F422548

General Info

Members Datasets Scaffolds Average Seq Length
362 219 724 95

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10450698|Ga0081455_104506982
Length 99
Sequence MHARVVRFTGVDAGRISEIAARVESEGPPPGVDSTGFELFVDEAQGTAIFVGYFETEQKMRDASAVFEQMDPSETPGTRASVDLCEVKVQRPFRGDPQP

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
91 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.01
Nodule 0
Rhizoplane 8.84
Rhizosphere 82.87
Stem 0
Stem Tuber 0
Unclassified 22.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10450698 3300005937 Bacteria 879
2 Ga0058861_10953391 3300004800 Archaea 657
3 Ga0058862_10743335 3300004803 Archaea 645
4 Ga0070658_10091799 3300005327 Bacteria 2503
5 Ga0070658_10277496 3300005327 Bacteria 1426
6 Ga0070676_10296823 3300005328 Bacteria 1094
7 Ga0070683_100600378 3300005329 Unclassified 1053
8 Ga0070670_100299548 3300005331 Bacteria 1406
9 Ga0068869_100066706 3300005334 Bacteria 2652
10 Ga0068869_100093171 3300005334 Bacteria 2269
11 Ga0068869_101651454 3300005334 Bacteria 571
12 Ga0070680_100328251 3300005336 Unclassified 1299
13 Ga0070682_100053195 3300005337 Bacteria 2537
14 Ga0070682_100142468 3300005337 Bacteria 1636
15 Ga0070682_100477425 3300005337 Archaea 961
16 Ga0068868_100320510 3300005338 Bacteria 1320
17 Ga0068868_100850441 3300005338 Unclassified 826
18 Ga0068868_101625004 3300005338 Bacteria 608
19 Ga0070689_100320257 3300005340 Bacteria 1295
20 Ga0070691_10062089 3300005341 Bacteria 1799
21 Ga0070687_100247305 3300005343 Bacteria 1106
22 Ga0070661_100244758 3300005344 Bacteria 1382
23 Ga0070661_100404345 3300005344 Bacteria 1080
24 Ga0070692_10080039 3300005345 Bacteria 1758
25 Ga0070668_100956977 3300005347 Bacteria 768
26 Ga0070668_101439339 3300005347 Unclassified 629
27 Ga0070669_102021543 3300005353 Unclassified 504
28 Ga0070675_100920264 3300005354 Unclassified 802
29 Ga0070671_100046847 3300005355 Bacteria 3596
30 Ga0070674_101625483 3300005356 Unclassified 583
31 Ga0070673_100008438 3300005364 Bacteria 6852
32 Ga0070659_100234164 3300005366 Bacteria 1518
33 Ga0070667_102364248 3300005367 Bacteria 500
34 Ga0070709_10341067 3300005434 Bacteria 1105
35 Ga0070710_10267870 3300005437 Bacteria 1104
36 Ga0070701_10188974 3300005438 Bacteria 1211
37 Ga0070701_10606812 3300005438 Unclassified 725
38 Ga0070711_100782785 3300005439 Bacteria 808
39 Ga0070705_100174559 3300005440 Bacteria 1450
40 Ga0070700_100048619 3300005441 Bacteria 2629
41 Ga0070700_100069889 3300005441 Bacteria 2237
42 Ga0070663_100117916 3300005455 Bacteria 2002
43 Ga0070663_100947585 3300005455 Bacteria 746
44 Ga0070678_100733168 3300005456 Bacteria 893
45 Ga0070662_100338170 3300005457 Bacteria 1231
46 Ga0070662_100982435 3300005457 Unclassified 722
47 Ga0070681_10022632 3300005458 Bacteria 6312
48 Ga0068867_101188363 3300005459 Bacteria 700
49 Ga0070685_10326600 3300005466 Bacteria 1042
50 Ga0070685_10561481 3300005466 Unclassified 816
51 Ga0070685_11130284 3300005466 Archaea 593
52 Ga0070679_100002463 3300005530 Bacteria 16765
53 Ga0070684_100044625 3300005535 Bacteria 3835
54 Ga0070684_100123307 3300005535 Bacteria 2332
55 Ga0070684_100345341 3300005535 Bacteria 1368
56 Ga0068853_100089741 3300005539 Bacteria 2700
57 Ga0068853_100954760 3300005539 Bacteria 824
58 Ga0070672_101125303 3300005543 Unclassified 698
59 Ga0070696_100806751 3300005546 Unclassified 773
60 Ga0070696_100871130 3300005546 Unclassified 745
61 Ga0070693_100309178 3300005547 Bacteria 1068
62 Ga0070693_101437767 3300005547 Bacteria 537
63 Ga0070665_100084587 3300005548 Bacteria 3178
