F422698

General Info

Members Datasets Scaffolds Average Seq Length
362 260 724 358

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0164632|Ga0466963_0164632_221_1333
Length 370
Sequence MSRPSKAGPQHYASLDHGAACGCCTSRRGFLAAAAAFGASVALPAMPAVAQPASTKLIDTHHHFYPPEYQKAWGEWEDKRKIPHLGVQLAWTREHAFEAMDKAGITTGVLSLPSTPGVWFDAGPEAAHDMARLCSEFGAQMVRDRPGRYGLFAPLSMMDVDTTLKEIEYAFDTLKADGINLQSNYGDKWLGNPFYKPILEELNRRKAVVFVHPLVASCCDARLSVGAFPAVIEVPHDTTRTVVSLLLSGSLTRLRDITWLFSHGGGTIPFLAGRIEAFYDEKARGPNGFAPDGIEAEFRRLHYDTANATHPAAMAALQKLVPISQITYGTDYPYFALDQFSELRQLGLAPADLAAIESGNATRLLPRLKT

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
115 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
126 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
213 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
214 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
215 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
216 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
217 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
218 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
219 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
220 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
223 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
224 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
225 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
226 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
227 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
228 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
229 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
230 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
231 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
232 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
233 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
234 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
235 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
236 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
237 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
238 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
239 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
240 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
241 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
242 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
243 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
244 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
245 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
246 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
247 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
248 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
249 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
250 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
251 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
252 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
253 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
254 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
255 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
256 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
257 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
258 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
259 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
260 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.95
Metatranscriptomes 0.28
Isolates 10.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.29
Nodule 9.94
Rhizoplane 9.67
Rhizosphere 64.92
Stem 0
Stem Tuber 0
Unclassified 3.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0164632 3300044694 Bacteria 1544
2 JGI25406J46586_10000096 3300003203 Bacteria 39663
3 JGI25153J46596_10004898 3300003215 Bacteria 7118
4 Ga0055543_1007118 3300004625 Bacteria 2620
