F422642

General Info

Members Datasets Scaffolds Average Seq Length
362 233 724 318

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10031610|Ga0207428_100316102
Length 381
Sequence MGVDPIVPAVWSRTNREQVAITIACCLRDSPCIERASRINLSGNAASALAMEDRLKVRLTSILMSKIKVCYHGNCFDGVSSAAVFSRFYKERIHHDWEFVYQPVVHRAGALFDAELFDGDENAIVDFKYSNSPRLTWWFDHHKSAFLSPEDEAHFKADASGKKFLDAGYKSCAKFIAETARRKFGFDAAPMGELIHWANKIDGALYESAAEPVEMRADAFKLALVIENERDQQLIERVIRNLQTKPLSEVAKSPYIAGRVAPLYERHLRSMEIIKQNAEIIGPVVFFDVVGHDMEGYSKFVPYYLYPEVTYSVSVSLSSFRSKVSVGSNPWAPRPRAHDLAAICERYGGGGHAVVAAISLAPGELETARKIAAEIVEELRQ

Samples

Sample ID Description Type Environment
1 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
146 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
214 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
215 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
216 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
217 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
218 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
221 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 0.83
Rhizosphere 96.69
Stem 0
Stem Tuber 0
Unclassified 14.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207428_10031610 3300027907 Bacteria 4365
2 Ga0070658_10001907 3300005327 Bacteria 17611
3 Ga0070658_10095020 3300005327 Bacteria 2460
4 Ga0070683_100032105 3300005329 Bacteria 4779
5 Ga0070690_100003749 3300005330 Bacteria 8373
6 Ga0070670_100071215 3300005331 Bacteria 2985
7 Ga0070670_100087285 3300005331 Bacteria 2681
8 Ga0070670_100169581 3300005331 Bacteria 1893
9 Ga0070670_100287531 3300005331 Bacteria 1436
10 Ga0068869_100165635 3300005334 Bacteria 1724
11 Ga0068869_100300876 3300005334 Bacteria 1295
12 Ga0070666_10020844 3300005335 Bacteria 4242
13 Ga0070680_100115763 3300005336 Bacteria 2234
14 Ga0068868_100008908 3300005338 Bacteria 7193
15 Ga0070689_100013719 3300005340 Bacteria 5870
16 Ga0070689_100044582 3300005340 Bacteria 3412
17 Ga0070689_100070499 3300005340 Bacteria 2729
18 Ga0070687_100074246 3300005343 Bacteria 1835
19 Ga0070668_100156740 3300005347 Bacteria 1845
20 Ga0070669_100012747 3300005353 Bacteria 5968
21 Ga0070669_100295309 3300005353 Bacteria 1302
22 Ga0070675_100025810 3300005354 Bacteria 4711
23 Ga0070671_100009699 3300005355 Bacteria 7735
24 Ga0070671_100051749 3300005355 Bacteria 3416
25 Ga0070671_100146815 3300005355 Unclassified 1991
26 Ga0070673_100019254 3300005364 Bacteria 4899
27 Ga0070688_100205111 3300005365 Bacteria 1381
28 Ga0070659_100007431 3300005366 Bacteria 7961
29 Ga0070667_100009207 3300005367 Bacteria 8176
30 Ga0070667_100360445 3300005367 Bacteria 1318
31 Ga0070714_100006738 3300005435 Bacteria 8901
32 Ga0070714_100080048 3300005435 Unclassified 2842
33 Ga0070713_100001996 3300005436 Bacteria 13164
34 Ga0070711_100007934 3300005439 Bacteria 6475
35 Ga0070694_100001408 3300005444 Bacteria 14078
36 Ga0070708_100199903 3300005445 Bacteria 1871
37 Ga0070663_100059661 3300005455 Bacteria 2742
38 Ga0070678_100091354 3300005456 Bacteria 2336
39 Ga0070662_100136148 3300005457 Bacteria 1899
40 Ga0070681_10067991 3300005458 Bacteria 3530
41 Ga0068867_100137522 3300005459 Unclassified 1906
42 Ga0068867_100247020 3300005459 Bacteria 1450
43 Ga0070685_10012245 3300005466 Bacteria 4501
44 Ga0070685_10015280 3300005466 Bacteria 4077
45 Ga0070707_100006078 3300005468 Bacteria 11262
46 Ga0070679_100020139 3300005530 Bacteria 6500
47 Ga0070679_100022936 3300005530 Bacteria 6104
48 Ga0070684_100143782 3300005535 Bacteria 2158
49 Ga0070684_100405092 3300005535 Bacteria 1258
50 Ga0068853_100028432 3300005539 Unclassified 4703