64 Ga0070704_100246988 3300005549 Bacteria 1463
65 Ga0070704_100736714 3300005549 Unclassified 877
66 Ga0068855_100237034 3300005563 Bacteria 2040
67 Ga0068855_101447698 3300005563 Bacteria 707
68 Ga0068857_100338913 3300005577 Bacteria 1391
69 Ga0068857_101866057 3300005577 Bacteria 588
70 Ga0068854_100735225 3300005578 Bacteria 855
71 Ga0068856_100000542 3300005614 Bacteria 41663
72 Ga0070702_100016876 3300005615 Bacteria 3757
73 Ga0070702_100593817 3300005615 Bacteria 829
74 Ga0068852_100089555 3300005616 Bacteria 2750
75 Ga0068859_100565807 3300005617 Bacteria 1231
76 Ga0068864_100018845 3300005618 Bacteria 5770
77 Ga0068866_10000248 3300005718 Bacteria 25439
78 Ga0068866_10079535 3300005718 Bacteria 1757
79 Ga0068861_100234040 3300005719 Bacteria 1559
80 Ga0068863_100699025 3300005841 Bacteria 1008
81 Ga0068858_100000353 3300005842 Bacteria 48412
82 Ga0068858_101794011 3300005842 Bacteria 606
83 Ga0068858_102351842 3300005842 Bacteria 527
84 Ga0068862_100449655 3300005844 Bacteria 1214
85 Ga0081455_10406807 3300005937 Bacteria 943
86 Ga0081455_10607658 3300005937 Unclassified 712
87 Ga0081540_1122052 3300005983 Unclassified 1079
88 Ga0081539_10074217 3300005985 Bacteria 1812
89 Ga0075365_10020328 3300006038 Bacteria 4115
90 Ga0075365_10150761 3300006038 Bacteria 1617
91 Ga0075365_10788951 3300006038 Bacteria 670
92 Ga0075363_100046508 3300006048 Unclassified 2302
93 Ga0075363_100058239 3300006048 Bacteria 2075
94 Ga0075363_100105515 3300006048 Bacteria 1562
95 Ga0075363_100179360 3300006048 Bacteria 1204
96 Ga0075363_100612068 3300006048 Unclassified 653
97 Ga0075363_100988393 3300006048 Unclassified 518
98 Ga0075364_10082592 3300006051 Unclassified 2126
99 Ga0075364_10212387 3300006051 Bacteria 1312
100 Ga0075364_10753204 3300006051 Bacteria 664
101 Ga0075364_11149494 3300006051 Bacteria 527
102 Ga0070716_100371444 3300006173 Bacteria 1019
103 Ga0070712_100247218 3300006175 Bacteria 1423
104 Ga0075367_10087414 3300006178 Bacteria 1893
105 Ga0075367_10165259 3300006178 Unclassified 1377
106 Ga0097621_102380670 3300006237 Unclassified 507
107 Ga0075370_10930100 3300006353 Bacteria 532
108 Ga0075428_100071107 3300006844 Bacteria 3803
109 Ga0075430_100377780 3300006846 Bacteria 1170
110 Ga0075430_101418502 3300006846 Bacteria 571
111 Ga0075431_100037150 3300006847 Bacteria 5019
112 Ga0075433_10038932 3300006852 Bacteria 4109
113 Ga0075433_11674037 3300006852 Unclassified 548
114 Ga0075434_100134858 3300006871 Unclassified 2488
115 Ga0075429_100108771 3300006880 Bacteria 2423
116 Ga0068865_100000013 3300006881 Bacteria 141352
117 Ga0068865_100556426 3300006881 Bacteria 964
118 Ga0068865_100884320 3300006881 Bacteria 776
119 Ga0068865_101822715 3300006881 Bacteria 550
120 Ga0097620_100565770 3300006931 Bacteria 1231
121 Ga0075435_100182588 3300007076 Bacteria 1773
122 Ga0099795_10456072 3300007788 Unclassified 589
123 Ga0111539_11624515 3300009094 Bacteria 750
124 Ga0111539_11849968 3300009094 Bacteria 700
125 Ga0105245_10009098 3300009098 Bacteria 8657
126 Ga0105245_10020163 3300009098 Bacteria 5843
127 Ga0105245_10501937 3300009098 Bacteria 1229
128 Ga0105245_10926806 3300009098 Bacteria 913
129 Ga0105245_11849055 3300009098 Bacteria 657
130 Ga0105245_12177533 3300009098 Unclassified 608
131 Ga0105247_10060206 3300009101 Bacteria 2353
132 Ga0105247_10250051 3300009101 Bacteria 1211
133 Ga0114129_10863575 3300009147 Bacteria 1149
134 Ga0105243_11964266 3300009148 Unclassified 619
135 Ga0105241_11431057 3300009174 Bacteria 663
136 Ga0105242_10005063 3300009176 Bacteria 10177
