F422536

General Info

Members Datasets Scaffolds Average Seq Length
362 209 724 249

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100114763|Ga0068856_1001147634
Length 260
Sequence MSVASGAAEGRRGGVAPATLTIGDVLAHLKPEFPDLTISKIRFLEGEGLVQPERTPSGYRKFSAADVARLRYVLAQQKEHYLPLKVIKEQLEAIDRGLVPPGSSGTATSAPRVPHMSIAAIEDNAPTGEHFRPAPAAMRLSREELLNAAGLRNDQLGELEQFGLISKRPGGHYDDDALAVGKIVAELAKYGLEGRHLRAFRTAAEREVGLFGQVVEPIARQRGSAAKVRAEETVRELAALSVRLHAALVQIGLRDVLSGS

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
139 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
140 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
148 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
203 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
204 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
205 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
206 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
207 2891562705 Microbispora tritici MT50 Isolate Unclassified
208 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
209 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.41
Metatranscriptomes 1.38
Isolates 2.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.29
Rhizosphere 86.46
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100114763 3300005614 Bacteria 2693
2 JGI24737J22298_10014171 3300001990 Bacteria 2589
3 JGI24735J21928_10040084 3300002067 Bacteria 1368
4 Ga0070676_10033973 3300005328 Bacteria 2927
5 Ga0068869_100014623 3300005334 Bacteria 5248
6 Ga0070666_10003317 3300005335 Bacteria 9754
7 Ga0070666_10024058 3300005335 Bacteria 3966
8 Ga0070682_100258118 3300005337 Bacteria 1260
9 Ga0068868_100244555 3300005338 Bacteria 1508
10 Ga0070660_100075477 3300005339 Bacteria 2639
11 Ga0070660_100236544 3300005339 Bacteria 1487
12 Ga0070691_10063943 3300005341 Bacteria 1774
13 Ga0070661_100226740 3300005344 Bacteria 1435
14 Ga0070692_10034128 3300005345 Bacteria 2567
15 Ga0070668_100002900 3300005347 Bacteria 12663
16 Ga0070668_100114671 3300005347 Bacteria 2147
17 Ga0070675_100066205 3300005354 Bacteria 2988
18 Ga0070671_100021033 3300005355 Bacteria 5325
19 Ga0070671_100068420 3300005355 Bacteria 2962
20 Ga0070674_100037245 3300005356 Bacteria 3270
21 Ga0070673_100005872 3300005364 Bacteria 7916
22 Ga0070688_100096228 3300005365 Bacteria 1944
23 Ga0070667_100005054 3300005367 Bacteria 11038
24 Ga0070667_100006026 3300005367 Bacteria 10075
25 Ga0070667_100049230 3300005367 Bacteria 3548
26 Ga0070709_10162627 3300005434 Bacteria 1553
27 Ga0070714_100000185 3300005435 Bacteria 49905
28 Ga0070714_100061153 3300005435 Bacteria 3234
29 Ga0070714_100128817 3300005435 Bacteria 2260
30 Ga0070714_100763800 3300005435 Bacteria 935
31 Ga0070713_100045264 3300005436 Bacteria 3605
32 Ga0070701_10027248 3300005438 Bacteria 2797
33 Ga0070711_100007302 3300005439 Bacteria 6720
34 Ga0070700_100000184 3300005441 Bacteria 35554
35 Ga0070694_100366783 3300005444 Bacteria 1120
36 Ga0070663_100061005 3300005455 Bacteria 2714
37 Ga0070678_100025304 3300005456 Bacteria 3990
38 Ga0070662_100028809 3300005457 Bacteria 3869
39 Ga0070681_10375220 3300005458 Bacteria 1333