51 Ga0068853_100187190 3300005539 Unclassified 1880
52 Ga0070696_100001187 3300005546 Bacteria 16897
53 Ga0070693_100107227 3300005547 Unclassified 1712
54 Ga0070665_100067823 3300005548 Bacteria 3577
55 Ga0070665_100123258 3300005548 Unclassified 2594
56 Ga0070665_100399600 3300005548 Bacteria 1382
57 Ga0068855_100006245 3300005563 Bacteria 14528
58 Ga0070664_100023317 3300005564 Bacteria 5111
59 Ga0070664_100067872 3300005564 Unclassified 3048
60 Ga0070664_100091564 3300005564 Bacteria 2632
61 Ga0068857_100318376 3300005577 Bacteria 1436
62 Ga0068856_100009479 3300005614 Bacteria 9453
63 Ga0068856_100078178 3300005614 Bacteria 3280
64 Ga0070702_100004207 3300005615 Bacteria 6546
65 Ga0068852_100474075 3300005616 Bacteria 1243
66 Ga0068859_100016664 3300005617 Bacteria 7378
67 Ga0068859_100061501 3300005617 Bacteria 3783
68 Ga0068859_100067577 3300005617 Bacteria 3608
69 Ga0068859_100128064 3300005617 Unclassified 2609
70 Ga0068859_100398594 3300005617 Bacteria 1472
71 Ga0068864_100007581 3300005618 Bacteria 8942
72 Ga0068864_100395307 3300005618 Bacteria 1313
73 Ga0068851_10067099 3300005834 Unclassified 1850
74 Ga0068863_100021839 3300005841 Bacteria 6108
75 Ga0068863_100029721 3300005841 Bacteria 5217
76 Ga0068863_100149626 3300005841 Bacteria 2233
77 Ga0068863_100169606 3300005841 Bacteria 2093
78 Ga0068858_100015620 3300005842 Bacteria 7140
79 Ga0068860_100015626 3300005843 Bacteria 7411
80 Ga0068860_100143111 3300005843 Bacteria 2299
81 Ga0081455_10016548 3300005937 Bacteria 7115
82 Ga0081455_10026668 3300005937 Bacteria 5307
83 Ga0081539_10000924 3300005985 Bacteria 55237
84 Ga0081539_10054347 3300005985 Bacteria 2236
85 Ga0070712_100034377 3300006175 Bacteria 3435
86 Ga0097621_100109413 3300006237 Bacteria 2334
87 Ga0068871_100017802 3300006358 Bacteria 5386
88 Ga0068871_100060736 3300006358 Bacteria 3084
89 Ga0075428_100056024 3300006844 Bacteria 4319
90 Ga0075431_100011881 3300006847 Bacteria 8788
91 Ga0075433_10152241 3300006852 Bacteria 2057
92 Ga0068865_100039553 3300006881 Bacteria 3199
93 Ga0097620_100016664 3300006931 Bacteria 7378
94 Ga0097620_100061500 3300006931 Bacteria 3783
95 Ga0097620_100067578 3300006931 Bacteria 3608
96 Ga0097620_100128060 3300006931 Unclassified 2609
97 Ga0097620_100398587 3300006931 Bacteria 1472
98 Ga0105251_10023169 3300009011 Bacteria 3209
99 Ga0105240_10010392 3300009093 Bacteria 13082
100 Ga0105240_10135603 3300009093 Bacteria 2948
101 Ga0105240_10347960 3300009093 Bacteria 1682
102 Ga0111539_10265024 3300009094 Bacteria 2000
103 Ga0111539_10408345 3300009094 Bacteria 1582
104 Ga0111539_10529515 3300009094 Bacteria 1373
105 Ga0105245_10070479 3300009098 Bacteria 3172
106 Ga0105245_10703844 3300009098 Bacteria 1044
107 Ga0105247_10008564 3300009101 Bacteria 6232
108 Ga0114129_10066556 3300009147 Bacteria 5026
109 Ga0105242_10007180 3300009176 Bacteria 8590
110 Ga0105242_10032609 3300009176 Bacteria 4166
111 Ga0105242_10195726 3300009176 Bacteria 1792
112 Ga0105248_10072623 3300009177 Bacteria 3867
113 Ga0105248_10169747 3300009177 Bacteria 2459
114 Ga0105248_10470170 3300009177 Bacteria 1417
115 Ga0105237_10120801 3300009545 Bacteria 2614
116 Ga0105249_10020180 3300009553 Bacteria 5954
117 Ga0105249_10424129 3300009553 Bacteria 1365
118 Ga0105239_10085999 3300010375 Bacteria 3466
119 Ga0157373_10074010 3300013100 Unclassified 2403
120 Ga0157373_10164708 3300013100 Bacteria 1560
121 Ga0157370_10097637 3300013104 Bacteria 2756
122 Ga0157370_10211349 3300013104 Bacteria 1798
123 Ga0157369_10072168 3300013105 Bacteria 3705
124 Ga0157369_10146568 3300013105 Unclassified 2496
125 Ga0157378_10002849 3300013297 Bacteria 15423
126 Ga0157378_10082076 3300013297 Unclassified 2915
127 Ga0163162_10023101 3300013306 Bacteria 6135
128 Ga0163162_10071609 3300013306 Bacteria 3520
129 Ga0163162_10136727 3300013306 Bacteria 2562
130 Ga0163162_10269971 3300013306 Unclassified 1833
131 Ga0157372_10011261 3300013307 Bacteria 9513
132 Ga0157372_10231831 3300013307 Bacteria 2141
133 Ga0157375_10017212 3300013308 Bacteria 6518
134 Ga0157375_10049925 3300013308 Bacteria 4102
135 Ga0157375_10177121 3300013308 Bacteria 2283
136 Ga0163163_10008251 3300014325 Bacteria 9246
137 Ga0163163_10115140 3300014325 Bacteria 2720
138 Ga0157380_10014296 3300014326 Bacteria 5807
139 Ga0157380_10021380 3300014326 Bacteria 4853
140 Ga0157380_10072914 3300014326 Bacteria 2783
141 Ga0157379_10032819 3300014968 Unclassified 4630
142 Ga0157376_10021257 3300014969 Bacteria 5039
143 Ga0157376_10031862 3300014969 Unclassified 4227
144 Ga0157376_10150619 3300014969 Unclassified 2097
145 Ga0163161_10001560 3300017792 Bacteria 16910
146 Ga0163161_10018216 3300017792 Unclassified 4923
147 Ga0213875_10009232 3300021388 Bacteria 5004
148 Ga0213875_10033689 3300021388 Bacteria 2419
149 Ga0213875_10094292 3300021388 Bacteria 1396
150 Ga0207656_10049044 3300025321 Unclassified 1820
151 Ga0207710_10078750 3300025900 Bacteria 1525
152 Ga0207680_10149197 3300025903 Bacteria 1557
153 Ga0207699_10016995 3300025906 Bacteria 3818
154 Ga0207705_10377552 3300025909 Bacteria 1095
155 Ga0207707_10063289 3300025912 Bacteria 3220
156 Ga0207707_10337145 3300025912 Unclassified 1300
157 Ga0207695_10011788 3300025913 Bacteria 10551
158 Ga0207671_10163235 3300025914 Bacteria 1726
159 Ga0207663_10021907 3300025916 Bacteria 3645
160 Ga0207662_10106647 3300025918 Bacteria 1743
161 Ga0207657_10040603 3300025919 Unclassified 4121
162 Ga0207652_10275358 3300025921 Unclassified 1518
163 Ga0207646_10005012 3300025922 Bacteria 14108
164 Ga0207681_10184317 3300025923 Bacteria 1592
165 Ga0207650_10050488 3300025925 Bacteria 3076
166 Ga0207650_10130237 3300025925 Bacteria 1968
167 Ga0207659_10228474 3300025926 Bacteria 1500
168 Ga0207659_10511135 3300025926 Unclassified 1018
169 Ga0207700_10011944 3300025928 Bacteria 5569
170 Ga0207664_10001101 3300025929 Bacteria 17996
171 Ga0207644_10016009 3300025931 Bacteria 5041
172 Ga0207644_10080571 3300025931 Bacteria 2405
173 Ga0207706_10007367 3300025933 Bacteria 10168
174 Ga0207706_10079129 3300025933 Bacteria 2891
175 Ga0207686_10030798 3300025934 Bacteria 3181
176 Ga0207709_10341744 3300025935 Bacteria 1127
177 Ga0207670_10050721 3300025936 Bacteria 2783
178 Ga0207704_10063908 3300025938 Bacteria 2297
179 Ga0207711_10010238 3300025941 Bacteria 7785
180 Ga0207661_10106008 3300025944 Bacteria 2369
181 Ga0207679_10176382 3300025945 Bacteria 1764
182 Ga0207651_10277459 3300025960 Unclassified 1383
183 Ga0207712_10022758 3300025961 Bacteria 4131
184 Ga0207712_10038931 3300025961 Bacteria 3254
185 Ga0207668_10087172 3300025972 Bacteria 2282
186 Ga0207658_10006381 3300025986 Bacteria 8051
187 Ga0207677_10011691 3300026023 Bacteria 5013
188 Ga0207677_10274344 3300026023 Bacteria 1381
189 Ga0207703_10004686 3300026035 Bacteria 11169
190 Ga0207639_10121010 3300026041 Bacteria 2151
191 Ga0207639_10158065 3300026041 Unclassified 1907
192 Ga0207708_10487249 3300026075 Bacteria 1032
193 Ga0207702_10216310 3300026078 Unclassified 1784
194 Ga0207641_10002083 3300026088 Bacteria 18951
195 Ga0207641_10024743 3300026088 Bacteria 4949
196 Ga0207641_10055601 3300026088 Unclassified 3361
197 Ga0207648_10234551 3300026089 Bacteria 1633
198 Ga0207648_10292006 3300026089 Bacteria 1460
199 Ga0207676_10001676 3300026095 Bacteria 16337
200 Ga0207676_10025825 3300026095 Bacteria 4361
201 Ga0207674_10010173 3300026116 Bacteria 10687
202 Ga0207674_10049239 3300026116 Bacteria 4311
203 Ga0207674_10065226 3300026116 Bacteria 3671
204 Ga0207698_10097349 3300026142 Bacteria 2428
205 Ga0268266_10427399 3300028379 Bacteria 1256
206 Ga0268265_10050544 3300028380 Unclassified 3133
207 Ga0268265_10139594 3300028380 Bacteria 2027
208 Ga0268264_10015912 3300028381 Bacteria 6162
209 Ga0265334_10024765 3300028573 Unclassified 2432
210 Ga0265318_10000263 3300028577 Bacteria 45526
211 Ga0265318_10016092 3300028577 Bacteria 3095
212 Ga0265323_10001542 3300028653 Bacteria 11154
213 Ga0265338_10184896 3300028800 Bacteria 1585
214 Ga0265760_10022632 3300031090 Bacteria 1822
215 Ga0265330_10008015 3300031235 Bacteria 5115
216 Ga0265330_10051177 3300031235 Unclassified 1811
217 Ga0265332_10000287 3300031238 Bacteria 39650
218 Ga0265328_10000629 3300031239 Bacteria 16322
219 Ga0265320_10045004 3300031240 Bacteria 2170
220 Ga0265329_10001509 3300031242 Bacteria 11144
221 Ga0265339_10111865 3300031249 Bacteria 1412
222 Ga0265331_10023143 3300031250 Bacteria 3161
223 Ga0265316_10003021 3300031344 Bacteria 17193
224 Ga0265316_10006581 3300031344 Bacteria 11081
225 Ga0265316_10007626 3300031344 Bacteria 10164
226 Ga0265316_10143652 3300031344 Bacteria 1791
227 Ga0265316_10206406 3300031344 Bacteria 1455
228 Ga0307408_100234056 3300031548 Bacteria 1506
229 Ga0265313_10007652 3300031595 Bacteria 7324
230 Ga0265314_10202413 3300031711 Bacteria 1172
231 Ga0265342_10000997 3300031712 Bacteria 27918
232 Ga0316576_10000183 3300031727 Bacteria 26128
233 Ga0316578_10165158 3300031728 Unclassified 1334
234 Ga0307405_10008631 3300031731 Bacteria 5178
235 Ga0316577_10021815 3300031733 Bacteria 3553
236 Ga0307413_10000565 3300031824 Bacteria 12421
237 Ga0307413_10009705 3300031824 Bacteria 4620
238 Ga0307413_10017621 3300031824 Bacteria 3724
239 Ga0307410_10007459 3300031852 Bacteria 5989
240 Ga0307410_10032302 3300031852 Bacteria 3367
241 Ga0307410_10369889 3300031852 Bacteria 1150
242 Ga0307406_10027485 3300031901 Unclassified 3429
243 Ga0307406_10033145 3300031901 Bacteria 3159
244 Ga0307407_10001419 3300031903 Bacteria 8665
245 Ga0307407_10001554 3300031903 Bacteria 8435
246 Ga0307407_10008533 3300031903 Bacteria 4711
247 Ga0307407_10078144 3300031903 Bacteria 1993
248 Ga0307407_10132618 3300031903 Bacteria 1596
249 Ga0307412_10045211 3300031911 Bacteria 2877
250 Ga0307412_10166870 3300031911 Bacteria 1642
251 Ga0307412_10214952 3300031911 Unclassified 1470
252 Ga0307409_100067886 3300031995 Bacteria 2817
253 Ga0307409_100181253 3300031995 Bacteria 1865
254 Ga0307416_100023150 3300032002 Bacteria 4502
255 Ga0307416_100023498 3300032002 Bacteria 4475
256 Ga0307416_100036916 3300032002 Bacteria 3754
257 Ga0307416_100422311 3300032002 Bacteria 1378
258 Ga0307414_10052833 3300032004 Bacteria 2830
259 Ga0307414_10134909 3300032004 Bacteria 1923
260 Ga0307414_10338283 3300032004 Bacteria 1287
261 Ga0307411_10003481 3300032005 Bacteria 7312
262 Ga0307411_10013337 3300032005 Unclassified 4531
263 Ga0307411_10083835 3300032005 Bacteria 2203
264 Ga0307411_10141488 3300032005 Bacteria 1774
265 Ga0307415_100041112 3300032126 Bacteria 3067
266 Ga0307415_100238585 3300032126 Unclassified 1469
267 Ga0307415_100264153 3300032126 Unclassified 1406
268 Ga0373923_0012408 3300035111 Unclassified 3149
269 Ga0373953_0038609 3300035117 Unclassified 1890
270 Ga0373954_0032699 3300035118 Bacteria 2406
271 Ga0373927_0000958 3300035695 Bacteria 22007
272 Ga0373947_0000524 3300035725 Bacteria 22377
273 Ga0373947_0321241 3300035725 Unclassified 1035
274 Ga0373937_0044753 3300036401 Bacteria 4043
275 Ga0316584_0000538 3300036712 Bacteria 20268
276 Ga0373925_0001782 3300037068 Bacteria 17977
277 Ga0373925_0034535 3300037068 Bacteria 3728
278 Ga0395905_0000584 3300037471 Bacteria 49066
279 Ga0395905_0056737 3300037471 Bacteria 3663
280 Ga0436364_0079763 3300037853 Bacteria 2497
281 Ga0436364_0214612 3300037853 Bacteria 30361
282 Ga0436364_0323603 3300037853 Bacteria 2085
283 Ga0436365_1587825 3300039437 Bacteria 3068
284 Ga0451837_0819436 3300041494 Bacteria 1537
285 Ga0451577_0123925 3300042876 Unclassified 2316
286 Ga0451577_0227884 3300042876 Bacteria 1685
287 Ga0466966_0130469 3300044684 Unclassified 1539
288 Ga0451576_0062119 3300045051 Bacteria 3895
289 Ga0466958_0045808 3300045836 Bacteria 2639
290 Ga0495651_0081061 3300046462 Bacteria 2450
291 Ga0495653_0172460 3300046463 Unclassified 1492
292 Ga0495580_0002595 3300046472 Bacteria 15709
293 Ga0495580_0164485 3300046472 Bacteria 1535
294 Ga0495664_0001085 3300046477 Bacteria 14059
295 Ga0495608_0050293 3300046511 Bacteria 2765
296 Ga0495628_0075307 3300046516 Bacteria 2629
297 Ga0495587_0025655 3300046536 Unclassified 3600
298 Ga0495645_0002942 3300046543 Bacteria 11543
299 Ga0495645_0082788 3300046543 Unclassified 2301
300 Ga0495667_0048399 3300046559 Bacteria 2807
301 Ga0495667_0090190 3300046559 Unclassified 1986
302 Ga0495635_0047736 3300046663 Unclassified 2952
303 Ga0495599_0011066 3300046678 Bacteria 5535
304 Ga0495599_0072746 3300046678 Bacteria 2146
305 Ga0495623_0069149 3300046679 Unclassified 2201
306 Ga0495623_0092741 3300046679 Bacteria 1850
307 Ga0495646_0029783 3300046680 Unclassified 3410
308 Ga0495636_0047832 3300047318 Bacteria 1787
309 Ga0495674_0012274 3300047319 Bacteria 8075
310 Ga0495674_0244683 3300047319 Bacteria 1477
311 Ga0495675_0009790 3300047444 Bacteria 5977
312 Ga0495675_0017953 3300047444 Bacteria 4486
313 Ga0495684_0002037 3300047471 Bacteria 16268
314 Ga0495684_0017282 3300047471 Bacteria 5553
315 Ga0495684_0334824 3300047471 Bacteria 1079
316 Ga0495602_0156499 3300048088 Bacteria 1784
317 Ga0496105_0018469 3300048908 Bacteria 5606
318 Ga0496109_0000023 3300048912 Bacteria 187904
319 Ga0496114_0047150 3300048917 Bacteria 3583
320 Ga0501298_003253 3300049521 Unclassified 2515
321 Ga0501032_0000350 3300049569 Bacteria 38526
322 Ga0501033_0006975 3300049570 Bacteria 8821
323 Ga0501034_0174263 3300049571 Bacteria 2117
324 Ga0501036_0031107 3300049572 Bacteria 4510
325 Ga0501037_0028516 3300049573 Bacteria 4124
326 Ga0501038_0006384 3300049574 Bacteria 10916
327 Ga0501039_0003704 3300049575 Bacteria 11471
328 Ga0501047_0081628 3300049581 Bacteria 3108
329 Ga0501048_0018700 3300049582 Bacteria 5093
330 Ga0501068_0000592 3300049584 Bacteria 18422
331 Ga0501069_0000790 3300049585 Bacteria 14887
332 Ga0501070_0013796 3300049586 Bacteria 6805
333 Ga0501072_0005941 3300049588 Bacteria 9298
334 Ga0501073_0001799 3300049589 Bacteria 15949
335 Ga0501074_0152512 3300049590 Bacteria 1651
336 Ga0501077_0004365 3300049593 Archaea 8578
337 Ga0501202_003380 3300049652 Bacteria 2730
338 Ga0501202_020985 3300049652 Bacteria 1302
339 Ga0501216_002824 3300049660 Bacteria 2494
340 Ga0501224_011567 3300049664 Bacteria 1298
341 Ga0501233_003089 3300049668 Bacteria 2977
342 Ga0501242_002292 3300049674 Bacteria 2001
343 Ga0501247_011262 3300049677 Unclassified 1076
344 Ga0501249_005070 3300049679 Bacteria 2691
345 Ga0501251_004346 3300049681 Bacteria 1461
346 Ga0501225_0027427 3300049705 Bacteria 1566
347 Ga0501079_0002674 3300049741 Bacteria 12956
348 Ga0501080_0014199 3300049742 Bacteria 7331
349 Ga0501083_0033265 3300049744 Bacteria 3531
350 Ga0501268_000950 3300049765 Bacteria 3423
351 Ga0501268_011428 3300049765 Unclassified 1401
352 Ga0501045_0280851 3300049824 Bacteria 1240
353 nmdc:mga05p37_113620_c1 3300050507 Bacteria 3329
354 nmdc:mga05p37_49615_c1 3300050507 Bacteria 5163
355 nmdc:mga06r32_103804_c1 3300050510 Bacteria 2791
356 nmdc:mga08y16_147564_c1 3300050511 Bacteria 2445
357 nmdc:mga08y16_95934_c1 3300050511 Bacteria 3088
358 nmdc:mga0a205_179253_c1 3300050515 Bacteria 2013
359 Ga0500604_0019608 3300053151 Bacteria 1896
360 Ga0501084_0008292 3300054114 Bacteria 8572
361 Ga0501082_0001190 3300060353 Bacteria 22873
362 Ga0501082_0074227 3300060353 Bacteria 2929
363 Ga0207428_10031610
364 Ga0070658_10001907
365 Ga0070658_10095020
366 Ga0070683_100032105
367 Ga0070690_100003749
368 Ga0070670_100071215
369 Ga0070670_100087285
370 Ga0070670_100169581
371 Ga0070670_100287531
372 Ga0068869_100165635
373 Ga0068869_100300876
374 Ga0070666_10020844
375 Ga0070680_100115763
376 Ga0068868_100008908
377 Ga0070689_100013719
378 Ga0070689_100044582
379 Ga0070689_100070499
380 Ga0070687_100074246
381 Ga0070668_100156740
382 Ga0070669_100012747
383 Ga0070669_100295309
384 Ga0070675_100025810
385 Ga0070671_100009699
386 Ga0070671_100051749
387 Ga0070671_100146815
388 Ga0070673_100019254
389 Ga0070688_100205111
390 Ga0070659_100007431
391 Ga0070667_100009207
392 Ga0070667_100360445
393 Ga0070714_100006738
394 Ga0070714_100080048
395 Ga0070713_100001996
396 Ga0070711_100007934
397 Ga0070694_100001408
398 Ga0070708_100199903
399 Ga0070663_100059661
400 Ga0070678_100091354
401 Ga0070662_100136148
402 Ga0070681_10067991
403 Ga0068867_100137522
404 Ga0068867_100247020
405 Ga0070685_10012245
406 Ga0070685_10015280
407 Ga0070707_100006078
408 Ga0070679_100020139
409 Ga0070679_100022936
410 Ga0070684_100143782
411 Ga0070684_100405092
412 Ga0068853_100028432
413 Ga0068853_100187190
414 Ga0070696_100001187
415 Ga0070693_100107227
416 Ga0070665_100067823
417 Ga0070665_100123258
418 Ga0070665_100399600
419 Ga0068855_100006245
420 Ga0070664_100023317
421 Ga0070664_100067872
422 Ga0070664_100091564
423 Ga0068857_100318376
424 Ga0068856_100009479
425 Ga0068856_100078178
426 Ga0070702_100004207
427 Ga0068852_100474075
428 Ga0068859_100016664
429 Ga0068859_100061501
430 Ga0068859_100067577
431 Ga0068859_100128064
432 Ga0068859_100398594
433 Ga0068864_100007581
434 Ga0068864_100395307
435 Ga0068851_10067099
436 Ga0068863_100021839
437 Ga0068863_100029721
438 Ga0068863_100149626
439 Ga0068863_100169606
440 Ga0068858_100015620
441 Ga0068860_100015626
442 Ga0068860_100143111
443 Ga0081455_10016548
444 Ga0081455_10026668
445 Ga0081539_10000924
446 Ga0081539_10054347
447 Ga0070712_100034377
448 Ga0097621_100109413
449 Ga0068871_100017802
450 Ga0068871_100060736
451 Ga0075428_100056024
452 Ga0075431_100011881
453 Ga0075433_10152241
454 Ga0068865_100039553
455 Ga0097620_100016664
456 Ga0097620_100061500
457 Ga0097620_100067578
458 Ga0097620_100128060
459 Ga0097620_100398587
460 Ga0105251_10023169
461 Ga0105240_10010392
462 Ga0105240_10135603
463 Ga0105240_10347960
464 Ga0111539_10265024
465 Ga0111539_10408345
466 Ga0111539_10529515
467 Ga0105245_10070479
468 Ga0105245_10703844
469 Ga0105247_10008564
470 Ga0114129_10066556
471 Ga0105242_10007180
472 Ga0105242_10032609
473 Ga0105242_10195726
474 Ga0105248_10072623
475 Ga0105248_10169747
476 Ga0105248_10470170
477 Ga0105237_10120801
478 Ga0105249_10020180
479 Ga0105249_10424129
480 Ga0105239_10085999
481 Ga0157373_10074010
482 Ga0157373_10164708
483 Ga0157370_10097637
484 Ga0157370_10211349
485 Ga0157369_10072168
486 Ga0157369_10146568
487 Ga0157378_10002849
488 Ga0157378_10082076
489 Ga0163162_10023101
490 Ga0163162_10071609
491 Ga0163162_10136727
492 Ga0163162_10269971
493 Ga0157372_10011261
494 Ga0157372_10231831
495 Ga0157375_10017212
496 Ga0157375_10049925
497 Ga0157375_10177121
498 Ga0163163_10008251
499 Ga0163163_10115140
500 Ga0157380_10014296
501 Ga0157380_10021380
502 Ga0157380_10072914
503 Ga0157379_10032819
504 Ga0157376_10021257
505 Ga0157376_10031862
506 Ga0157376_10150619
507 Ga0163161_10001560
508 Ga0163161_10018216
509 Ga0213875_10009232
510 Ga0213875_10033689
511 Ga0213875_10094292
512 Ga0207656_10049044
513 Ga0207710_10078750
514 Ga0207680_10149197
515 Ga0207699_10016995
516 Ga0207705_10377552
517 Ga0207707_10063289
518 Ga0207707_10337145
519 Ga0207695_10011788
520 Ga0207671_10163235
521 Ga0207663_10021907
522 Ga0207662_10106647
523 Ga0207657_10040603
524 Ga0207652_10275358
525 Ga0207646_10005012
526 Ga0207681_10184317
527 Ga0207650_10050488
528 Ga0207650_10130237
529 Ga0207659_10228474
530 Ga0207659_10511135
531 Ga0207700_10011944
532 Ga0207664_10001101
533 Ga0207644_10016009
534 Ga0207644_10080571
535 Ga0207706_10007367
536 Ga0207706_10079129
537 Ga0207686_10030798
538 Ga0207709_10341744
539 Ga0207670_10050721
540 Ga0207704_10063908
541 Ga0207711_10010238
542 Ga0207661_10106008
543 Ga0207679_10176382
544 Ga0207651_10277459
545 Ga0207712_10022758
546 Ga0207712_10038931
547 Ga0207668_10087172
548 Ga0207658_10006381
549 Ga0207677_10011691
550 Ga0207677_10274344
551 Ga0207703_10004686
552 Ga0207639_10121010
553 Ga0207639_10158065
554 Ga0207708_10487249
555 Ga0207702_10216310
556 Ga0207641_10002083
557 Ga0207641_10024743
558 Ga0207641_10055601
559 Ga0207648_10234551
560 Ga0207648_10292006
561 Ga0207676_10001676
562 Ga0207676_10025825
563 Ga0207674_10010173
564 Ga0207674_10049239
565 Ga0207674_10065226
566 Ga0207698_10097349
567 Ga0268266_10427399
568 Ga0268265_10050544
569 Ga0268265_10139594
570 Ga0268264_10015912
571 Ga0265334_10024765
572 Ga0265318_10000263
573 Ga0265318_10016092
574 Ga0265323_10001542
575 Ga0265338_10184896
576 Ga0265760_10022632
577 Ga0265330_10008015
578 Ga0265330_10051177
579 Ga0265332_10000287
580 Ga0265328_10000629
581 Ga0265320_10045004
582 Ga0265329_10001509
583 Ga0265339_10111865
584 Ga0265331_10023143
585 Ga0265316_10003021
586 Ga0265316_10006581
587 Ga0265316_10007626
588 Ga0265316_10143652
589 Ga0265316_10206406
590 Ga0307408_100234056
591 Ga0265313_10007652
592 Ga0265314_10202413
593 Ga0265342_10000997
594 Ga0316576_10000183
595 Ga0316578_10165158
596 Ga0307405_10008631
597 Ga0316577_10021815
598 Ga0307413_10000565
599 Ga0307413_10009705
600 Ga0307413_10017621
601 Ga0307410_10007459
602 Ga0307410_10032302
603 Ga0307410_10369889
604 Ga0307406_10027485
605 Ga0307406_10033145
606 Ga0307407_10001419
607 Ga0307407_10001554
608 Ga0307407_10008533
609 Ga0307407_10078144
610 Ga0307407_10132618
611 Ga0307412_10045211
612 Ga0307412_10166870
613 Ga0307412_10214952
614 Ga0307409_100067886
615 Ga0307409_100181253
616 Ga0307416_100023150
617 Ga0307416_100023498
618 Ga0307416_100036916
619 Ga0307416_100422311
620 Ga0307414_10052833
621 Ga0307414_10134909
622 Ga0307414_10338283
623 Ga0307411_10003481
624 Ga0307411_10013337
625 Ga0307411_10083835
626 Ga0307411_10141488
627 Ga0307415_100041112
628 Ga0307415_100238585
629 Ga0307415_100264153
630 Ga0373923_0012408
631 Ga0373953_0038609
632 Ga0373954_0032699