137 Ga0105242_10109524 3300009176 Bacteria 2352
138 Ga0105242_11565393 3300009176 Bacteria 692
139 Ga0105242_12676918 3300009176 Bacteria 548
140 Ga0105242_12787413 3300009176 Bacteria 539
141 Ga0105248_10205419 3300009177 Bacteria 2220
142 Ga0105249_10522645 3300009553 Unclassified 1234
143 Ga0105249_13129521 3300009553 Bacteria 532
144 Ga0105033_111359 3300009986 Bacteria 787
145 Ga0105239_10641617 3300010375 Bacteria 1213
146 Ga0105239_10883134 3300010375 Bacteria 1026
147 Ga0105239_12980149 3300010375 Bacteria 552
148 Ga0105246_10164552 3300011119 Bacteria 1693
149 Ga0105246_10168529 3300011119 Bacteria 1675
150 Ga0157321_1037856 3300012487 Unclassified 519
151 Ga0157342_1058244 3300012507 Unclassified 560
152 Ga0157370_10326616 3300013104 Bacteria 1415
153 Ga0157374_10002158 3300013296 Bacteria 16587
154 Ga0157374_10012946 3300013296 Bacteria 7271
155 Ga0157378_10737287 3300013297 Bacteria 1007
156 Ga0163162_10166435 3300013306 Bacteria 2329
157 Ga0163162_11225680 3300013306 Unclassified 852
158 Ga0163162_12343175 3300013306 Unclassified 613
159 Ga0157372_10384770 3300013307 Bacteria 1635
160 Ga0157372_12730725 3300013307 Unclassified 566
161 Ga0157375_10058329 3300013308 Bacteria 3818
162 Ga0157375_10684279 3300013308 Bacteria 1180
163 Ga0163163_10094869 3300014325 Bacteria 3002
164 Ga0163163_10604056 3300014325 Bacteria 1160
165 Ga0157380_10123727 3300014326 Bacteria 2195
166 Ga0157380_11783906 3300014326 Unclassified 674
167 Ga0157380_12190848 3300014326 Bacteria 616
168 Ga0157377_10258251 3300014745 Bacteria 1132
169 Ga0157377_10380685 3300014745 Bacteria 955
170 Ga0157377_11514686 3300014745 Unclassified 534
171 Ga0157376_10574107 3300014969 Bacteria 1119
172 Ga0163161_10450821 3300017792 Bacteria 1040
173 Ga0163161_11697096 3300017792 Unclassified 559
174 Ga0206350_10530580 3300020080 Bacteria 547
175 Ga0207692_10983221 3300025898 Unclassified 557
176 Ga0207642_10003626 3300025899 Bacteria 4900
177 Ga0207710_10046135 3300025900 Bacteria 1945
178 Ga0207688_10039216 3300025901 Bacteria 2631
179 Ga0207647_10553171 3300025904 Unclassified 638
180 Ga0207699_10189931 3300025906 Bacteria 1386
181 Ga0207705_10069378 3300025909 Bacteria 2553
182 Ga0207707_10054143 3300025912 Bacteria 3493
183 Ga0207693_10074509 3300025915 Bacteria 2658
184 Ga0207693_10842701 3300025915 Bacteria 705
185 Ga0207660_10224976 3300025917 Bacteria 1474
186 Ga0207660_11087715 3300025917 Bacteria 652
187 Ga0207662_10172196 3300025918 Bacteria 1389
188 Ga0207649_10153439 3300025920 Bacteria 1589
189 Ga0207649_10472281 3300025920 Bacteria 950
190 Ga0207652_10000400 3300025921 Bacteria 45246
191 Ga0207694_10517766 3300025924 Bacteria 999
192 Ga0207650_10203782 3300025925 Bacteria 1586
193 Ga0207650_10785939 3300025925 Bacteria 806
194 Ga0207687_10010121 3300025927 Bacteria 6166
195 Ga0207687_10182799 3300025927 Bacteria 1626
196 Ga0207687_10293406 3300025927 Bacteria 1307
197 Ga0207687_10386852 3300025927 Bacteria 1147
198 Ga0207687_10603491 3300025927 Unclassified 925
199 Ga0207690_10197054 3300025932 Bacteria 1527
200 Ga0207690_10582029 3300025932 Bacteria 912
201 Ga0207706_10170507 3300025933 Bacteria 1912
202 Ga0207706_10858407 3300025933 Unclassified 768
203 Ga0207706_11718590 3300025933 Unclassified 505
204 Ga0207686_10084080 3300025934 Bacteria 2084
205 Ga0207686_10221085 3300025934 Bacteria 1368
206 Ga0207709_11395156 3300025935 Unclassified 580
207 Ga0207669_10000010 3300025937 Bacteria 150070
208 Ga0207669_10471467 3300025937 Bacteria 999
209 Ga0207669_11093382 3300025937 Unclassified 673