40 Ga0070698_100490432 3300005471 Bacteria 1166
41 Ga0068853_100006715 3300005539 Bacteria 9168
42 Ga0070672_100013383 3300005543 Bacteria 5795
43 Ga0070686_100052132 3300005544 Bacteria 2607
44 Ga0070695_100167985 3300005545 Bacteria 1545
45 Ga0070696_100063217 3300005546 Bacteria 2592
46 Ga0070693_100004569 3300005547 Bacteria 6563
47 Ga0070665_100338316 3300005548 Bacteria 1510
48 Ga0070704_100189342 3300005549 Bacteria 1652
49 Ga0068855_100016764 3300005563 Bacteria 8809
50 Ga0068855_100021450 3300005563 Bacteria 7745
51 Ga0068855_100041577 3300005563 Bacteria 5448
52 Ga0068855_100059501 3300005563 Bacteria 4470
53 Ga0068855_100112739 3300005563 Bacteria 3121
54 Ga0068855_101011280 3300005563 Bacteria 873
55 Ga0070664_100289704 3300005564 Bacteria 1478
56 Ga0068857_100128302 3300005577 Bacteria 2286
57 Ga0068854_100035646 3300005578 Bacteria 3483
58 Ga0068854_100377149 3300005578 Bacteria 1168
59 Ga0068856_100006679 3300005614 Bacteria 11310
60 Ga0068856_100021634 3300005614 Bacteria 6251
61 Ga0068856_100061799 3300005614 Bacteria 3700
62 Ga0068856_100072469 3300005614 Bacteria 3410
63 Ga0068856_100344306 3300005614 Bacteria 1509
64 Ga0070702_100078816 3300005615 Bacteria 1967
65 Ga0068852_100050308 3300005616 Bacteria 3570
66 Ga0068852_100107160 3300005616 Bacteria 2534
67 Ga0068852_100304498 3300005616 Bacteria 1543
68 Ga0068852_100529260 3300005616 Bacteria 1177
69 Ga0068859_100002361 3300005617 Bacteria 19217
70 Ga0068859_100093879 3300005617 Bacteria 3052
71 Ga0068864_100024217 3300005618 Bacteria 5104
72 Ga0068866_10017116 3300005718 Bacteria 3255
73 Ga0068861_100022015 3300005719 Bacteria 4586
74 Ga0068851_10029291 3300005834 Bacteria 2725
75 Ga0068870_10025366 3300005840 Bacteria 2942
76 Ga0068863_100004882 3300005841 Bacteria 13214
77 Ga0068863_100015311 3300005841 Bacteria 7370
78 Ga0068858_100013689 3300005842 Bacteria 7655
79 Ga0068858_100110718 3300005842 Bacteria 2564
80 Ga0068860_100000035 3300005843 Bacteria 238993
81 Ga0068860_100042424 3300005843 Bacteria 4344
82 Ga0081455_10005234 3300005937 Bacteria 14260
83 Ga0081540_1005470 3300005983 Bacteria 9475
84 Ga0070717_10009177 3300006028 Bacteria 7432
85 Ga0070717_10254530 3300006028 Bacteria 1552
86 Ga0070716_100016696 3300006173 Bacteria 3794
87 Ga0070712_100023323 3300006175 Bacteria 4086
88 Ga0097621_100055298 3300006237 Bacteria 3240
89 Ga0068871_100200529 3300006358 Bacteria 1722
90 Ga0075431_100501748 3300006847 Bacteria 1204
91 Ga0075433_10006767 3300006852 Bacteria 9086
92 Ga0075434_100165663 3300006871 Bacteria 2230
93 Ga0068865_100047181 3300006881 Bacteria 2958
94 Ga0075436_100030843 3300006914 Bacteria 3689
95 Ga0097620_100002361 3300006931 Bacteria 19217
96 Ga0097620_100093877 3300006931 Bacteria 3052
97 Ga0075435_100054586 3300007076 Bacteria 3225
98 Ga0105251_10017885 3300009011 Bacteria 3788
99 Ga0105251_10018729 3300009011 Bacteria 3672
100 Ga0105250_10033257 3300009092 Bacteria 2070
101 Ga0105240_10012487 3300009093 Bacteria 11721
102 Ga0105240_10211260 3300009093 Bacteria 2267
103 Ga0105240_10367696 3300009093 Bacteria 1627
104 Ga0105240_10533329 3300009093 Bacteria 1301