5 Ga0065165_1000747 3300005262 Bacteria 44635
6 Ga0070683_100019365 3300005329 Bacteria 6044
7 Ga0070661_100140668 3300005344 Bacteria 1819
8 Ga0070675_100037262 3300005354 Bacteria 3961
9 Ga0070675_100213891 3300005354 Bacteria 1677
10 Ga0070674_100039292 3300005356 Bacteria 3194
11 Ga0070673_100026328 3300005364 Bacteria 4294
12 Ga0070673_100294525 3300005364 Bacteria 1427
13 Ga0070688_100031745 3300005365 Bacteria 3180
14 Ga0070667_100188574 3300005367 Bacteria 1826
15 Ga0070709_10010219 3300005434 Bacteria 5190
16 Ga0070709_10060951 3300005434 Bacteria 2400
17 Ga0070713_100005705 3300005436 Bacteria 8548
18 Ga0070713_100026587 3300005436 Bacteria 4546
19 Ga0070713_100036922 3300005436 Bacteria 3947
20 Ga0070713_100049563 3300005436 Bacteria 3465
21 Ga0070713_100066135 3300005436 Bacteria 3039
22 Ga0070713_100107245 3300005436 Bacteria 2430
23 Ga0070713_100191389 3300005436 Unclassified 1843
24 Ga0070710_10004305 3300005437 Bacteria 6747
25 Ga0070710_10007679 3300005437 Bacteria 5230
26 Ga0070711_100097582 3300005439 Bacteria 2131
27 Ga0070700_100073851 3300005441 Bacteria 2184
28 Ga0070694_100229138 3300005444 Unclassified 1397
29 Ga0070708_100120290 3300005445 Bacteria 2422
30 Ga0070678_100054614 3300005456 Bacteria 2912
31 Ga0070678_100070687 3300005456 Bacteria 2611
32 Ga0070707_100191025 3300005468 Bacteria 1997
33 Ga0070699_100006567 3300005518 Bacteria 10121
34 Ga0070699_100080498 3300005518 Bacteria 2839
35 Ga0070699_100290219 3300005518 Bacteria 1466
36 Ga0070679_100048368 3300005530 Bacteria 4237
37 Ga0070679_100051421 3300005530 Bacteria 4104
38 Ga0070697_100068409 3300005536 Bacteria 2907
39 Ga0068853_100008408 3300005539 Bacteria 8291
40 Ga0068853_100357299 3300005539 Bacteria 1360
41 Ga0070695_100082436 3300005545 Bacteria 2129
42 Ga0070696_100100217 3300005546 Bacteria 2074
43 Ga0070696_100158881 3300005546 Bacteria 1664
44 Ga0070693_100070832 3300005547 Bacteria 2052
45 Ga0070665_100163032 3300005548 Bacteria 2231
46 Ga0070704_100112804 3300005549 Bacteria 2072
47 Ga0068857_100017665 3300005577 Bacteria 6254
48 Ga0068856_100000513 3300005614 Bacteria 42640
49 Ga0068859_100295236 3300005617 Bacteria 1714
50 Ga0068866_10211894 3300005718 Bacteria 1164
51 Ga0068851_10098545 3300005834 Bacteria 1548
52 Ga0068863_100111051 3300005841 Bacteria 2611
53 Ga0068858_100218066 3300005842 Bacteria 1806
54 Ga0081455_10046233 3300005937 Bacteria 3778
55 Ga0081539_10000051 3300005985 Bacteria 268337
56 Ga0081539_10002070 3300005985 Bacteria 30041
57 Ga0081539_10007181 3300005985 Bacteria 10265
58 Ga0070717_10011028 3300006028 Bacteria 6845
59 Ga0070717_10032501 3300006028 Bacteria 4205
60 Ga0070717_10090108 3300006028 Bacteria 2588
61 Ga0070717_10092932 3300006028 Bacteria 2549
62 Ga0075365_10138358 3300006038 Unclassified 1689
63 Ga0075363_100010423 3300006048 Bacteria 4415
64 Ga0075364_10042097 3300006051 Bacteria 2967
65 Ga0070715_10052141 3300006163 Bacteria 1763
66 Ga0070716_100026573 3300006173 Bacteria 3101
67 Ga0070716_100110035 3300006173 Bacteria 1706
68 Ga0070712_100002530 3300006175 Bacteria 11286
69 Ga0070712_100028801 3300006175 Bacteria 3718
70 Ga0075362_10006794 3300006177 Bacteria 4279
71 Ga0075366_10006973 3300006195 Bacteria 6222
72 Ga0075366_10025979 3300006195 Bacteria 3426
73 Ga0075366_10071222 3300006195 Bacteria 2071
74 Ga0075428_100320526 3300006844 Bacteria 1666
75 Ga0075433_10030356 3300006852 Bacteria 4611
76 Ga0075434_100485294 3300006871 Unclassified 1257
77 Ga0068865_100162266 3300006881 Bacteria 1706
78 Ga0097620_100295229 3300006931 Bacteria 1714
79 Ga0075435_100012731 3300007076 Bacteria 6233
80 Ga0075435_100144047 3300007076 Bacteria 2000
81 Ga0111539_10130754 3300009094 Bacteria 2940
82 Ga0105245_10056492 3300009098 Bacteria 3528
83 Ga0114129_10520984 3300009147 Bacteria 1550