210 Ga0207704_10003815 3300025938 Bacteria 6860
211 Ga0207704_10595529 3300025938 Bacteria 904
212 Ga0207704_10777145 3300025938 Bacteria 798
213 Ga0207665_10930921 3300025939 Bacteria 690
214 Ga0207689_10090786 3300025942 Bacteria 2510
215 Ga0207689_10445322 3300025942 Bacteria 1082
216 Ga0207661_10007432 3300025944 Bacteria 7799
217 Ga0207661_10745508 3300025944 Unclassified 901
218 Ga0207667_11808265 3300025949 Unclassified 575
219 Ga0207651_10017957 3300025960 Bacteria 4195
220 Ga0207712_10374173 3300025961 Unclassified 1190
221 Ga0207712_11200015 3300025961 Unclassified 677
222 Ga0207712_11298272 3300025961 Bacteria 650
223 Ga0207658_11080416 3300025986 Bacteria 733
224 Ga0207677_10027794 3300026023 Bacteria 3569
225 Ga0207677_10759642 3300026023 Unclassified 865
226 Ga0207703_10000339 3300026035 Bacteria 50936
227 Ga0207639_11451228 3300026041 Bacteria 644
228 Ga0207678_10708881 3300026067 Bacteria 886
229 Ga0207708_10025086 3300026075 Bacteria 4509
230 Ga0207708_10135866 3300026075 Bacteria 1926
231 Ga0207708_11845288 3300026075 Unclassified 530
232 Ga0207708_11966365 3300026075 Bacteria 512
233 Ga0207702_10001133 3300026078 Bacteria 27239
234 Ga0207702_10199819 3300026078 Bacteria 1852
235 Ga0207641_10590792 3300026088 Bacteria 1086
236 Ga0207648_10869903 3300026089 Bacteria 841
237 Ga0207675_100170283 3300026118 Bacteria 2081
238 Ga0207675_102049404 3300026118 Bacteria 589
239 Ga0207675_102082936 3300026118 Unclassified 584
240 Ga0207683_10101074 3300026121 Bacteria 2574
241 Ga0207698_11145139 3300026142 Bacteria 791
242 Ga0268266_10060308 3300028379 Bacteria 3270
243 Ga0268266_10377356 3300028379 Bacteria 1337
244 Ga0268265_10440805 3300028380 Bacteria 1214
245 Ga0268264_10162173 3300028381 Unclassified 2015
246 Ga0268264_11349421 3300028381 Bacteria 723
247 Ga0373954_0500775 3300035118 Bacteria 602
248 Ga0373937_0036684 3300036401 Bacteria 4468
249 Ga0373937_0165258 3300036401 Bacteria 2075
250 Ga0373937_0306376 3300036401 Bacteria 1502
251 Ga0466963_0000011 3300044694 Bacteria 65918
252 Ga0495629_0000431 3300046459 Bacteria 34967
253 Ga0495629_0646063 3300046459 Unclassified 705
254 Ga0495641_0000214 3300046461 Bacteria 44992
255 Ga0495651_0444928 3300046462 Unclassified 838
256 Ga0495653_0369076 3300046463 Unclassified 919
257 Ga0495608_0093536 3300046511 Bacteria 1942
258 Ga0495608_0162594 3300046511 Bacteria 1419
259 Ga0495608_0405883 3300046511 Unclassified 833
260 Ga0495628_0460086 3300046516 Bacteria 923
261 Ga0495630_0035038 3300046517 Bacteria 3751
262 Ga0495644_0001925 3300046523 Bacteria 8341
263 Ga0495652_0000023 3300046529 Bacteria 168049
264 Ga0495652_0717025 3300046529 Unclassified 672
265 Ga0495586_0001810 3300046535 Bacteria 11669
266 Ga0495645_0179174 3300046543 Bacteria 1453
267 Ga0495667_0066266 3300046559 Bacteria 2361
268 Ga0495634_0634517 3300046642 Unclassified 618
269 Ga0495625_0863886 3300046660 Unclassified 521
270 Ga0495635_0995091 3300046663 Unclassified 534
271 Ga0495657_0002934 3300046675 Bacteria 14139
272 Ga0495647_0000016 3300046681 Bacteria 86316
273 Ga0495647_0000508 3300046681 Bacteria 11338
274 Ga0495669_0000167 3300046684 Bacteria 41728
275 Ga0495613_0569800 3300046689 Unclassified 756
276 Ga0495624_0000024 3300046690 Bacteria 98577
277 Ga0495649_0000320 3300046694 Bacteria 41735
278 Ga0495649_0001372 3300046694 Bacteria 18481
279 Ga0495660_0067146 3300046810 Bacteria 1911
280 Ga0495604_0757063 3300047317 Unclassified 614
281 Ga0495676_0000127 3300047321 Bacteria 57750
282 Ga0495676_0171639 3300047321 Bacteria 1526