105 Ga0105245_10015300 3300009098 Bacteria 6686
106 Ga0105247_10003264 3300009101 Bacteria 10634
107 Ga0105247_10013085 3300009101 Bacteria 4976
108 Ga0105243_10029336 3300009148 Bacteria 4229
109 Ga0105241_10036646 3300009174 Bacteria 3692
110 Ga0105242_10005734 3300009176 Bacteria 9571
111 Ga0105248_10134364 3300009177 Bacteria 2791
112 Ga0105237_10041205 3300009545 Bacteria 4658
113 Ga0105237_10043794 3300009545 Bacteria 4507
114 Ga0105237_10052211 3300009545 Bacteria 4105
115 Ga0105238_10168465 3300009551 Bacteria 2166
116 Ga0105238_10238462 3300009551 Bacteria 1796
117 Ga0105238_10608721 3300009551 Bacteria 1101
118 Ga0105249_10005245 3300009553 Bacteria 11188
119 Ga0105249_10216240 3300009553 Bacteria 1884
120 Ga0105239_10068028 3300010375 Bacteria 3914
121 Ga0105239_10334200 3300010375 Bacteria 1709
122 Ga0105246_10003223 3300011119 Bacteria 9905
123 Ga0157370_10123817 3300013104 Bacteria 2414
124 Ga0157369_10071300 3300013105 Bacteria 3730
125 Ga0157374_10067841 3300013296 Bacteria 3355
126 Ga0163162_10014032 3300013306 Bacteria 7830
127 Ga0157372_10001302 3300013307 Bacteria 26984
128 Ga0157372_10699651 3300013307 Bacteria 1179
129 Ga0163163_10097694 3300014325 Bacteria 2957
130 Ga0157380_10033341 3300014326 Bacteria 3965
131 Ga0157377_10261404 3300014745 Bacteria 1126
132 Ga0157379_10042835 3300014968 Bacteria 4042
133 Ga0163161_10023316 3300017792 Bacteria 4366
134 Ga0206353_10021455 3300020082 Bacteria 3103
135 Ga0206353_10253874 3300020082 Bacteria 1465
136 Ga0213876_10027237 3300021384 Bacteria 3017
137 Ga0213875_10042765 3300021388 Bacteria 2128
138 Ga0224712_10015633 3300022467 Bacteria 2474
139 Ga0224712_10016179 3300022467 Bacteria 2444
140 Ga0224712_10062743 3300022467 Bacteria 1485
141 Ga0207713_1079371 3300025735 Bacteria 1185
142 Ga0207692_10020732 3300025898 Bacteria 2995
143 Ga0207710_10001933 3300025900 Bacteria 9920
144 Ga0207710_10095059 3300025900 Bacteria 1400
145 Ga0207688_10005436 3300025901 Bacteria 6925
146 Ga0207680_10007745 3300025903 Bacteria 5248
147 Ga0207680_10013189 3300025903 Bacteria 4236
148 Ga0207647_10038438 3300025904 Bacteria 3026
149 Ga0207699_10044945 3300025906 Bacteria 2574
150 Ga0207705_10298903 3300025909 Bacteria 1234
151 Ga0207654_10122780 3300025911 Bacteria 1633
152 Ga0207695_10048226 3300025913 Bacteria 4500
153 Ga0207695_10072221 3300025913 Bacteria 3522
154 Ga0207695_10154591 3300025913 Bacteria 2229
155 Ga0207695_10178454 3300025913 Bacteria 2045
156 Ga0207671_10027300 3300025914 Bacteria 4268
157 Ga0207693_10000761 3300025915 Bacteria 28954
158 Ga0207657_10030578 3300025919 Bacteria 4886
159 Ga0207649_10489672 3300025920 Bacteria 934
160 Ga0207694_10124640 3300025924 Bacteria 2060
161 Ga0207659_10123569 3300025926 Bacteria 1987
162 Ga0207687_10040732 3300025927 Bacteria 3186
163 Ga0207687_10114380 3300025927 Bacteria 2008
164 Ga0207664_10000002 3300025929 Bacteria 657053
165 Ga0207644_10040748 3300025931 Bacteria 3283
166 Ga0207706_10006255 3300025933 Bacteria 11067
167 Ga0207665_10000422 3300025939 Bacteria 29175
168 Ga0207689_10008948 3300025942 Bacteria 8680
169 Ga0207667_10016618 3300025949 Bacteria 8307