84 Ga0114129_10873185 3300009147 Bacteria 1142
85 Ga0105243_10018773 3300009148 Bacteria 5238
86 Ga0105243_10049545 3300009148 Bacteria 3314
87 Ga0105242_10014951 3300009176 Bacteria 6016
88 Ga0105248_10193045 3300009177 Bacteria 2295
89 Ga0105237_10014994 3300009545 Bacteria 8077
90 Ga0105238_10021143 3300009551 Bacteria 6632
91 Ga0105238_10037311 3300009551 Bacteria 4940
92 Ga0105249_10096789 3300009553 Bacteria 2770
93 Ga0157370_10017428 3300013104 Bacteria 7247
94 Ga0157370_10250161 3300013104 Bacteria 1639
95 Ga0157369_10003783 3300013105 Bacteria 17976
96 Ga0157369_10013058 3300013105 Bacteria 9405
97 Ga0157369_10022737 3300013105 Bacteria 6991
98 Ga0163162_10042467 3300013306 Bacteria 4551
99 Ga0163162_10061161 3300013306 Bacteria 3804
100 Ga0157375_10156871 3300013308 Bacteria 2415
101 Ga0163163_10190988 3300014325 Bacteria 2097
102 Ga0157380_10164858 3300014326 Bacteria 1930
103 Ga0157376_10106644 3300014969 Bacteria 2458
104 Ga0163161_10148891 3300017792 Bacteria 1778
105 Ga0213876_10000894 3300021384 Bacteria 19913
106 Ga0213876_10011185 3300021384 Bacteria 4797
107 Ga0213876_10049291 3300021384 Bacteria 2225
108 Ga0213876_10099843 3300021384 Bacteria 1538
109 Ga0213875_10000009 3300021388 Bacteria 451129
110 Ga0228598_1002312 3300024227 Bacteria 4168
111 Ga0209148_1000677 3300025254 Bacteria 28498
112 Ga0209233_1007084 3300025261 Bacteria 3576
113 Ga0209455_1001837 3300025272 Bacteria 8887
114 Ga0209455_1014485 3300025272 Bacteria 1782
115 Ga0209758_1003090 3300025297 Bacteria 15771
116 Ga0209758_1010708 3300025297 Bacteria 5442
117 Ga0207426_1001355 3300025302 Bacteria 20765
118 Ga0207688_10044337 3300025901 Bacteria 2479
119 Ga0207707_10001607 3300025912 Bacteria 20820
120 Ga0207707_10059267 3300025912 Bacteria 3331
121 Ga0207695_10035524 3300025913 Bacteria 5403
122 Ga0207671_10073149 3300025914 Bacteria 2560
123 Ga0207693_10003777 3300025915 Bacteria 12900
124 Ga0207693_10015214 3300025915 Bacteria 6175
125 Ga0207693_10021329 3300025915 Bacteria 5149
126 Ga0207693_10061176 3300025915 Bacteria 2949
127 Ga0207693_10088248 3300025915 Bacteria 2431
128 Ga0207693_10109861 3300025915 Bacteria 2162
129 Ga0207663_10201198 3300025916 Bacteria 1437
130 Ga0207660_10009667 3300025917 Bacteria 6241
131 Ga0207662_10013187 3300025918 Bacteria 4620
132 Ga0207657_10007233 3300025919 Bacteria 11402
133 Ga0207652_10022823 3300025921 Bacteria 5182
134 Ga0207652_10063432 3300025921 Bacteria 3196
135 Ga0207646_10060961 3300025922 Bacteria 3368
136 Ga0207681_10325197 3300025923 Bacteria 1224
137 Ga0207694_10208260 3300025924 Bacteria 1592
138 Ga0207659_10170347 3300025926 Bacteria 1717
139 Ga0207687_10048405 3300025927 Bacteria 2951
140 Ga0207687_10244018 3300025927 Bacteria 1425
141 Ga0207700_10002812 3300025928 Bacteria 10019
142 Ga0207700_10039246 3300025928 Bacteria 3445
143 Ga0207700_10045067 3300025928 Bacteria 3252
144 Ga0207700_10062716 3300025928 Bacteria 2824
145 Ga0207700_10154204 3300025928 Bacteria 1901
146 Ga0207664_10020657 3300025929 Bacteria 4885
147 Ga0207664_10084855 3300025929 Bacteria 2584
148 Ga0207686_10106819 3300025934 Bacteria 1880
149 Ga0207669_10030731 3300025937 Bacteria 2989
150 Ga0207665_10007368 3300025939 Bacteria 7271
151 Ga0207665_10022416 3300025939 Bacteria 4155
152 Ga0207665_10151550 3300025939 Bacteria 1661
153 Ga0207691_10132551 3300025940 Bacteria 2200
154 Ga0207711_10187412 3300025941 Bacteria 1884
155 Ga0207689_10181199 3300025942 Bacteria 1737
156 Ga0207667_10336410 3300025949 Bacteria 1541
157 Ga0207712_10086259 3300025961 Bacteria 2299
158 Ga0207658_10120550 3300025986 Bacteria 2091
159 Ga0207639_10340670 3300026041 Bacteria 1336
160 Ga0207678_10004235 3300026067 Bacteria 12868
161 Ga0207678_10033573 3300026067 Bacteria 4470
162 Ga0207702_10001780 3300026078 Bacteria 21210
163 Ga0207676_10074063 3300026095 Bacteria 2742