283 Ga0495676_0236939 3300047321 Bacteria 1251
284 Ga0495680_0100266 3300047322 Bacteria 2158
285 Ga0495680_0386717 3300047322 Bacteria 968
286 Ga0495675_0076715 3300047444 Bacteria 2106
287 Ga0495679_111800 3300047446 Unclassified 751
288 Ga0495593_0070752 3300047673 Bacteria 1812
289 Ga0495602_0335186 3300048088 Unclassified 1096
290 Ga0496100_1198421 3300048903 Bacteria 599
291 Ga0496100_1680391 3300048903 Unclassified 502
292 Ga0496102_0181481 3300048905 Bacteria 1983
293 Ga0496102_0411969 3300048905 Unclassified 1270
294 Ga0496103_0361110 3300048906 Bacteria 934
295 Ga0496104_0027906 3300048907 Bacteria 5227
296 Ga0496105_0004752 3300048908 Bacteria 10252
297 Ga0496106_0721810 3300048909 Bacteria 793
298 Ga0496107_0090456 3300048910 Bacteria 2236
299 Ga0496107_0300755 3300048910 Bacteria 1194
300 Ga0496107_0936920 3300048910 Bacteria 630
301 Ga0496108_0064223 3300048911 Bacteria 3092
302 Ga0496108_0311428 3300048911 Unclassified 1372
303 Ga0496109_0529527 3300048912 Bacteria 1112
304 Ga0496109_0606712 3300048912 Bacteria 1031
305 Ga0496109_1092858 3300048912 Bacteria 735
306 Ga0496109_1884817 3300048912 Bacteria 530
307 Ga0496110_0052358 3300048913 Bacteria 3587
308 Ga0496110_0121823 3300048913 Bacteria 2350
309 Ga0496110_0297979 3300048913 Unclassified 1469
310 Ga0496111_0028464 3300048914 Bacteria 3960
311 Ga0496111_0145787 3300048914 Bacteria 1755
312 Ga0496111_0493303 3300048914 Unclassified 902
313 Ga0496112_0030881 3300048915 Bacteria 5191
314 Ga0496112_0139425 3300048915 Bacteria 2394
315 Ga0496112_1160449 3300048915 Bacteria 690
316 Ga0496113_0060002 3300048916 Bacteria 2866
317 Ga0496113_0343057 3300048916 Bacteria 1198
318 Ga0496113_0965951 3300048916 Unclassified 672
319 Ga0496114_0000054 3300048917 Bacteria 98328
320 Ga0496115_0000184 3300048918 Bacteria 58010
321 Ga0496115_0016828 3300048918 Bacteria 5575
322 Ga0496124_0099506 3300048927 Bacteria 2358
323 Ga0501048_0936598 3300049582 Unclassified 623
324 Ga0501069_0662945 3300049585 Bacteria 628
325 Ga0501071_0750951 3300049587 Unclassified 752
326 Ga0501075_0001414 3300049591 Bacteria 15642
327 Ga0501076_0986832 3300049592 Bacteria 694
328 Ga0501035_0839113 3300049822 Unclassified 732
329 Ga0501045_0514080 3300049824 Unclassified 889
330 nmdc:mga03n38_104031_c1 3300050490 Bacteria 1373
331 nmdc:mga03n38_250433_c1 3300050490 Bacteria 935
332 nmdc:mga03n38_834783_c1 3300050490 Unclassified 538
333 nmdc:mga03n38_97800_c1 3300050490 Unclassified 1410
334 nmdc:mga00v17_175749_c1 3300050491 Bacteria 1381
335 nmdc:mga00v17_209910_c1 3300050491 Unclassified 1260
336 nmdc:mga00v17_265103_c1 3300050491 Bacteria 1115
337 nmdc:mga0yw44_20809_c1 3300050492 Bacteria 3648
338 nmdc:mga0yw44_434203_c1 3300050492 Bacteria 890
339 nmdc:mga06z11_147066_c1 3300050494 Unclassified 1336
340 nmdc:mga06z11_293497_c1 3300050494 Bacteria 965
341 nmdc:mga07m45_821855_c1 3300050496 Bacteria 532
342 nmdc:mga05p37_764803_c1 3300050507 Bacteria 1062
343 nmdc:mga0qj67_1416905_c1 3300050509 Bacteria 536
344 nmdc:mga0qj67_605803_c1 3300050509 Bacteria 876
345 nmdc:mga06r32_1734234_c1 3300050510 Unclassified 561
346 nmdc:mga06r32_193330_c1 3300050510 Bacteria 2022
347 nmdc:mga08y16_579247_c1 3300050511 Unclassified 1133
348 nmdc:mga0n895_300209_c1 3300050512 Bacteria 1628
349 nmdc:mga0n895_811289_c1 3300050512 Unclassified 926
350 nmdc:mga0rr50_1130176_c1 3300050513 Unclassified 666
351 nmdc:mga08x19_309821_c1 3300050514 Bacteria 1097
352 nmdc:mga0a205_159332_c1 3300050515 Bacteria 2154
353 Ga0495601_0229995 3300053077 Bacteria 1211