170 Ga0207667_10034175 3300025949 Bacteria 5462
171 Ga0207667_10120154 3300025949 Bacteria 2708
172 Ga0207667_10353724 3300025949 Bacteria 1498
173 Ga0207667_10973620 3300025949 Bacteria 837
174 Ga0207651_10108439 3300025960 Bacteria 2078
175 Ga0207712_10021402 3300025961 Bacteria 4246
176 Ga0207712_10153118 3300025961 Bacteria 1783
177 Ga0207668_10011660 3300025972 Bacteria 5349
178 Ga0207668_10034693 3300025972 Bacteria 3352
179 Ga0207640_10106541 3300025981 Bacteria 1977
180 Ga0207640_10237321 3300025981 Bacteria 1407
181 Ga0207658_10013680 3300025986 Bacteria 5549
182 Ga0207677_10138200 3300026023 Bacteria 1861
183 Ga0207703_10087458 3300026035 Bacteria 2613
184 Ga0207703_10475659 3300026035 Bacteria 1170
185 Ga0207678_10001278 3300026067 Bacteria 23260
186 Ga0207708_10000023 3300026075 Bacteria 176615
187 Ga0207702_10005937 3300026078 Bacteria 10608
188 Ga0207702_10007680 3300026078 Bacteria 9169
189 Ga0207702_10102364 3300026078 Bacteria 2531
190 Ga0207702_10382823 3300026078 Bacteria 1353
191 Ga0207641_10038448 3300026088 Bacteria 4000
192 Ga0207641_10066911 3300026088 Bacteria 3076
193 Ga0207648_10463590 3300026089 Bacteria 1155
194 Ga0207676_10144113 3300026095 Bacteria 2043
195 Ga0207675_100020738 3300026118 Bacteria 6127
196 Ga0207683_10004856 3300026121 Bacteria 11575
197 Ga0207698_10025660 3300026142 Bacteria 4156
198 Ga0207698_10419635 3300026142 Bacteria 1283
199 Ga0268266_10001967 3300028379 Bacteria 23057
200 Ga0268266_10715780 3300028379 Bacteria 965
201 Ga0268264_10000031 3300028381 Bacteria 409525
202 Ga0373930_0037794 3300034816 Bacteria 1017
203 Ga0373952_0005181 3300035092 Bacteria 2377
204 Ga0373932_0003072 3300035112 Bacteria 4076
205 Ga0373961_0007495 3300035241 Bacteria 2640
206 Ga0373931_0002210 3300035691 Bacteria 8594
207 Ga0373927_0285740 3300035695 Bacteria 1085
208 Ga0395899_0302595 3300037312 Unclassified 1082
209 Ga0436364_0516703 3300037853 Bacteria 6526
210 Ga0436365_1340223 3300039437 Bacteria 3054
211 Ga0439463_013636 3300042016 Bacteria 2001
212 Ga0439458_0004053 3300042157 Bacteria 3382
213 Ga0466969_0008483 3300044656 Bacteria 5451
214 Ga0466972_0044304 3300044658 Bacteria 2158
215 Ga0466972_0046374 3300044658 Bacteria 2104
216 Ga0466972_0080928 3300044658 Bacteria 1547
217 Ga0466972_0137088 3300044658 Bacteria 1152
218 Ga0466965_0010965 3300044683 Bacteria 4239
219 Ga0466966_0012157 3300044684 Bacteria 5703
220 Ga0466966_0070507 3300044684 Bacteria 2191
221 Ga0466966_0070590 3300044684 Bacteria 2190
222 Ga0466966_0073255 3300044684 Bacteria 2143
223 Ga0466966_0117400 3300044684 Bacteria 1637
224 Ga0466966_0128649 3300044684 Bacteria 1552
225 Ga0466966_0142500 3300044684 Bacteria 1464
226 Ga0466961_0006943 3300044693 Bacteria 7204
227 Ga0466961_0016441 3300044693 Bacteria 4755
228 Ga0466961_0021704 3300044693 Bacteria 4131
229 Ga0466961_0023676 3300044693 Bacteria 3951
230 Ga0466961_0026300 3300044693 Bacteria 3741
231 Ga0466963_0001197 3300044694 Bacteria 13660
232 Ga0466963_0004114 3300044694 Bacteria 8415
233 Ga0466963_0005135 3300044694 Bacteria 7644
234 Ga0466963_0020352 3300044694 Bacteria 4172