164 Ga0207674_10007559 3300026116 Bacteria 12661
165 Ga0268266_10005119 3300028379 Bacteria 12356
166 Ga0268265_10060694 3300028380 Bacteria 2899
167 Ga0268265_10392202 3300028380 Bacteria 1281
168 Ga0265338_10006282 3300028800 Bacteria 15190
169 Ga0307511_10000019 3300030521 Bacteria 117947
170 Ga0265760_10008551 3300031090 Bacteria 2925
171 Ga0265325_10005403 3300031241 Bacteria 7894
172 Ga0265325_10058116 3300031241 Bacteria 1971
173 Ga0265339_10000084 3300031249 Bacteria 80035
174 Ga0265327_10016124 3300031251 Bacteria 4771
175 Ga0265327_10028019 3300031251 Bacteria 3231
176 Ga0265313_10000011 3300031595 Bacteria 166182
177 Ga0265314_10003957 3300031711 Bacteria 14046
178 Ga0265342_10025808 3300031712 Bacteria 3688
179 Ga0307510_10017164 3300033180 Bacteria 8539
180 Ga0373923_0088430 3300035111 Bacteria 1352
181 Ga0373945_0019651 3300035116 Unclassified 2308
182 Ga0373954_0000211 3300035118 Bacteria 21214
183 Ga0373956_0000624 3300035119 Bacteria 14512
184 Ga0373943_0036894 3300035170 Unclassified 2343
185 Ga0373931_0009045 3300035691 Bacteria 4749
186 Ga0373935_0063324 3300035692 Unclassified 2370
187 Ga0373927_0088836 3300035695 Unclassified 2006
188 Ga0373933_0001889 3300035724 Bacteria 12082
189 Ga0373933_0002626 3300035724 Bacteria 10071
190 Ga0373947_0082513 3300035725 Unclassified 1992
191 Ga0373947_0154533 3300035725 Bacteria 1480
192 Ga0373937_0003544 3300036401 Bacteria 13143
193 Ga0373937_0011676 3300036401 Bacteria 7705
194 Ga0373925_0348267 3300037068 Bacteria 1202
195 Ga0395900_0004389 3300037418 Bacteria 14971
196 Ga0395898_0030232 3300037466 Bacteria 5421
197 Ga0436364_0164328 3300037853 Bacteria 1806
198 Ga0436364_0174146 3300037853 Bacteria 60383
199 Ga0395901_0072567 3300038443 Bacteria 3589
200 Ga0436365_0070962 3300039437 Bacteria 2602
201 Ga0436365_0093274 3300039437 Bacteria 81442
202 Ga0436365_0404766 3300039437 Bacteria 1301
203 Ga0436365_0893985 3300039437 Bacteria 3293
204 Ga0436365_1415392 3300039437 Bacteria 2565
205 Ga0436365_1810429 3300039437 Bacteria 2912
206 Ga0436360_0640162 3300039438 Bacteria 3192
207 Ga0436362_0659930 3300039453 Bacteria 5596
208 Ga0466963_0158199 3300044694 Bacteria 1576
209 Ga0466964_0056960 3300044706 Bacteria 1617
210 Ga0466968_0021948 3300044735 Bacteria 2590
211 Ga0466957_0062741 3300044842 Bacteria 2283
212 Ga0466959_0116917 3300045049 Bacteria 1898
213 Ga0466967_0404202 3300045976 Bacteria 1329
214 Ga0495629_0059637 3300046459 Bacteria 2667
215 Ga0495638_0019138 3300046460 Bacteria 4534
216 Ga0495651_0013345 3300046462 Bacteria 6356
217 Ga0495651_0016873 3300046462 Bacteria 5655
218 Ga0495653_0023914 3300046463 Bacteria 4931
219 Ga0495639_0027455 3300046475 Bacteria 2520
220 Ga0495662_0000302 3300046476 Bacteria 21424
221 Ga0495664_0000860 3300046477 Bacteria 15590
222 Ga0495608_0010208 3300046511 Bacteria 6554
223 Ga0495610_0020393 3300046512 Bacteria 3681
224 Ga0495618_0002304 3300046514 Bacteria 12368
225 Ga0495648_0032030 3300046524 Bacteria 3456
226 Ga0495666_0073292 3300046526 Bacteria 1625
227 Ga0495652_0011068 3300046529 Bacteria 8174
228 Ga0495665_0129593 3300046531 Bacteria 1320
229 Ga0495640_0005371 3300046533 Bacteria 10191
230 Ga0495640_0028164 3300046533 Bacteria 4047
231 Ga0495640_0105233 3300046533 Bacteria 1849
232 Ga0495587_0163404 3300046536 Bacteria 1266
233 Ga0495645_0010934 3300046543 Bacteria 6376
234 Ga0495667_0013229 3300046559 Bacteria 5588
235 Ga0495634_0021724 3300046642 Bacteria 4530
236 Ga0495634_0080605 3300046642 Bacteria 2130
237 Ga0495611_0088727 3300046648 Bacteria 1428
238 Ga0495635_0006160 3300046663 Bacteria 8361
239 Ga0495635_0062636 3300046663 Bacteria 2554
240 Ga0495657_0024259 3300046675 Bacteria 4322
241 Ga0495599_0003706 3300046678 Bacteria 8956
242 Ga0495623_0037018 3300046679 Bacteria 3125
243 Ga0495646_0014297 3300046680 Bacteria 5049
244 Ga0495624_0024817 3300046690 Bacteria 3943
245 Ga0495600_0041009 3300046809 Bacteria 3017
246 Ga0495604_0110894 3300047317 Bacteria 2001
247 Ga0495674_0002679 3300047319 Bacteria 17337
248 Ga0495674_0018280 3300047319 Bacteria 6527
249 Ga0495676_0052544 3300047321 Bacteria 3252
250 Ga0495676_0117254 3300047321 Bacteria 1943
251 Ga0495680_0002674 3300047322 Bacteria 17996
252 Ga0495673_0079080 3300047469 Bacteria 1365
253 Ga0495684_0053284 3300047471 Bacteria 3086
254 Ga0495602_0007206 3300048088 Bacteria 11654
255 Ga0495602_0181284 3300048088 Bacteria 1624
256 Ga0496100_0003963 3300048903 Bacteria 7781
257 Ga0496100_0019355 3300048903 Bacteria 4059
258 Ga0496100_0039030 3300048903 Bacteria 3013
259 Ga0496101_0005181 3300048904 Bacteria 8293
260 Ga0496101_0012282 3300048904 Bacteria 5711
261 Ga0496102_0067919 3300048905 Bacteria 3270
262 Ga0496102_0185254 3300048905 Bacteria 1962
263 Ga0496102_0330801 3300048905 Bacteria 1435
264 Ga0496104_0001623 3300048907 Bacteria 19411
265 Ga0496104_0012032 3300048907 Bacteria 7766
266 Ga0496104_0113810 3300048907 Bacteria 2594
267 Ga0496105_0010690 3300048908 Bacteria 7223
268 Ga0496105_0026382 3300048908 Bacteria 4738
269 Ga0496105_0044819 3300048908 Bacteria 3649
270 Ga0496106_0004886 3300048909 Bacteria 9925
271 Ga0496106_0015145 3300048909 Bacteria 5706
272 Ga0496106_0025167 3300048909 Bacteria 4427
273 Ga0496106_0071831 3300048909 Bacteria 2646
274 Ga0496108_0083927 3300048911 Bacteria 2703
275 Ga0496108_0104781 3300048911 Bacteria 2414
276 Ga0496108_0185946 3300048911 Bacteria 1800
277 Ga0496108_0306439 3300048911 Bacteria 1384
278 Ga0496109_0384873 3300048912 Bacteria 1325
279 Ga0496110_0071397 3300048913 Bacteria 3078
280 Ga0496111_0039233 3300048914 Bacteria 3395
281 Ga0496113_0084026 3300048916 Bacteria 2443
282 Ga0496114_0016535 3300048917 Bacteria 5946
283 Ga0496114_0057858 3300048917 Bacteria 3237
284 Ga0496114_0558654 3300048917 Bacteria 1011
285 Ga0496115_0015400 3300048918 Bacteria 5800
286 Ga0496115_0023853 3300048918 Bacteria 4750
287 Ga0496115_0037240 3300048918 Bacteria 3855
288 Ga0496115_0094398 3300048918 Bacteria 2447
289 Ga0496115_0159803 3300048918 Bacteria 1862
290 Ga0496115_0245640 3300048918 Bacteria 1475
291 Ga0496116_0024097 3300048919 Bacteria 4510
292 Ga0496117_0045899 3300048920 Bacteria 3150
293 Ga0496118_0004841 3300048921 Bacteria 15697
294 Ga0496121_0020084 3300048924 Bacteria 6636
295 Ga0496121_0032051 3300048924 Bacteria 4785
296 Ga0496121_0186502 3300048924 Bacteria 1491
297 Ga0496126_0046121 3300048929 Bacteria 4001
298 Ga0496126_0089222 3300048929 Bacteria 2714
299 Ga0501080_0212550 3300049742 Bacteria 1772
300 Ga0501083_0044891 3300049744 Bacteria 2991
301 nmdc:mga03n38_44296_c1 3300050490 Bacteria 1954
302 nmdc:mga00v17_85726_c1 3300050491 Bacteria 1973
303 nmdc:mga0k408_62720_c1 3300050493 Bacteria 2162
304 nmdc:mga06z11_264196_c1 3300050494 Bacteria 1016
305 nmdc:mga0rr50_313050_c1 3300050513 Unclassified 1315
306 nmdc:mga08x19_7833_c1 3300050514 Bacteria 6344
307 nmdc:mga0a205_51285_c1 3300050515 Bacteria 3983
308 Ga0495601_0000295 3300053077 Bacteria 26627
309 Ga0495601_0015501 3300053077 Bacteria 4606
310 Ga0495612_0003008 3300053078 Bacteria 6995
311 Ga0495595_0070408 3300053084 Unclassified 1652
312 Ga0495619_0003413 3300053085 Bacteria 10256
313 Ga0495619_0015097 3300053085 Bacteria 4881
314 Ga0500646_0000176 3300053090 Bacteria 19079
315 Ga0500651_0012890 3300053093 Bacteria 5077
316 Ga0500640_059017 3300053095 Bacteria 1666
317 Ga0500595_015227 3300053119 Bacteria 2891
318 Ga0500652_000006 3300053131 Bacteria 167437
319 Ga0500590_051019 3300053148 Bacteria 2102
320 Ga0500604_0005376 3300053151 Bacteria 3380
321 Ga0500639_003518 3300053163 Bacteria 7901
322 Ga0500601_000562 3300053737 Bacteria 5438
323 Ga0501084_0116747 3300054114 Bacteria 2244
324 2513651162 2513237095 Bacteria 8976980
325 2818236759 2816332527 Bacteria 8933356
326 2824669161 2824661429 Bacteria 9877870
327 2874630130 2874628541 Bacteria 8630250
328 2879107911 2879099564 Bacteria 10442239
329 2888385681 2888378607 Bacteria 9652610
330 2932785183 2932784394 Bacteria 9704911
331 2932810210 2932809354 Bacteria 9135765
332 2932821783 2932818245 Bacteria 9955613
333 2932829019 2932828146 Bacteria 9745859
334 2935619561 2935616580 Bacteria 9032984
335 2935638541 2935638405 Bacteria 10015038
336 2935666607 2935665750 Bacteria 9571747
337 2935682209 2935675223 Bacteria 9928132
338 2935691135 2935684952 Bacteria 9590419
339 2935694434 2935694250 Bacteria 9291695
340 2935703547 2935703347 Bacteria 10242284
341 2935718516 2935713505 Bacteria 9608509
342 2935727504 2935722832 Bacteria 9608746
343 2935736207 2935732158 Bacteria 9706831
344 2935745587 2935741537 Bacteria 9707219
345 2935755968 2935750917 Bacteria 9590372
346 2935760770 2935760218 Bacteria 9817913
347 2935801684 2935801545 Bacteria 9301974
348 2935814900 2935810662 Bacteria 9401221
349 2935828035 2935827899 Bacteria 10038562
350 2935842241 2935837841 Bacteria 9454360
351 2935858123 2935855204 Bacteria 9035059
352 2935868028 2935864058 Bacteria 9784707
353 2935873949 2935873716 Bacteria 9632195
354 2935993127 2935992306 Bacteria 9802711
355 2936003064 2936002035 Bacteria 9362176
356 2936040457 2936037263 Bacteria 9446081
357 2940562057 2940556831 Bacteria 9590747
358 2941542289 2941538514 Bacteria 9402094
359 8016520442 8016511872 Bacteria 9921665
360 8017065133 8017057580 Bacteria 10023680
361 8019592293 8019586578 Bacteria 10212056
362 8019598991 8019597564 Bacteria 10041141
363 Ga0466963_0164632
364 JGI25406J46586_10000096
365 JGI25153J46596_10004898
366 Ga0055543_1007118
367 Ga0065165_1000747
368 Ga0070683_100019365
369 Ga0070661_100140668
370 Ga0070675_100037262
371 Ga0070675_100213891
372 Ga0070674_100039292
373 Ga0070673_100026328
374 Ga0070673_100294525
375 Ga0070688_100031745
376 Ga0070667_100188574
377 Ga0070709_10010219
378 Ga0070709_10060951
379 Ga0070713_100005705
380 Ga0070713_100026587
381 Ga0070713_100036922
382 Ga0070713_100049563
383 Ga0070713_100066135
384 Ga0070713_100107245
385 Ga0070713_100191389
386 Ga0070710_10004305
387 Ga0070710_10007679
388 Ga0070711_100097582
389 Ga0070700_100073851
390 Ga0070694_100229138
391 Ga0070708_100120290
392 Ga0070678_100054614
393 Ga0070678_100070687
394 Ga0070707_100191025
395 Ga0070699_100006567
396 Ga0070699_100080498
397 Ga0070699_100290219
398 Ga0070679_100048368
399 Ga0070679_100051421
400 Ga0070697_100068409
401 Ga0068853_100008408
402 Ga0068853_100357299
403 Ga0070695_100082436
404 Ga0070696_100100217
405 Ga0070696_100158881
406 Ga0070693_100070832
407 Ga0070665_100163032
408 Ga0070704_100112804
409 Ga0068857_100017665
410 Ga0068856_100000513
411 Ga0068859_100295236
412 Ga0068866_10211894
413 Ga0068851_10098545
414 Ga0068863_100111051
415 Ga0068858_100218066
416 Ga0081455_10046233
417 Ga0081539_10000051
418 Ga0081539_10002070
419 Ga0081539_10007181
420 Ga0070717_10011028
421 Ga0070717_10032501
422 Ga0070717_10090108
423 Ga0070717_10092932
424 Ga0075365_10138358
425 Ga0075363_100010423
426 Ga0075364_10042097
427 Ga0070715_10052141
428 Ga0070716_100026573
429 Ga0070716_100110035
430 Ga0070712_100002530
431 Ga0070712_100028801
432 Ga0075362_10006794
433 Ga0075366_10006973
434 Ga0075366_10025979
435 Ga0075366_10071222
436 Ga0075428_100320526
437 Ga0075433_10030356
438 Ga0075434_100485294
439 Ga0068865_100162266
440 Ga0097620_100295229
441 Ga0075435_100012731
442 Ga0075435_100144047
443 Ga0111539_10130754
444 Ga0105245_10056492
445 Ga0114129_10520984
446 Ga0114129_10873185
447 Ga0105243_10018773
448 Ga0105243_10049545
449 Ga0105242_10014951
450 Ga0105248_10193045
451 Ga0105237_10014994
452 Ga0105238_10021143