354 Ga0495601_0910458 3300053077 Unclassified 555
355 Ga0495612_0000024 3300053078 Bacteria 115718
356 Ga0495612_0003998 3300053078 Bacteria 6110
357 Ga0495619_0000001 3300053085 Bacteria 586054
358 Ga0495619_0013611 3300053085 Bacteria 5126
359 Ga0495619_0016050 3300053085 Bacteria 4741
360 Ga0495619_0043583 3300053085 Bacteria 2942
361 Ga0500614_000559 3300053123 Bacteria 9591
362 Ga0501084_1118058 3300054114 Bacteria 661
363 Ga0081455_10450698
364 Ga0058861_10953391
365 Ga0058862_10743335
366 Ga0070658_10091799
367 Ga0070658_10277496
368 Ga0070676_10296823
369 Ga0070683_100600378
370 Ga0070670_100299548
371 Ga0068869_100066706
372 Ga0068869_100093171
373 Ga0068869_101651454
374 Ga0070680_100328251
375 Ga0070682_100053195
376 Ga0070682_100142468
377 Ga0070682_100477425
378 Ga0068868_100320510
379 Ga0068868_100850441
380 Ga0068868_101625004
381 Ga0070689_100320257
382 Ga0070691_10062089
383 Ga0070687_100247305
384 Ga0070661_100244758
385 Ga0070661_100404345
386 Ga0070692_10080039
387 Ga0070668_100956977
388 Ga0070668_101439339
389 Ga0070669_102021543
390 Ga0070675_100920264
391 Ga0070671_100046847
392 Ga0070674_101625483
393 Ga0070673_100008438
394 Ga0070659_100234164
395 Ga0070667_102364248
396 Ga0070709_10341067
397 Ga0070710_10267870
398 Ga0070701_10188974
399 Ga0070701_10606812
400 Ga0070711_100782785
401 Ga0070705_100174559
402 Ga0070700_100048619
403 Ga0070700_100069889
404 Ga0070663_100117916
405 Ga0070663_100947585
406 Ga0070678_100733168
407 Ga0070662_100338170
408 Ga0070662_100982435
409 Ga0070681_10022632
410 Ga0068867_101188363
411 Ga0070685_10326600
412 Ga0070685_10561481
413 Ga0070685_11130284
414 Ga0070679_100002463
415 Ga0070684_100044625
416 Ga0070684_100123307
417 Ga0070684_100345341
418 Ga0068853_100089741
419 Ga0068853_100954760
420 Ga0070672_101125303
421 Ga0070696_100806751
422 Ga0070696_100871130
423 Ga0070693_100309178
424 Ga0070693_101437767
425 Ga0070665_100084587
426 Ga0070704_100246988
427 Ga0070704_100736714
428 Ga0068855_100237034
429 Ga0068855_101447698
430 Ga0068857_100338913
431 Ga0068857_101866057
432 Ga0068854_100735225
433 Ga0068856_100000542
434 Ga0070702_100016876
435 Ga0070702_100593817
436 Ga0068852_100089555
437 Ga0068859_100565807
438 Ga0068864_100018845
439 Ga0068866_10000248
440 Ga0068866_10079535
441 Ga0068861_100234040
442 Ga0068863_100699025
443 Ga0068858_100000353
444 Ga0068858_101794011
445 Ga0068858_102351842
446 Ga0068862_100449655
447 Ga0081455_10406807
448 Ga0081455_10607658
449 Ga0081540_1122052
450 Ga0081539_10074217
451 Ga0075365_10020328
452 Ga0075365_10150761
453 Ga0075365_10788951
454 Ga0075363_100046508
455 Ga0075363_100058239
456 Ga0075363_100105515
457 Ga0075363_100179360
458 Ga0075363_100612068
459 Ga0075363_100988393
460 Ga0075364_10082592
461 Ga0075364_10212387
462 Ga0075364_10753204
463 Ga0075364_11149494
464 Ga0070716_100371444
465 Ga0070712_100247218
466 Ga0075367_10087414
467 Ga0075367_10165259
468 Ga0097621_102380670
469 Ga0075370_10930100
470 Ga0075428_100071107
471 Ga0075430_100377780
472 Ga0075430_101418502
473 Ga0075431_100037150
474 Ga0075433_10038932
475 Ga0075433_11674037
476 Ga0075434_100134858
477 Ga0075429_100108771
478 Ga0068865_100000013
479 Ga0068865_100556426
480 Ga0068865_100884320
481 Ga0068865_101822715
482 Ga0097620_100565770
483 Ga0075435_100182588
484 Ga0099795_10456072
485 Ga0111539_11624515
486 Ga0111539_11849968
487 Ga0105245_10009098
488 Ga0105245_10020163
489 Ga0105245_10501937
490 Ga0105245_10926806
491 Ga0105245_11849055
492 Ga0105245_12177533
493 Ga0105247_10060206
494 Ga0105247_10250051
495 Ga0114129_10863575
496 Ga0105243_11964266
497 Ga0105241_11431057
498 Ga0105242_10005063
499 Ga0105242_10109524
500 Ga0105242_11565393
501 Ga0105242_12676918
502 Ga0105242_12787413
503 Ga0105248_10205419
504 Ga0105249_10522645
505 Ga0105249_13129521
506 Ga0105033_111359
507 Ga0105239_10641617
508 Ga0105239_10883134
509 Ga0105239_12980149
510 Ga0105246_10164552
511 Ga0105246_10168529
512 Ga0157321_1037856
513 Ga0157342_1058244
514 Ga0157370_10326616
515 Ga0157374_10002158
516 Ga0157374_10012946
517 Ga0157378_10737287
518 Ga0163162_10166435
519 Ga0163162_11225680
520 Ga0163162_12343175
521 Ga0157372_10384770
522 Ga0157372_12730725
523 Ga0157375_10058329
524 Ga0157375_10684279
525 Ga0163163_10094869
526 Ga0163163_10604056
527 Ga0157380_10123727
528 Ga0157380_11783906
529 Ga0157380_12190848
530 Ga0157377_10258251
531 Ga0157377_10380685
532 Ga0157377_11514686
533 Ga0157376_10574107
534 Ga0163161_10450821
535 Ga0163161_11697096
536 Ga0206350_10530580
537 Ga0207692_10983221
538 Ga0207642_10003626
539 Ga0207710_10046135
540 Ga0207688_10039216
541 Ga0207647_10553171
542 Ga0207699_10189931
543 Ga0207705_10069378
544 Ga0207707_10054143
545 Ga0207693_10074509
546 Ga0207693_10842701
547 Ga0207660_10224976
548 Ga0207660_11087715
549 Ga0207662_10172196
550 Ga0207649_10153439
551 Ga0207649_10472281
552 Ga0207652_10000400
553 Ga0207694_10517766
554 Ga0207650_10203782
555 Ga0207650_10785939
556 Ga0207687_10010121
557 Ga0207687_10182799
558 Ga0207687_10293406
559 Ga0207687_10386852
560 Ga0207687_10603491
561 Ga0207690_10197054
562 Ga0207690_10582029
563 Ga0207706_10170507
564 Ga0207706_10858407
565 Ga0207706_11718590
566 Ga0207686_10084080
567 Ga0207686_10221085
568 Ga0207709_11395156
569 Ga0207669_10000010
570 Ga0207669_10471467
571 Ga0207669_11093382
572 Ga0207704_10003815
573 Ga0207704_10595529
574 Ga0207704_10777145
575 Ga0207665_10930921
576 Ga0207689_10090786
577 Ga0207689_10445322
578 Ga0207661_10007432
579 Ga0207661_10745508
580 Ga0207667_11808265
581 Ga0207651_10017957
582 Ga0207712_10374173
583 Ga0207712_11200015
584 Ga0207712_11298272
585 Ga0207658_11080416
586 Ga0207677_10027794
587 Ga0207677_10759642
588 Ga0207703_10000339
589 Ga0207639_11451228
590 Ga0207678_10708881
591 Ga0207708_10025086
592 Ga0207708_10135866
593 Ga0207708_11845288
594 Ga0207708_11966365
595 Ga0207702_10001133
596 Ga0207702_10199819
597 Ga0207641_10590792
598 Ga0207648_10869903
599 Ga0207675_100170283
600 Ga0207675_102049404
601 Ga0207675_102082936
602 Ga0207683_10101074
603 Ga0207698_11145139
604 Ga0268266_10060308
605 Ga0268266_10377356
606 Ga0268265_10440805
607 Ga0268264_10162173
608 Ga0268264_11349421
609 Ga0373954_0500775
610 Ga0373937_0036684
611 Ga0373937_0165258
612 Ga0373937_0306376
613 Ga0466963_0000011
614 Ga0495629_0000431
615 Ga0495629_0646063
616 Ga0495641_0000214
617 Ga0495651_0444928
618 Ga0495653_0369076
619 Ga0495608_0093536
620 Ga0495608_0162594
621 Ga0495608_0405883
622 Ga0495628_0460086
623 Ga0495630_0035038
624 Ga0495644_0001925
625 Ga0495652_0000023
626 Ga0495652_0717025
627 Ga0495586_0001810
628 Ga0495645_0179174
629 Ga0495667_0066266
630 Ga0495634_0634517
631 Ga0495625_0863886
632 Ga0495635_0995091
633 Ga0495657_0002934
634 Ga0495647_0000016
635 Ga0495647_0000508
636 Ga0495669_0000167
637 Ga0495613_0569800
638 Ga0495624_0000024
639 Ga0495649_0000320
640 Ga0495649_0001372
641 Ga0495660_0067146
642 Ga0495604_0757063
643 Ga0495676_0000127
644 Ga0495676_0171639
645 Ga0495676_0236939
646 Ga0495680_0100266
647 Ga0495680_0386717
648 Ga0495675_0076715
649 Ga0495679_111800
650 Ga0495593_0070752
651 Ga0495602_0335186
652 Ga0496100_1198421
653 Ga0496100_1680391
654 Ga0496102_0181481
655 Ga0496102_0411969
656 Ga0496103_0361110
657 Ga0496104_0027906
658 Ga0496105_0004752
659 Ga0496106_0721810
660 Ga0496107_0090456
661 Ga0496107_0300755
662 Ga0496107_0936920
663 Ga0496108_0064223
664 Ga0496108_0311428
665 Ga0496109_0529527
666 Ga0496109_0606712
667 Ga0496109_1092858
668 Ga0496109_1884817
669 Ga0496110_0052358
670 Ga0496110_0121823
671 Ga0496110_0297979
672 Ga0496111_0028464
673 Ga0496111_0145787
674 Ga0496111_0493303
675 Ga0496112_0030881
676 Ga0496112_0139425
677 Ga0496112_1160449
678 Ga0496113_0060002
679 Ga0496113_0343057
680 Ga0496113_0965951
681 Ga0496114_0000054
682 Ga0496115_0000184
683 Ga0496115_0016828
684 Ga0496124_0099506
685 Ga0501048_0936598
686 Ga0501069_0662945
687 Ga0501071_0750951
688 Ga0501075_0001414
689 Ga0501076_0986832
690 Ga0501035_0839113
691 Ga0501045_0514080
692 nmdc:mga03n38_104031_c1
693 nmdc:mga03n38_250433_c1
694 nmdc:mga03n38_834783_c1
695 nmdc:mga03n38_97800_c1
696 nmdc:mga00v17_175749_c1
697 nmdc:mga00v17_209910_c1
698 nmdc:mga00v17_265103_c1
699 nmdc:mga0yw44_20809_c1
700 nmdc:mga0yw44_434203_c1
701 nmdc:mga06z11_147066_c1
702 nmdc:mga06z11_293497_c1
703 nmdc:mga07m45_821855_c1
704 nmdc:mga05p37_764803_c1
705 nmdc:mga0qj67_1416905_c1
706 nmdc:mga0qj67_605803_c1
707 nmdc:mga06r32_1734234_c1
708 nmdc:mga06r32_193330_c1
709 nmdc:mga08y16_579247_c1
710 nmdc:mga0n895_300209_c1
711 nmdc:mga0n895_811289_c1
712 nmdc:mga0rr50_1130176_c1
713 nmdc:mga08x19_309821_c1
714 nmdc:mga0a205_159332_c1
715 Ga0495601_0229995
716 Ga0495601_0910458
717 Ga0495612_0000024
718 Ga0495612_0003998
719 Ga0495619_0000001
720 Ga0495619_0013611
721 Ga0495619_0016050
722 Ga0495619_0043583
723 Ga0500614_000559
724 Ga0501084_1118058

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wmk-assembly1.cif.gz_A crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae sp3-bs71 (sp3gh98) in complex with the a-lewisy pentasaccharide blood group antigen. 0.7174 32 53
2wmi-assembly1.cif.gz_A crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae sp3-bs71 in complex with the a-trisaccharide blood group antigen. 0.7006 31 53
2pgc-assembly1.cif.gz_C crystal structure of a a marine metagenome protein (jcvi_pep_1096685590403) from uncultured marine organism at 2.53 a resolution 0.6961 2 85
4d6i-assembly1.cif.gz_A crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the type 1 blood group a-tetrasaccharide (e558a l19 mutant) 0.6912 32 53
4d6d-assembly1.cif.gz_A crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the blood group a-trisaccharide (x02 mutant) 0.6887 32 53
ID Description Score Start End Superfamily
af_Q2G0W0_4_114_3.10.450.40 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.838 31 57 3.10.450.40
af_P9WLA3_32_98_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7428 5 67 3.10.450.240
1wd6B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.727 1 89 3.30.70.100
af_Q86HP6_27_112_3.30.310.50 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.7212 1 69 3.30.310.50
af_P9WLA3_28_227_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7197 2 85 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A538K827-F1-model_v4 ABM domain-containing protein 0.9711 1 94
AF-A0A6N6JWQ9-F1-model_v4 ABM domain-containing protein 0.9699 6 94
AF-A0A538K827-F1-model_v4 ABM domain-containing protein 0.961 1 94
AF-A0A6N6JWQ9-F1-model_v4 ABM domain-containing protein 0.9492 6 94
AF-A0A538MF73-F1-model_v4 ABM domain-containing protein 0.934 1 94

Map