235 Ga0466963_0027052 3300044694 Bacteria 3670
236 Ga0466963_0065795 3300044694 Bacteria 2431
237 Ga0466963_0067338 3300044694 Bacteria 2403
238 Ga0466963_0078413 3300044694 Bacteria 2233
239 Ga0466963_0088964 3300044694 Bacteria 2100
240 Ga0466963_0106162 3300044694 Bacteria 1925
241 Ga0466963_0139720 3300044694 Bacteria 1677
242 Ga0466963_0158666 3300044694 Bacteria 1574
243 Ga0466963_0195305 3300044694 Bacteria 1415
244 Ga0466963_0225424 3300044694 Bacteria 1313
245 Ga0466964_0014548 3300044706 Bacteria 2992
246 Ga0466964_0017405 3300044706 Bacteria 2750
247 Ga0466964_0062846 3300044706 Bacteria 1549
248 Ga0466964_0095374 3300044706 Bacteria 1302
249 Ga0466971_0075263 3300044719 Bacteria 1535
250 Ga0466971_0180852 3300044719 Bacteria 991
251 Ga0466968_0048607 3300044735 Bacteria 1806
252 Ga0466970_0001419 3300044765 Bacteria 11586
253 Ga0466970_0028510 3300044765 Bacteria 2934
254 Ga0466970_0069251 3300044765 Bacteria 1896
255 Ga0466970_0077146 3300044765 Bacteria 1796
256 Ga0466957_0017495 3300044842 Bacteria 4199
257 Ga0466957_0037187 3300044842 Bacteria 2930
258 Ga0466957_0067717 3300044842 Bacteria 2203
259 Ga0466957_0068135 3300044842 Bacteria 2196
260 Ga0466960_0006393 3300044901 Bacteria 4726
261 Ga0466959_0001698 3300045049 Bacteria 13673
262 Ga0466959_0053665 3300045049 Bacteria 2946
263 Ga0466959_0086790 3300045049 Bacteria 2251
264 Ga0466959_0089765 3300045049 Bacteria 2208
265 Ga0466959_0123892 3300045049 Bacteria 1835
266 Ga0466958_0005815 3300045836 Bacteria 6672
267 Ga0466958_0009062 3300045836 Bacteria 5528
268 Ga0466958_0013404 3300045836 Bacteria 4667
269 Ga0466958_0025828 3300045836 Bacteria 3466
270 Ga0466958_0030320 3300045836 Bacteria 3212
271 Ga0466958_0030735 3300045836 Bacteria 3191
272 Ga0466958_0049719 3300045836 Bacteria 2537
273 Ga0466958_0117117 3300045836 Bacteria 1666
274 Ga0466967_0000613 3300045976 Bacteria 17801
275 Ga0466967_0004748 3300045976 Bacteria 9247
276 Ga0466967_0004827 3300045976 Bacteria 9193
277 Ga0466967_0012903 3300045976 Bacteria 6424
278 Ga0466967_0033125 3300045976 Bacteria 4372
279 Ga0466967_0057734 3300045976 Bacteria 3427
280 Ga0466967_0111670 3300045976 Bacteria 2512
281 Ga0466967_0161609 3300045976 Bacteria 2103
282 Ga0466967_0180794 3300045976 Bacteria 1989
283 Ga0466967_0194506 3300045976 Bacteria 1918
284 Ga0466967_0202263 3300045976 Bacteria 1882
285 Ga0466967_0205153 3300045976 Bacteria 1868
286 Ga0466967_0277814 3300045976 Bacteria 1606
287 Ga0466967_0331723 3300045976 Bacteria 1469
288 Ga0466967_0405446 3300045976 Bacteria 1327
289 Ga0466967_0419370 3300045976 Bacteria 1304
290 Ga0495635_0283961 3300046663 Bacteria 1112
291 Ga0495676_0075831 3300047321 Bacteria 2570
292 Ga0496100_0559252 3300048903 Unclassified 885
293 Ga0496101_0073521 3300048904 Bacteria 2511
294 Ga0496101_0192800 3300048904 Bacteria 1573
295 Ga0496102_0000474 3300048905 Bacteria 44502
296 Ga0496102_0000735 3300048905 Bacteria 32176
297 Ga0496102_0104432 3300048905 Bacteria 2635
298 Ga0496102_0181170 3300048905 Bacteria 1985
299 Ga0496103_0000976 3300048906 Bacteria 20250
300 Ga0496103_0005567 3300048906 Bacteria 7532
301 Ga0496103_0015419 3300048906 Bacteria 4547
302 Ga0496103_0067370 3300048906 Bacteria 2236
303 Ga0496104_0004536 3300048907 Bacteria 12100
304 Ga0496104_0022625 3300048907 Bacteria 5773
305 Ga0496105_0138715 3300048908 Bacteria 2002
306 Ga0496106_0156592 3300048909 Bacteria 1799
307 Ga0496107_0071418 3300048910 Bacteria 2522
308 Ga0496108_0007637 3300048911 Bacteria 8755
309 Ga0496108_0016478 3300048911 Bacteria 6031
310 Ga0496109_0010596 3300048912 Bacteria 7885
311 Ga0496110_0015465 3300048913 Bacteria 6352
312 Ga0496110_0169994 3300048913 Bacteria 1977
313 Ga0496110_0409616 3300048913 Bacteria 1236
314 Ga0496111_0013474 3300048914 Bacteria 5565
315 Ga0496112_0083654 3300048915 Bacteria 3156
316 Ga0496113_0015998 3300048916 Bacteria 5174
317 Ga0496113_0101853 3300048916 Bacteria 2226
318 Ga0496114_0063958 3300048917 Bacteria 3080
319 Ga0496114_0182616 3300048917 Bacteria 1832
320 Ga0496114_0431550 3300048917 Bacteria 1167
321 Ga0496115_0007736 3300048918 Bacteria 7925
322 Ga0496119_0000960 3300048922 Bacteria 37110
323 Ga0496119_0027393 3300048922 Bacteria 3917
324 Ga0496120_0001834 3300048923 Bacteria 23688
325 Ga0496121_0017831 3300048924 Bacteria 7211
326 Ga0496121_0086440 3300048924 Bacteria 2464
327 Ga0496126_0000006 3300048929 Bacteria 798804
328 Ga0496126_0021047 3300048929 Bacteria 6381
329 Ga0496126_0302167 3300048929 Bacteria 1320
330 Ga0501031_0002698 3300049568 Bacteria 11292
331 Ga0501032_0009780 3300049569 Bacteria 6938
332 Ga0501033_0085199 3300049570 Bacteria 2315
333 Ga0501033_0152833 3300049570 Bacteria 1664
334 Ga0501034_0068888 3300049571 Bacteria 3549
335 Ga0501034_0499740 3300049571 Bacteria 1130
336 Ga0501037_0036393 3300049573 Bacteria 3628
337 Ga0501038_0007999 3300049574 Bacteria 9745
338 Ga0501047_0005402 3300049581 Bacteria 12015
339 Ga0501047_0049715 3300049581 Bacteria 4048
340 Ga0501047_0220080 3300049581 Bacteria 1755
341 Ga0501048_0000405 3300049582 Bacteria 30043
342 Ga0501070_0378389 3300049586 Bacteria 1147
343 Ga0501080_0098689 3300049742 Bacteria 2711
344 Ga0501035_0042132 3300049822 Bacteria 4119
345 Ga0501044_0138393 3300049823 Bacteria 2424
346 Ga0501044_0501932 3300049823 Bacteria 1114
347 nmdc:mga0rr50_85037_c1 3300050513 Bacteria 2451
348 nmdc:mga08x19_105536_c1 3300050514 Bacteria 1874
349 Ga0495595_0102879 3300053084 Bacteria 1380
350 Ga0466962_0002858 3300061719 Bacteria 8229
351 Ga0466962_0013525 3300061719 Bacteria 3929
352 Ga0466962_0062804 3300061719 Bacteria 1774
353 Ga0466962_0064081 3300061719 Bacteria 1755
354 Ga0466962_0145398 3300061719 Bacteria 1149
355 2676492167 2675903060 Bacteria 10051191
356 2856745391 2856741275 Bacteria 8096094
357 2884698296 2884693830 Bacteria 11273186
358 2891397538 2891395885 Bacteria 9251614
359 2891561379 2891554331 Bacteria 8812224
360 2891569050 2891562705 Bacteria 8039471
361 2895427369 2895427314 Bacteria 13147766
362 2895450887 2895442618 Bacteria 11027144
363 Ga0068856_100114763
364 JGI24737J22298_10014171
365 JGI24735J21928_10040084
366 Ga0070676_10033973
367 Ga0068869_100014623
368 Ga0070666_10003317
369 Ga0070666_10024058
370 Ga0070682_100258118
371 Ga0068868_100244555
