161 | |||
| 689 | 2874630130 | |||
| 690 | 2879107911 | |||
| 691 | 2888385681 | |||
| 692 | 2932785183 | |||
| 693 | 2932810210 | |||
| 694 | 2932821783 | |||
| 695 | 2932829019 | |||
| 696 | 2935619561 | |||
| 697 | 2935638541 | |||
| 698 | 2935666607 | |||
| 699 | 2935682209 | |||
| 700 | 2935691135 | |||
| 701 | 2935694434 | |||
| 702 | 2935703547 | |||
| 703 | 2935718516 | |||
| 704 | 2935727504 | |||
| 705 | 2935736207 | |||
| 706 | 2935745587 | |||
| 707 | 2935755968 | |||
| 708 | 2935760770 | |||
| 709 | 2935801684 | |||
| 710 | 2935814900 | |||
| 711 | 2935828035 | |||
| 712 | 2935842241 | |||
| 713 | 2935858123 | |||
| 714 | 2935868028 | |||
| 715 | 2935873949 | |||
| 716 | 2935993127 | |||
| 717 | 2936003064 | |||
| 718 | 2936040457 | |||
| 719 | 2940562057 | |||
| 720 | 2941542289 | |||
| 721 | 8016520442 | |||
| 722 | 8017065133 | |||
| 723 | 8019592293 | |||
| 724 | 8019598991 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f6k-assembly1.cif.gz_A | crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24 | 0.896 | 50 | 358 |
| 2f6k-assembly1.cif.gz_A | crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24 | 0.8905 | 50 | 358 |
| 7bp1-assembly1.cif.gz_D | crystal structure of 2, 3-dihydroxybenzoic acid decarboxylase from fusarium oxysporum in complex with catechol | 0.8672 | 50 | 358 |
| 4inf-assembly1.cif.gz_B | crystal structure of amidohydrolase saro_0799 (target efi-505250) from novosphingobium aromaticivorans dsm 12444 with bound calcium | 0.8605 | 50 | 358 |
| 4ofc-assembly1.cif.gz_A | 2.0 angstroms x-ray crystal structure of human 2-amino-3-carboxymuconate-6-semialdehye decarboxylase | 0.8583 | 52 | 358 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4icmA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.872 | 50 | 358 | 3.20.20.140 |
| 2f6kB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8701 | 50 | 358 | 3.20.20.140 |
| 2f6kB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8646 | 50 | 358 | 3.20.20.140 |
| 4ofcD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8528 | 51 | 358 | 3.20.20.140 |
| 4eraA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8528 | 50 | 362 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354UYE6-F1-model_v4 | Amidohydrolase | 0.9695 | 170 | 362 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A354UYE6-F1-model_v4 | Amidohydrolase | 0.9598 | 170 | 362 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A7C9L8F6-F1-model_v4 | Amidohydrolase family protein | 0.9531 | 50 | 362 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A2V8DJU2-F1-model_v4 | Amidohydrolase | 0.9413 | 123 | 362 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A5N7RU37-F1-model_v4 | Amidohydrolase | 0.9388 | 47 | 362 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |