F422611

General Info

Members Datasets Scaffolds Average Seq Length
362 313 724 316

Family's Representative Sequence

Representative Sequence 3300021327|Ga0214543_1032510|Ga0214543_10325102
Length 311
Sequence MTITPQQLPHFTDAASFRAFRSASAQWLPIALDIARSHGLDAGSPHVFATXXNLTLILKIFPPLLAAQFVSERAALTQLKGRLHLPIPEIVAEGMRDGWPYLVITRLAGTLGSEVWPSLPEPQKERLLLQIGETIAAVQRVPLGELASIEPRWDAFMRQQMQGCRGRHERLGLAPKFLAGLDDLLRDAPKLIPMDAPPVILIGEYIPENFLLACDGQWSLGGLFDFGDVLTGWRDYDLLGPSAFMAAGRPGRVKSLLEGFGYTTLDFTLKRRLMALMLLHRASDLNAHICIEGWQERADDLIELQELIWPN

Samples

Sample ID Description Type Environment
1 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
27 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
38 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
39 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
40 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
43 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
59 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
60 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
61 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
62 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
65 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
66 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
67 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
78 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
79 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
80 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
81 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
82 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
83 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
84 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
85 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
86 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
87 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
88 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
92 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
99 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
100 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
106 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
107 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
108 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
109 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
110 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
111 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
112 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
113 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
114 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
115 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
116 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
117 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
118 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
119 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
120 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
121 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
122 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
123 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
124 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
125 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
126 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
127 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
128 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
129 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
130 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
131 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
132 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
133 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
136 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
137 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
138 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
139 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
140 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
141 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
142 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
143 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
144 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
145 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
146 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
147 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
148 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
149 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
150 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
151 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
152 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
153 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
154 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
155 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
156 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
157 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
158 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
159 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
160 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
161 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
162 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
163 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
164 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
165 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
166 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
167 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
168 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
169 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
170 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
171 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
172 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
173 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
174 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
175 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
176 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
177 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
178 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
179 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
180 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
181 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
182 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
183 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
184 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
185 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
186 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
187 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
188 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
189 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
190 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
191 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
192 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
193 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
194 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
195 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
196 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
197 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
198 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
199 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
200 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
201 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
202 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
203 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
204 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
205 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
206 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
207 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
208 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
209 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
210 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
211 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
212 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
213 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
214 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
215 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
216 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
217 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
218 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
219 2922368715
220 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
221 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
222 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
223 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
224 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
225 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
226 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
227 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
228 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
229 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
230 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
231 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
232 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
233 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
234 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
235 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
236 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
237 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
238 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
239 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
240 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
241 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
242 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
243 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
244 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
245 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
246 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
247 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
248 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
249 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
250 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
251 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
252 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
253 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
254 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
255 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
256 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
257 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
258 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
259 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
260 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
261 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
262 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
263 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
264 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
265 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
266 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
267 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
268 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
269 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
270 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
271 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
272 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
273 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
274 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
275 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
276 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
277 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
278 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
279 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
280 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
281 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
282 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
283 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
284 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
285 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
286 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
287 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
288 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
289 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
290 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
291 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
292 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
293 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
294 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
295 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
296 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
297 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
298 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
299 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
300 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
301 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
302 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
303 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
304 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
305 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
306 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
307 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
308 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
309 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
310 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
311 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
312 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
313 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.63
Metatranscriptomes 0
Isolates 47.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.19
Nodule 40.06
Rhizoplane 5.52
Rhizosphere 21.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0214543_1032510 3300021327 Bacteria 1964
2 JGI25153J46596_10003314 3300003215 Bacteria 9053
3 JGI25153J46596_10005353 3300003215 Bacteria 6741
4 JGI25153J46596_10006017 3300003215 Bacteria 6238
5 JGI25404J52841_10004881 3300003659 Bacteria 2751
6 Ga0055539_1009963 3300003752 Bacteria 1177
7 Ga0055531_10003847 3300003794 Bacteria 9398
8 Ga0065165_1002635 3300005262 Bacteria 14588
9 Ga0065165_1014808 3300005262 Bacteria 3007
10 Ga0070658_10064229 3300005327 Bacteria 2994
11 Ga0070658_10090233 3300005327 Bacteria 2525
12 Ga0070680_100220047 3300005336 Bacteria 1603
13 Ga0070668_100140813 3300005347 Bacteria 1944
14 Ga0070669_100387250 3300005353 Bacteria 1141
15 Ga0070673_100277883 3300005364 Bacteria 1468
16 Ga0070710_10018538 3300005437 Bacteria 3581
17 Ga0070663_100163187 3300005455 Bacteria 1717
18 Ga0070681_10069268 3300005458 Bacteria 3494
19 Ga0068853_100137847 3300005539 Bacteria 2188
20 Ga0070665_100437216 3300005548 Bacteria 1317
21 Ga0068855_100059393 3300005563 Bacteria 4474
22 Ga0068852_100224062 3300005616 Bacteria 1789
23 Ga0081455_10074379 3300005937 Bacteria 2806
24 Ga0081540_1007646 3300005983 Bacteria 7669
25 Ga0081540_1011828 3300005983 Bacteria 5799
26 Ga0081540_1022142 3300005983 Bacteria 3756
27 Ga0075364_10020138 3300006051 Bacteria 4195
28 Ga0075364_10090071 3300006051 Bacteria 2034
29 Ga0075369_10014526 3300006186 Bacteria 3147
30 Ga0075366_10085785 3300006195 Bacteria 1883
31 Ga0075370_10020611 3300006353 Bacteria 3607
32 Ga0075370_10056329 3300006353 Bacteria 2234
33 Ga0075434_100307482 3300006871 Bacteria 1605
34 Ga0099824_1004372 3300006942 Bacteria 20372
35 Ga0099823_1036071 3300006944 Bacteria 3821
36 Ga0105240_10243641 3300009093 Bacteria 2083
37 Ga0105240_10315923 3300009093 Bacteria 1782
38 Ga0105240_10593114 3300009093 Bacteria 1221
39 Ga0105243_10243127 3300009148 Bacteria 1603
40 Ga0105248_10116480 3300009177 Bacteria 3014
41 Ga0105248_10469383 3300009177 Bacteria 1419
42 Ga0105237_10192306 3300009545 Bacteria 2040
43 Ga0105238_10271693 3300009551 Bacteria 1676
44 Ga0105239_10222903 3300010375 Bacteria 2115
45 Ga0105239_10609208 3300010375 Bacteria 1246
46 Ga0105246_10306532 3300011119 Bacteria 1284
47 Ga0157378_10004612 3300013297 Bacteria 12090
48 Ga0163162_10324516 3300013306 Bacteria 1672
49 Ga0214544_1000003 3300021320 Bacteria 643752
50 Ga0214542_1000003 3300021321 Bacteria 435700
51 Ga0214545_1000004 3300021324 Bacteria 453352
52 Ga0214545_1030466 3300021324 Bacteria 2291
53 Ga0214543_1000007 3300021327 Bacteria 414744
54 Ga0209563_102257 3300025230 Bacteria 4452
55 Ga0209148_1000351 3300025254 Bacteria 59739
56 Ga0209233_1009961 3300025261 Bacteria 2868
57 Ga0209455_1001952 3300025272 Bacteria 8497
58 Ga0209455_1013447 3300025272 Bacteria 1899
59 Ga0209758_1000015 3300025297 Bacteria 851943
60 Ga0209758_1000224 3300025297 Bacteria 121530
61 Ga0209758_1004207 3300025297 Bacteria 12193
62 Ga0209758_1047291 3300025297 Bacteria 1541
63 Ga0209256_1014611 3300025299 Bacteria 2811
64 Ga0207426_1000585 3300025302 Bacteria 48529
65 Ga0207426_1000940 3300025302 Bacteria 28937
66 Ga0207426_1008500 3300025302 Bacteria 4135
67 Ga0207426_1024318 3300025302 Bacteria 2057
68 Ga0209257_1000440 3300025304 Bacteria 79182
69 Ga0207647_10009182 3300025904 Bacteria 7035
70 Ga0207645_10019390 3300025907 Bacteria 4459
71 Ga0207707_10112405 3300025912 Bacteria 2381
72 Ga0207695_10000065 3300025913 Bacteria 336949
73 Ga0207695_10111416 3300025913 Bacteria 2716
74 Ga0207660_10062619 3300025917 Bacteria 2680
75 Ga0207657_10067687 3300025919 Bacteria 3036
76 Ga0207640_10313807 3300025981 Bacteria 1245
77 Ga0207678_10098741 3300026067 Bacteria 2494
78 Ga0207674_10166927 3300026116 Bacteria 2155
79 Ga0207698_10021377 3300026142 Bacteria 4474
80 Ga0207698_10147161 3300026142 Bacteria 2039
81 Ga0209389_1000029 3300027296 Bacteria 140337
82 Ga0209389_1000076 3300027296 Bacteria 92447
83 Ga0209589_1000012 3300027357 Bacteria 229451
84 Ga0209589_1000013 3300027357 Bacteria 229273
85 Ga0209489_100013 3300027361 Bacteria 229831
86 Ga0209489_100416 3300027361 Bacteria 77981
87 Ga0209700_100014 3300027363 Bacteria 299349
88 Ga0307517_10000766 3300028786 Bacteria 55210
89 Ga0307515_10015215 3300028794 Bacteria 14194
90 Ga0307515_10277046 3300028794 Bacteria 1390
91 Ga0307509_10032747 3300031507 Bacteria 5726
92 Ga0307516_10022356 3300031730 Bacteria 6496
93 Ga0307516_10096996 3300031730 Bacteria 2768
94 Ga0307510_10007640 3300033180 Bacteria 12891
95 Ga0373932_0081873 3300035112 Bacteria 1021
96 Ga0373927_0033816 3300035695 Bacteria 3327
97 Ga0395905_0533904 3300037471 Bacteria 1074
98 Ga0395905_0576636 3300037471 Bacteria 1026
99 Ga0466969_0019388 3300044656 Bacteria 3537
100 Ga0466972_0003543 3300044658 Bacteria 7751
101 Ga0466972_0078534 3300044658 Bacteria 1572
102 Ga0466972_0132712 3300044658 Bacteria 1173
103 Ga0466966_0030631 3300044684 Bacteria 3490
104 Ga0466966_0113567 3300044684 Bacteria 1668
105 Ga0466961_0000044 3300044693 Bacteria 76071
106 Ga0466961_0241509 3300044693 Bacteria 1110
107 Ga0466964_0023576 3300044706 Bacteria 2393
108 Ga0466960_0187198 3300044901 Bacteria 1125
109 Ga0466959_0000909 3300045049 Bacteria 17495
110 Ga0495603_0003699 3300046455 Bacteria 9103
111 Ga0495594_0076142 3300046499 Bacteria 1871
112 Ga0495607_0128633 3300046501 Bacteria 1321
113 Ga0495583_0126343 3300046506 Bacteria 1073
114 Ga0495631_0020847 3300046518 Bacteria 3057
115 Ga0495648_0001461 3300046524 Bacteria 23127
116 Ga0495648_0099753 3300046524 Bacteria 1606
117 Ga0495609_0065515 3300046538 Bacteria 1601
118 Ga0495622_0009411 3300046557 Bacteria 4520
119 Ga0495656_0030433 3300046615 Bacteria 2182
120 Ga0495668_0121555 3300046616 Bacteria 1428
121 Ga0495611_0038011 3300046648 Bacteria 2140
122 Ga0495588_0070570 3300046674 Bacteria 1816
123 Ga0495657_0219713 3300046675 Bacteria 1152
124 Ga0495649_0029156 3300046694 Bacteria 3055
125 Ga0495581_0089730 3300047315 Bacteria 1783
126 Ga0495683_0025471 3300047323 Bacteria 3032
127 Ga0496100_0063140 3300048903 Bacteria 2447
128 Ga0496101_0426248 3300048904 Bacteria 1046
129 Ga0496102_0386531 3300048905 Bacteria 1317
130 Ga0496102_0387001 3300048905 Bacteria 1316
131 Ga0496103_0157422 3300048906 Bacteria 1456
132 Ga0496104_0070076 3300048907 Bacteria 3333
133 Ga0496104_0125896 3300048907 Bacteria 2460
134 Ga0496104_0171521 3300048907 Bacteria 2080
135 Ga0496104_0218795 3300048907 Bacteria 1817
136 Ga0496105_0011855 3300048908 Bacteria 6903
137 Ga0496105_0082351 3300048908 Bacteria 2658
138 Ga0496105_0385005 3300048908 Bacteria 1115
139 Ga0496106_0253707 3300048909 Bacteria 1407
140 Ga0496106_0276537 3300048909 Bacteria 1345
141 Ga0496107_0125749 3300048910 Bacteria 1891
142 Ga0496108_0395399 3300048911 Bacteria 1207
143 Ga0496110_0109177 3300048913 Bacteria 2485
144 Ga0496110_0238142 3300048913 Bacteria 1656
145 Ga0496112_0117810 3300048915 Bacteria 2626
146 Ga0496114_0043523 3300048917 Bacteria 3723
147 Ga0496116_0039302 3300048919 Bacteria 3273
148 Ga0496117_0062072 3300048920 Bacteria 2564
149 Ga0496119_0053529 3300048922 Bacteria 2464
150 Ga0496121_0018167 3300048924 Bacteria 7109
151 Ga0496121_0021376 3300048924 Bacteria 6340
152 Ga0496121_0048768 3300048924 Bacteria 3599
153 Ga0496121_0053391 3300048924 Bacteria 3386
154 Ga0496122_0055062 3300048925 Bacteria 2980
155 Ga0496123_0107541 3300048926 Bacteria 1604
156 Ga0496125_0082722 3300048928 Bacteria 2446
157 Ga0496125_0210494 3300048928 Bacteria 1263
158 Ga0496126_0001531 3300048929 Bacteria 35598
159 Ga0496126_0198902 3300048929 Bacteria 1693
160 Ga0496126_0208548 3300048929 Bacteria 1646
161 nmdc:mga06z11_40267_c1 3300050494 Bacteria 2331
162 nmdc:mga04h51_59915_c1 3300050495 Bacteria 1302
163 nmdc:mga07m45_16284_c1 3300050496 Bacteria 3979
164 nmdc:mga0rr50_502634_c1 3300050513 Bacteria 1031
165 nmdc:mga0sz30_43513_c1 3300050516 Bacteria 1890
166 Ga0500610_0029072 3300053079 Bacteria 2790
167 Ga0500635_0008799 3300053080 Bacteria 2781
168 Ga0495595_0117762 3300053084 Bacteria 1292
169 Ga0495619_0010200 3300053085 Bacteria 5918
170 Ga0500643_018668 3300053087 Bacteria 2297
171 Ga0500646_0012087 3300053090 Bacteria 2227
172 Ga0500647_0009065 3300053091 Bacteria 4350
173 Ga0500566_0000199 3300053094 Bacteria 31473
174 Ga0500566_0108723 3300053094 Bacteria 1510
175 Ga0500640_084809 3300053095 Bacteria 1337
176 Ga0500557_000043 3300053105 Bacteria 63389
177 Ga0500572_001226 3300053111 Bacteria 7237
178 Ga0500608_014079 3300053122 Bacteria 3561
179 Ga0500614_010405 3300053123 Bacteria 1997
180 Ga0500642_0000129 3300053130 Bacteria 34204
181 Ga0500559_0000287 3300053136 Bacteria 38965
182 Ga0500604_0070159 3300053151 Bacteria 1116
183 Ga0500616_0006124 3300053153 Bacteria 7958
184 Ga0500636_0000291 3300053177 Bacteria 27724
185 Ga0500576_050671 3300053725 Bacteria 1842
186 Ga0500625_109335 3300053729 Bacteria 1138
187 Ga0500645_056578 3300053730 Bacteria 1138
188 Ga0500596_001015 3300053735 Bacteria 5628
189 Ga0500601_001037 3300053737 Bacteria 3177
190 Ga0500661_012632 3300055283 Bacteria 1523
191 2507504820 2507262055 Bacteria 8048963
192 2508546172 2508501009 Bacteria 7784016
193 2508695106 2508501042 Bacteria 8719808
194 2513626155 2513237092 Bacteria 8341956
195 2513641887 2513237094 Bacteria 8789602
196 2513647987 2513237095 Bacteria 8976980
197 2513705992 2513237102 Bacteria 7703324
198 2513873936 2513237139 Bacteria 8737671
199 2514012910 2513237161 Bacteria 8871253
200 2515625890 2515154112 Bacteria 8294334
201 2517102412 2517093001 Bacteria 9002274
202 2524435721 2524023205 Bacteria 8918781
203 2524466478 2524023210 Bacteria 9029266
204 2528855161 2528768022 Bacteria 10457665
205 2617351678 2617270735 Bacteria 9163226
206 2617374154 2617270741 Bacteria 8201522
207 2745079017 2744054633 Bacteria 8678936
208 2793063124 2791355196 Bacteria 7323613
209 2805919477 2802429603 Bacteria 8777136
210 2818237255 2816332527 Bacteria 8933356
211 2824602551 2824600985 Bacteria 8488197
212 2824612669 2824609381 Bacteria 8672835
213 2824624776 2824617872 Bacteria 8814715
214 2824633648 2824626560 Bacteria 8813858
215 2824643262 2824635225 Bacteria 8785348
216 2824651473 2824644064 Bacteria 8743947
217 2824654483 2824653114 Bacteria 8493680
218 2824663640 2824661429 Bacteria 9877870
219 2824674877 2824671348 Bacteria 8369588
220 2824685496 2824679649 Bacteria 8248951
221 2824691945 2824687955 Bacteria 8360029
222 2824700435 2824696289 Bacteria 8335049
223 2824721587 2824714736 Bacteria 8717648
224 2824731515 2824723954 Bacteria 8758240
225 2824734844 2824732956 Bacteria 7810675
226 2824748149 2824746037 Bacteria 7911610
227 2824774966 2824773399 Bacteria 8360218
228 2838129534 2838122688 Bacteria 8803140
229 2841944435 2841941048 Bacteria 8688029
230 2841951576 2841949485 Bacteria 8680857
231 2841964638 2841957949 Bacteria 8652217
232 2841969212 2841966195 Bacteria 8673214
233 2841982877 2841974524 Bacteria 8931498
234 2841991041 2841983080 Bacteria 8395090
235 2842043906 2842038055 Bacteria 8002051
236 2842052104 2842045827 Bacteria 8006841
237 2844321799 2844315083 Bacteria 8138177
238 2847931492 2847930680 Bacteria 9342022
239 2847941730 2847939898 Bacteria 8606328
240 2849082649 2849076700 Bacteria 7039503
241 2857511545 2857509624 Bacteria 7472071
242 2874596811 2874590934 Bacteria 8299676
243 2874617942 2874612657 Bacteria 8252029
244 2874624398 2874620515 Bacteria 8290088
245 2874636682 2874628541 Bacteria 8630250
246 2874648616 2874645413 Bacteria 8214782
247 2876765018 2876761206 Bacteria 10111113
248 2876777275 2876771140 Bacteria 8287509
249 2876825357 2876818435 Bacteria 8274608
250 2879077606 2879074833 Bacteria 8279565
251 2879087470 2879083081 Bacteria 8587928
252 2879107202 2879099564 Bacteria 10442239
253 2879130749 2879127579 Bacteria 8294491
254 2879146091 2879142872 Bacteria 8267021
255 2881371025 2881364244 Bacteria 7710352
256 2881665671 2881665667 Bacteria 8175609
257 2885371420 2885366525 Bacteria 8326213
258 2885410820 2885409591 Bacteria 9235467
259 2888379991 2888378607 Bacteria 9652610
260 2888391067 2888388044 Bacteria 7304136
261 2888420796 2888419890 Bacteria 7857137
262 2903727651 2903727486 Bacteria 8281579
263 2904672263 2904666416 Bacteria 8226587
264 2906602859 2906602504 Bacteria 8295279
265 2906627037 2906626472 Bacteria 8826946
266 2906647568 2906643746 Bacteria 8722424
267 2908776628 2908775508 Bacteria 8092255
268 2922378374
269 2922400346 2922393267 Bacteria 8285685
270 2929622526 2929615660 Bacteria 9193770
271 2929631256 2929624759 Bacteria 9339455
272 2932786323 2932784394 Bacteria 9704911
273 2932794709 2932794094 Bacteria 7915132
274 2932805480 2932801729 Bacteria 7987968
275 2932812602 2932809354 Bacteria 9135765
276 2932822964 2932818245 Bacteria 9955613
277 2932829561 2932828146 Bacteria 9745859
278 2933584395 2933577622 Bacteria 9116884
279 2935614982 2935608549 Bacteria 8203142
280 2935618079 2935616580 Bacteria 9032984
281 2935641523 2935638405 Bacteria 10015038
282 2935651670 2935648319 Bacteria 8801166
283 2935659563 2935656913 Bacteria 8965014
284 2935669419 2935665750 Bacteria 9571747
285 2935677983 2935675223 Bacteria 9928132
286 2935689566 2935684952 Bacteria 9590419
287 2935701778 2935694250 Bacteria 9291695
288 2935717085 2935713505 Bacteria 9608509
289 2935730081 2935722832 Bacteria 9608746
290 2935738500 2935732158 Bacteria 9706831
291 2935749252 2935741537 Bacteria 9707219
292 2935756919 2935750917 Bacteria 9590372
293 2935764467 2935760218 Bacteria 9817913
294 2935772799 2935769743 Bacteria 7878163
295 2935778065 2935777560 Bacteria 8077691
296 2935787292 2935785616 Bacteria 7962367
297 2935795920 2935793552 Bacteria 8012592
298 2935804377 2935801545 Bacteria 9301974
299 2935817238 2935810662 Bacteria 9401221
300 2935825979 2935819856 Bacteria 8261050
301 2935831254 2935827899 Bacteria 10038562
302 2935841863 2935837841 Bacteria 9454360
303 2935851598 2935847175 Bacteria 8228321
304 2935856422 2935855204 Bacteria 9035059
305 2935871055 2935864058 Bacteria 9784707
306 2935874552 2935873716 Bacteria 9632195
307 2935888923 2935883170 Bacteria 7964738
308 2935910379 2935908558 Bacteria 8568796
309 2935918335 2935916978 Bacteria 9113783
310 2935927710 2935926038 Bacteria 8601059
311 2935936418 2935934488 Bacteria 8602579
312 2935944029 2935942939 Bacteria 8599779
313 2935952466 2935951376 Bacteria 8602333
314 2935969306 2935967501 Bacteria 8603075
315 2935977932 2935975950 Bacteria 8347125
316 2935984767 2935984226 Bacteria 8302647
317 2935994013 2935992306 Bacteria 9802711
318 2936004976 2936002035 Bacteria 9362176
319 2936013978 2936011229 Bacteria 8801034
320 2936023112 2936019824 Bacteria 8804134
321 2936031249 2936028420 Bacteria 8965941
322 2936044034 2936037263 Bacteria 9446081
323 2936049371 2936046547 Bacteria 8903709
324 2936055937 2936055302 Bacteria 8785755
325 2940562833 2940556831 Bacteria 9590747
326 2941532330 2941531003 Bacteria 7653939
327 2941543936 2941538514 Bacteria 9402094
328 3005488937 3005483717 Bacteria 7877331
329 3005509568 3005506211 Bacteria 6943378
330 3005594163 3005587118 Bacteria 7794411
331 3005602148 3005594810 Bacteria 8716512
332 3005724937 3005718088 Bacteria 8283608
333 8016518667 8016511872 Bacteria 9921665
334 8016526627 8016522445 Bacteria 8156687
335 8016544910 8016539877 Bacteria 8155419
336 8016557162 8016548790 Bacteria 8155074
337 8016565513 8016557553 Bacteria 8154380
338 8016569983 8016566248 Bacteria 8158151
339 8016582559 8016575299 Bacteria 8154085
340 8016586839 8016583857 Bacteria 10421953
341 8016603139 8016595262 Bacteria 8149947
342 8016606053 8016603502 Bacteria 8731218
343 8016617936 8016613128 Bacteria 8794220
344 8016623635 8016622563 Bacteria 7999408
345 8016636110 8016630954 Bacteria 9217207
346 8017058006 8017057580 Bacteria 10023680
347 8019531536 8019530166 Bacteria 8155624
348 8019539997 8019538911 Bacteria 7872763
349 8019550656 8019547302 Bacteria 7996444
350 8019577713 8019576017 Bacteria 10049540
351 8019595815 8019586578 Bacteria 10212056
352 8019605945 8019597564 Bacteria 10041141
353 8019612587 8019608314 Bacteria 10042931
354 8019622529 8019619141 Bacteria 9218857
355 8019630587 8019629233 Bacteria 8687553
356 8019640029 8019638758 Bacteria 9062356
357 8019652061 8019648815 Bacteria 10014479
358 8019677184 8019668869 Bacteria 8791617
359 8019678799 8019678201 Bacteria 8863603
360 8019696726 8019687851 Bacteria 8712826
361 8055750977 8055742211 Bacteria 9226248
362 8056970890 8056967851 Bacteria 9038162
363 Ga0214543_1032510
364 JGI25153J46596_10003314
365 JGI25153J46596_10005353
366 JGI25153J46596_10006017
367 JGI25404J52841_10004881
368 Ga0055539_1009963
369 Ga0055531_10003847
370 Ga0065165_1002635
371 Ga0065165_1014808
372 Ga0070658_10064229
373 Ga0070658_10090233
374 Ga0070680_100220047
375 Ga0070668_100140813
376 Ga0070669_100387250
377 Ga0070673_100277883
378 Ga0070710_10018538
379 Ga0070663_100163187
380 Ga0070681_10069268
381 Ga0068853_100137847
382 Ga0070665_100437216
383 Ga0068855_100059393
384 Ga0068852_100224062
385 Ga0081455_10074379
386 Ga0081540_1007646
387 Ga0081540_1011828
388 Ga0081540_1022142
389 Ga0075364_10020138
390 Ga0075364_10090071
391 Ga0075369_10014526
392 Ga0075366_10085785
393 Ga0075370_10020611
394 Ga0075370_10056329
395 Ga0075434_100307482
396 Ga0099824_1004372
397 Ga0099823_1036071
398 Ga0105240_10243641
399 Ga0105240_10315923
400 Ga0105240_10593114
401 Ga0105243_10243127
402 Ga0105248_10116480
403 Ga0105248_10469383
404 Ga0105237_10192306
405 Ga0105238_10271693
406 Ga0105239_10222903
407 Ga0105239_10609208
408 Ga0105246_10306532
409 Ga0157378_10004612
410 Ga0163162_10324516
411 Ga0214544_1000003
412 Ga0214542_1000003
413 Ga0214545_1000004
414 Ga0214545_1030466
415 Ga0214543_1000007
416 Ga0209563_102257
417 Ga0209148_1000351
418 Ga0209233_1009961
419 Ga0209455_1001952
420 Ga0209455_1013447
421 Ga0209758_1000015
422 Ga0209758_1000224
423 Ga0209758_1004207
424 Ga0209758_1047291
425 Ga0209256_1014611
426 Ga0207426_1000585
427 Ga0207426_1000940
428 Ga0207426_1008500
429 Ga0207426_1024318
430 Ga0209257_1000440
431 Ga0207647_10009182
432 Ga0207645_10019390
433 Ga0207707_10112405
434 Ga0207695_10000065
435 Ga0207695_10111416
436 Ga0207660_10062619
437 Ga0207657_10067687
438 Ga0207640_10313807
439 Ga0207678_10098741
440 Ga0207674_10166927
441 Ga0207698_10021377
442 Ga0207698_10147161
443 Ga0209389_1000029
444 Ga0209389_1000076
445 Ga0209589_1000012
446 Ga0209589_1000013
447 Ga0209489_100013
448 Ga0209489_100416
449 Ga0209700_100014
450 Ga0307517_10000766
451 Ga0307515_10015215
452 Ga0307515_10277046
453 Ga0307509_10032747
454 Ga0307516_10022356
455 Ga0307516_10096996
456 Ga0307510_10007640
457 Ga0373932_0081873
458 Ga0373927_0033816
459 Ga0395905_0533904
460 Ga0395905_0576636
461 Ga0466969_0019388
462 Ga0466972_0003543
463 Ga0466972_0078534
464 Ga0466972_0132712
465 Ga0466966_0030631
466 Ga0466966_0113567
467 Ga0466961_0000044
468 Ga0466961_0241509
469 Ga0466964_0023576
470 Ga0466960_0187198
471 Ga0466959_0000909
472 Ga0495603_0003699
473 Ga0495594_0076142
474 Ga0495607_0128633
475 Ga0495583_0126343
476 Ga0495631_0020847
477 Ga0495648_0001461
478 Ga0495648_0099753
479 Ga0495609_0065515
480 Ga0495622_0009411
481 Ga0495656_0030433
482 Ga0495668_0121555
483 Ga0495611_0038011
484 Ga0495588_0070570
485 Ga0495657_0219713
486 Ga0495649_0029156
487 Ga0495581_0089730
488 Ga0495683_0025471
489 Ga0496100_0063140
490 Ga0496101_0426248
491 Ga0496102_0386531
492 Ga0496102_0387001
493 Ga0496103_0157422
494 Ga0496104_0070076
495 Ga0496104_0125896
496 Ga0496104_0171521
497 Ga0496104_0218795
498 Ga0496105_0011855
499 Ga0496105_0082351
500 Ga0496105_0385005
501 Ga0496106_0253707
502 Ga0496106_0276537
503 Ga0496107_0125749
504 Ga0496108_0395399
505 Ga0496110_0109177
506 Ga0496110_0238142
507 Ga0496112_0117810
508 Ga0496114_0043523
509 Ga0496116_0039302
510 Ga0496117_0062072
511 Ga0496119_0053529
512 Ga0496121_0018167
513 Ga0496121_0021376
514 Ga0496121_0048768
515 Ga0496121_0053391
516 Ga0496122_0055062
517 Ga0496123_0107541
518 Ga0496125_0082722
519 Ga0496125_0210494
520 Ga0496126_0001531
521 Ga0496126_0198902
522 Ga0496126_0208548
523 nmdc:mga06z11_40267_c1
524 nmdc:mga04h51_59915_c1
525 nmdc:mga07m45_16284_c1
526 nmdc:mga0rr50_502634_c1
527 nmdc:mga0sz30_43513_c1