453 Ga0105238_10037311
454 Ga0105249_10096789
455 Ga0157370_10017428
456 Ga0157370_10250161
457 Ga0157369_10003783
458 Ga0157369_10013058
459 Ga0157369_10022737
460 Ga0163162_10042467
461 Ga0163162_10061161
462 Ga0157375_10156871
463 Ga0163163_10190988
464 Ga0157380_10164858
465 Ga0157376_10106644
466 Ga0163161_10148891
467 Ga0213876_10000894
468 Ga0213876_10011185
469 Ga0213876_10049291
470 Ga0213876_10099843
471 Ga0213875_10000009
472 Ga0228598_1002312
473 Ga0209148_1000677
474 Ga0209233_1007084
475 Ga0209455_1001837
476 Ga0209455_1014485
477 Ga0209758_1003090
478 Ga0209758_1010708
479 Ga0207426_1001355
480 Ga0207688_10044337
481 Ga0207707_10001607
482 Ga0207707_10059267
483 Ga0207695_10035524
484 Ga0207671_10073149
485 Ga0207693_10003777
486 Ga0207693_10015214
487 Ga0207693_10021329
488 Ga0207693_10061176
489 Ga0207693_10088248
490 Ga0207693_10109861
491 Ga0207663_10201198
492 Ga0207660_10009667
493 Ga0207662_10013187
494 Ga0207657_10007233
495 Ga0207652_10022823
496 Ga0207652_10063432
497 Ga0207646_10060961
498 Ga0207681_10325197
499 Ga0207694_10208260
500 Ga0207659_10170347
501 Ga0207687_10048405
502 Ga0207687_10244018
503 Ga0207700_10002812
504 Ga0207700_10039246
505 Ga0207700_10045067
506 Ga0207700_10062716
507 Ga0207700_10154204
508 Ga0207664_10020657
509 Ga0207664_10084855
510 Ga0207686_10106819
511 Ga0207669_10030731
512 Ga0207665_10007368
513 Ga0207665_10022416
514 Ga0207665_10151550
515 Ga0207691_10132551
516 Ga0207711_10187412
517 Ga0207689_10181199
518 Ga0207667_10336410
519 Ga0207712_10086259
520 Ga0207658_10120550
521 Ga0207639_10340670
522 Ga0207678_10004235
523 Ga0207678_10033573
524 Ga0207702_10001780
525 Ga0207676_10074063
526 Ga0207674_10007559
527 Ga0268266_10005119
528 Ga0268265_10060694
529 Ga0268265_10392202
530 Ga0265338_10006282
531 Ga0307511_10000019
532 Ga0265760_10008551
533 Ga0265325_10005403
534 Ga0265325_10058116
535 Ga0265339_10000084
536 Ga0265327_10016124
537 Ga0265327_10028019
538 Ga0265313_10000011
539 Ga0265314_10003957
540 Ga0265342_10025808
541 Ga0307510_10017164
542 Ga0373923_0088430
543 Ga0373945_0019651
544 Ga0373954_0000211
545 Ga0373956_0000624
546 Ga0373943_0036894
547 Ga0373931_0009045
548 Ga0373935_0063324
549 Ga0373927_0088836
550 Ga0373933_0001889
551 Ga0373933_0002626
552 Ga0373947_0082513
553 Ga0373947_0154533
554 Ga0373937_0003544
555 Ga0373937_0011676
556 Ga0373925_0348267
557 Ga0395900_0004389
558 Ga0395898_0030232
559 Ga0436364_0164328
560 Ga0436364_0174146
561 Ga0395901_0072567
562 Ga0436365_0070962
563 Ga0436365_0093274
564 Ga0436365_0404766
565 Ga0436365_0893985
566 Ga0436365_1415392
567 Ga0436365_1810429
568 Ga0436360_0640162
569 Ga0436362_0659930
570 Ga0466963_0158199
571 Ga0466964_0056960
572 Ga0466968_0021948
573 Ga0466957_0062741
574 Ga0466959_0116917
575 Ga0466967_0404202
576 Ga0495629_0059637
577 Ga0495638_0019138
578 Ga0495651_0013345
579 Ga0495651_0016873
580 Ga0495653_0023914
581 Ga0495639_0027455
582 Ga0495662_0000302
583 Ga0495664_0000860
584 Ga0495608_0010208
585 Ga0495610_0020393
586 Ga0495618_0002304
587 Ga0495648_0032030
588 Ga0495666_0073292
589 Ga0495652_0011068
590 Ga0495665_0129593
591 Ga0495640_0005371
592 Ga0495640_0028164
593 Ga0495640_0105233
594 Ga0495587_0163404
595 Ga0495645_0010934
596 Ga0495667_0013229
597 Ga0495634_0021724
598 Ga0495634_0080605
599 Ga0495611_0088727
600 Ga0495635_0006160
601 Ga0495635_0062636
602 Ga0495657_0024259
603 Ga0495599_0003706
604 Ga0495623_0037018
605 Ga0495646_0014297
606 Ga0495624_0024817
607 Ga0495600_0041009
608 Ga0495604_0110894
609 Ga0495674_0002679
610 Ga0495674_0018280
611 Ga0495676_0052544
612 Ga0495676_0117254
613 Ga0495680_0002674
614 Ga0495673_0079080
615 Ga0495684_0053284
616 Ga0495602_0007206
617 Ga0495602_0181284
618 Ga0496100_0003963
619 Ga0496100_0019355
620 Ga0496100_0039030
621 Ga0496101_0005181
622 Ga0496101_0012282
623 Ga0496102_0067919
624 Ga0496102_0185254
625 Ga0496102_0330801
626 Ga0496104_0001623
627 Ga0496104_0012032
628 Ga0496104_0113810
629 Ga0496105_0010690
630 Ga0496105_0026382
631 Ga0496105_0044819
632 Ga0496106_0004886
633 Ga0496106_0015145
634 Ga0496106_0025167
635 Ga0496106_0071831
636 Ga0496108_0083927
637 Ga0496108_0104781
638 Ga0496108_0185946
639 Ga0496108_0306439
640 Ga0496109_0384873
641 Ga0496110_0071397
642 Ga0496111_0039233
643 Ga0496113_0084026
644 Ga0496114_0016535
645 Ga0496114_0057858
646 Ga0496114_0558654
647 Ga0496115_0015400
648 Ga0496115_0023853
649 Ga0496115_0037240
650 Ga0496115_0094398
651 Ga0496115_0159803
652 Ga0496115_0245640
653 Ga0496116_0024097
654 Ga0496117_0045899
655 Ga0496118_0004841
656 Ga0496121_0020084
657 Ga0496121_0032051
658 Ga0496121_0186502
659 Ga0496126_0046121
660 Ga0496126_0089222
661 Ga0501080_0212550
662 Ga0501083_0044891
663 nmdc:mga03n38_44296_c1
664 nmdc:mga00v17_85726_c1
665 nmdc:mga0k408_62720_c1
666 nmdc:mga06z11_264196_c1
667 nmdc:mga0rr50_313050_c1
668 nmdc:mga08x19_7833_c1
669 nmdc:mga0a205_51285_c1
670 Ga0495601_0000295
671 Ga0495601_0015501
672 Ga0495612_0003008
673 Ga0495595_0070408
674 Ga0495619_0003413
675 Ga0495619_0015097
676 Ga0500646_0000176
677 Ga0500651_0012890
678 Ga0500640_059017
679 Ga0500595_015227
680 Ga0500652_000006
681 Ga0500590_051019
682 Ga0500604_0005376
683 Ga0500639_003518
684 Ga0500601_000562
685 Ga0501084_0116747
686 2513651162
687 2818236759
688 2824669161
689 2874630130
690 2879107911
691 2888385681
692 2932785183
693 2932810210
694 2932821783
695 2932829019
696 2935619561
697 2935638541
698 2935666607
699 2935682209
700 2935691135
701 2935694434
702 2935703547
703 2935718516
704 2935727504
705 2935736207
706 2935745587
707 2935755968
708 2935760770
709 2935801684
710 2935814900
711 2935828035
712 2935842241
713 2935858123
714 2935868028
715 2935873949
716 2935993127
717 2936003064
718 2936040457
719 2940562057
720 2941542289
721 8016520442
722 8017065133
723 8019592293
724 8019598991

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

58

367

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f6k-assembly1.cif.gz_A crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24 0.896 50 358
2f6k-assembly1.cif.gz_A crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24 0.8905 50 358
7bp1-assembly1.cif.gz_D crystal structure of 2, 3-dihydroxybenzoic acid decarboxylase from fusarium oxysporum in complex with catechol 0.8672 50 358
4inf-assembly1.cif.gz_B crystal structure of amidohydrolase saro_0799 (target efi-505250) from novosphingobium aromaticivorans dsm 12444 with bound calcium 0.8605 50 358
4ofc-assembly1.cif.gz_A 2.0 angstroms x-ray crystal structure of human 2-amino-3-carboxymuconate-6-semialdehye decarboxylase 0.8583 52 358
ID Description Score Start End Superfamily
4icmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.872 50 358 3.20.20.140
2f6kB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8701 50 358 3.20.20.140
2f6kB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8646 50 358 3.20.20.140
4ofcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8528 51 358 3.20.20.140
4eraA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8528 50 362 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A354UYE6-F1-model_v4 Amidohydrolase 0.9695 170 362 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A354UYE6-F1-model_v4 Amidohydrolase 0.9598 170 362 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A7C9L8F6-F1-model_v4 Amidohydrolase family protein 0.9531 50 362 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A2V8DJU2-F1-model_v4 Amidohydrolase 0.9413 123 362 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A5N7RU37-F1-model_v4 Amidohydrolase 0.9388 47 362 GO:0005737
GO:0016787
GO:0016831
GO:0019748

Map