633 Ga0373927_0000958
634 Ga0373947_0000524
635 Ga0373947_0321241
636 Ga0373937_0044753
637 Ga0316584_0000538
638 Ga0373925_0001782
639 Ga0373925_0034535
640 Ga0395905_0000584
641 Ga0395905_0056737
642 Ga0436364_0079763
643 Ga0436364_0214612
644 Ga0436364_0323603
645 Ga0436365_1587825
646 Ga0451837_0819436
647 Ga0451577_0123925
648 Ga0451577_0227884
649 Ga0466966_0130469
650 Ga0451576_0062119
651 Ga0466958_0045808
652 Ga0495651_0081061
653 Ga0495653_0172460
654 Ga0495580_0002595
655 Ga0495580_0164485
656 Ga0495664_0001085
657 Ga0495608_0050293
658 Ga0495628_0075307
659 Ga0495587_0025655
660 Ga0495645_0002942
661 Ga0495645_0082788
662 Ga0495667_0048399
663 Ga0495667_0090190
664 Ga0495635_0047736
665 Ga0495599_0011066
666 Ga0495599_0072746
667 Ga0495623_0069149
668 Ga0495623_0092741
669 Ga0495646_0029783
670 Ga0495636_0047832
671 Ga0495674_0012274
672 Ga0495674_0244683
673 Ga0495675_0009790
674 Ga0495675_0017953
675 Ga0495684_0002037
676 Ga0495684_0017282
677 Ga0495684_0334824
678 Ga0495602_0156499
679 Ga0496105_0018469
680 Ga0496109_0000023
681 Ga0496114_0047150
682 Ga0501298_003253
683 Ga0501032_0000350
684 Ga0501033_0006975
685 Ga0501034_0174263
686 Ga0501036_0031107
687 Ga0501037_0028516
688 Ga0501038_0006384
689 Ga0501039_0003704
690 Ga0501047_0081628
691 Ga0501048_0018700
692 Ga0501068_0000592
693 Ga0501069_0000790
694 Ga0501070_0013796
695 Ga0501072_0005941
696 Ga0501073_0001799
697 Ga0501074_0152512
698 Ga0501077_0004365
699 Ga0501202_003380
700 Ga0501202_020985
701 Ga0501216_002824
702 Ga0501224_011567
703 Ga0501233_003089
704 Ga0501242_002292
705 Ga0501247_011262
706 Ga0501249_005070
707 Ga0501251_004346
708 Ga0501225_0027427
709 Ga0501079_0002674
710 Ga0501080_0014199
711 Ga0501083_0033265
712 Ga0501268_000950
713 Ga0501268_011428
714 Ga0501045_0280851
715 nmdc:mga05p37_113620_c1
716 nmdc:mga05p37_49615_c1
717 nmdc:mga06r32_103804_c1
718 nmdc:mga08y16_147564_c1
719 nmdc:mga08y16_95934_c1
720 nmdc:mga0a205_179253_c1
721 Ga0500604_0019608
722 Ga0501084_0008292
723 Ga0501082_0001190
724 Ga0501082_0074227

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d62-assembly1.cif.gz_A pgpg-specific phosphodiesterase - pggh from vibrio cholrae 0.7762 1 315
7d62-assembly1.cif.gz_A pgpg-specific phosphodiesterase - pggh from vibrio cholrae 0.7715 1 315
3r6u-assembly1.cif.gz_A crystal structure of choline binding protein opubc from bacillus subtilis 0.7519 1 40
7d62-assembly1.cif.gz_B pgpg-specific phosphodiesterase - pggh from vibrio cholrae 0.7445 2 315
3ppr-assembly2.cif.gz_B structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc 0.7356 3 38
ID Description Score Start End Superfamily
af_A0A1D6HFN8_137_214_3.10.310.30 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.7727 249 306 3.10.310.30
af_Q2FXM3_201_313_3.10.310.30 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.7273 207 316 3.10.310.30
3l6hA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7231 2 40 3.40.190.10
af_Q92361_1_108_2.170.210.10 Mainly Beta;Beta Complex;Dna Repair Protein Xrcc4; Chain: A, domain 1;DNA double-strand break repair and VJ recombination XRCC4, N-terminal 0.7153 244 297 2.170.210.10
af_Q2FXM3_201_313_3.10.310.30 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.7054 207 316 3.10.310.30
ID Description Score Start End GO Terms
AF-A0A357EY45-F1-model_v4 Phosphoesterase 1.001 210 319
AF-A0A838U3F4-F1-model_v4 Phosphoesterase 0.9974 1 249
AF-A0A357EXS5-F1-model_v4 Phosphoesterase 0.9935 1 180
AF-A0A1Q7NHQ7-F1-model_v4 Phosphoesterase 0.993 1 315
AF-A0A2V8PJ47-F1-model_v4 Phosphoesterase 0.9923 1 284

Map