528 Ga0500610_0029072
529 Ga0500635_0008799
530 Ga0495595_0117762
531 Ga0495619_0010200
532 Ga0500643_018668
533 Ga0500646_0012087
534 Ga0500647_0009065
535 Ga0500566_0000199
536 Ga0500566_0108723
537 Ga0500640_084809
538 Ga0500557_000043
539 Ga0500572_001226
540 Ga0500608_014079
541 Ga0500614_010405
542 Ga0500642_0000129
543 Ga0500559_0000287
544 Ga0500604_0070159
545 Ga0500616_0006124
546 Ga0500636_0000291
547 Ga0500576_050671
548 Ga0500625_109335
549 Ga0500645_056578
550 Ga0500596_001015
551 Ga0500601_001037
552 Ga0500661_012632
553 2507504820
554 2508546172
555 2508695106
556 2513626155
557 2513641887
558 2513647987
559 2513705992
560 2513873936
561 2514012910
562 2515625890
563 2517102412
564 2524435721
565 2524466478
566 2528855161
567 2617351678
568 2617374154
569 2745079017
570 2793063124
571 2805919477
572 2818237255
573 2824602551
574 2824612669
575 2824624776
576 2824633648
577 2824643262
578 2824651473
579 2824654483
580 2824663640
581 2824674877
582 2824685496
583 2824691945
584 2824700435
585 2824721587
586 2824731515
587 2824734844
588 2824748149
589 2824774966
590 2838129534
591 2841944435
592 2841951576
593 2841964638
594 2841969212
595 2841982877
596 2841991041
597 2842043906
598 2842052104
599 2844321799
600 2847931492
601 2847941730
602 2849082649
603 2857511545
604 2874596811
605 2874617942
606 2874624398
607 2874636682
608 2874648616
609 2876765018
610 2876777275
611 2876825357
612 2879077606
613 2879087470
614 2879107202
615 2879130749
616 2879146091
617 2881371025
618 2881665671
619 2885371420
620 2885410820
621 2888379991
622 2888391067
623 2888420796
624 2903727651
625 2904672263
626 2906602859
627 2906627037
628 2906647568
629 2908776628
630 2922378374
631 2922400346
632 2929622526
633 2929631256
634 2932786323
635 2932794709
636 2932805480
637 2932812602
638 2932822964
639 2932829561
640 2933584395
641 2935614982
642 2935618079
643 2935641523
644 2935651670
645 2935659563
646 2935669419
647 2935677983
648 2935689566
649 2935701778
650 2935717085
651 2935730081
652 2935738500
653 2935749252
654 2935756919
655 2935764467
656 2935772799
657 2935778065
658 2935787292
659 2935795920
660 2935804377
661 2935817238
662 2935825979
663 2935831254
664 2935841863
665 2935851598
666 2935856422
667 2935871055
668 2935874552
669 2935888923
670 2935910379
671 2935918335
672 2935927710
673 2935936418
674 2935944029
675 2935952466
676 2935969306
677 2935977932
678 2935984767
679 2935994013
680 2936004976
681 2936013978
682 2936023112
683 2936031249
684 2936044034
685 2936049371
686 2936055937
687 2940562833
688 2941532330
689 2941543936
690 3005488937
691 3005509568
692 3005594163
693 3005602148
694 3005724937
695 8016518667
696 8016526627
697 8016544910
698 8016557162
699 8016565513
700 8016569983
701 8016582559
702 8016586839
703 8016603139
704 8016606053
705 8016617936
706 8016623635
707 8016636110
708 8017058006
709 8019531536
710 8019539997
711 8019550656
712 8019577713
713 8019595815
714 8019605945
715 8019612587
716 8019622529
717 8019630587
718 8019640029
719 8019652061
720 8019677184
721 8019678799
722 8019696726
723 8055750977
724 8056970890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01636

APH

Phosphotransferase enzyme family

35

304

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tdv-assembly2.cif.gz_B structure of the gdp complex of wild-type aminoglycoside 2'-phosphotransferase-iiia 0.7917 35 292
6iy9-assembly2.cif.gz_B "crystal structure of aminoglycoside 7""-phoshotransferase-ia (aph(7"")-ia/hyg) from streptomyces hygroscopicus complexed with hygromycin b" 0.7832 20 323
3tdw-assembly1.cif.gz_A the gdp complex of the aminoglycoside 2'-phosphotransfere-iiia f108l mutant 0.7792 35 292
6iy9-assembly2.cif.gz_B "crystal structure of aminoglycoside 7""-phoshotransferase-ia (aph(7"")-ia/hyg) from streptomyces hygroscopicus complexed with hygromycin b" 0.7375 20 323
4dtb-assembly2.cif.gz_B crystal structure of f95y aminoglycoside-2''-phosphotransferase type iva in complex with guanosine 0.7356 36 286
ID Description Score Start End Superfamily
3tdvA01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.775 35 122 3.30.200.20
af_I1K9W2_366_970_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.7387 32 324 3.90.1200.10
3tdvB02 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.733 124 292 3.90.1200.10
3tdvA01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7204 35 122 3.30.200.20
af_K7KIA4_631_724_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7039 54 119 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A5P6P4M9-F1-model_v4 Phosphotransferase 0.9664 19 325 GO:0016301
AF-A0A1Q5RY61-F1-model_v4 Phosphotransferase 0.9544 9 325 GO:0016301
AF-A0A0E4BP05-F1-model_v4 Putative phosphotransferase 0.9531 98 325 GO:0016301
AF-A0A0E4BP05-F1-model_v4 Putative phosphotransferase 0.9491 98 325 GO:0016301
AF-A0A4U6RVR8-F1-model_v4 Phosphotransferase 0.9473 15 325 GO:0016301

Map