372 Ga0070660_100075477
373 Ga0070660_100236544
374 Ga0070691_10063943
375 Ga0070661_100226740
376 Ga0070692_10034128
377 Ga0070668_100002900
378 Ga0070668_100114671
379 Ga0070675_100066205
380 Ga0070671_100021033
381 Ga0070671_100068420
382 Ga0070674_100037245
383 Ga0070673_100005872
384 Ga0070688_100096228
385 Ga0070667_100005054
386 Ga0070667_100006026
387 Ga0070667_100049230
388 Ga0070709_10162627
389 Ga0070714_100000185
390 Ga0070714_100061153
391 Ga0070714_100128817
392 Ga0070714_100763800
393 Ga0070713_100045264
394 Ga0070701_10027248
395 Ga0070711_100007302
396 Ga0070700_100000184
397 Ga0070694_100366783
398 Ga0070663_100061005
399 Ga0070678_100025304
400 Ga0070662_100028809
401 Ga0070681_10375220
402 Ga0070698_100490432
403 Ga0068853_100006715
404 Ga0070672_100013383
405 Ga0070686_100052132
406 Ga0070695_100167985
407 Ga0070696_100063217
408 Ga0070693_100004569
409 Ga0070665_100338316
410 Ga0070704_100189342
411 Ga0068855_100016764
412 Ga0068855_100021450
413 Ga0068855_100041577
414 Ga0068855_100059501
415 Ga0068855_100112739
416 Ga0068855_101011280
417 Ga0070664_100289704
418 Ga0068857_100128302
419 Ga0068854_100035646
420 Ga0068854_100377149
421 Ga0068856_100006679
422 Ga0068856_100021634
423 Ga0068856_100061799
424 Ga0068856_100072469
425 Ga0068856_100344306
426 Ga0070702_100078816
427 Ga0068852_100050308
428 Ga0068852_100107160
429 Ga0068852_100304498
430 Ga0068852_100529260
431 Ga0068859_100002361
432 Ga0068859_100093879
433 Ga0068864_100024217
434 Ga0068866_10017116
435 Ga0068861_100022015
436 Ga0068851_10029291
437 Ga0068870_10025366
438 Ga0068863_100004882
439 Ga0068863_100015311
440 Ga0068858_100013689
441 Ga0068858_100110718
442 Ga0068860_100000035
443 Ga0068860_100042424
444 Ga0081455_10005234
445 Ga0081540_1005470
446 Ga0070717_10009177
447 Ga0070717_10254530
448 Ga0070716_100016696
449 Ga0070712_100023323
450 Ga0097621_100055298
451 Ga0068871_100200529
452 Ga0075431_100501748
453 Ga0075433_10006767
454 Ga0075434_100165663
455 Ga0068865_100047181
456 Ga0075436_100030843
457 Ga0097620_100002361
458 Ga0097620_100093877
459 Ga0075435_100054586
460 Ga0105251_10017885
461 Ga0105251_10018729
462 Ga0105250_10033257
463 Ga0105240_10012487
464 Ga0105240_10211260
465 Ga0105240_10367696
466 Ga0105240_10533329
467 Ga0105245_10015300
468 Ga0105247_10003264
469 Ga0105247_10013085
470 Ga0105243_10029336
471 Ga0105241_10036646
472 Ga0105242_10005734
473 Ga0105248_10134364
474 Ga0105237_10041205
475 Ga0105237_10043794
476 Ga0105237_10052211
477 Ga0105238_10168465
478 Ga0105238_10238462
479 Ga0105238_10608721
480 Ga0105249_10005245
481 Ga0105249_10216240
482 Ga0105239_10068028
483 Ga0105239_10334200
484 Ga0105246_10003223
485 Ga0157370_10123817
486 Ga0157369_10071300
487 Ga0157374_10067841
488 Ga0163162_10014032
489 Ga0157372_10001302
490 Ga0157372_10699651
491 Ga0163163_10097694
492 Ga0157380_10033341
493 Ga0157377_10261404
494 Ga0157379_10042835
495 Ga0163161_10023316
496 Ga0206353_10021455
497 Ga0206353_10253874
498 Ga0213876_10027237
499 Ga0213875_10042765
500 Ga0224712_10015633
501 Ga0224712_10016179
502 Ga0224712_10062743
503 Ga0207713_1079371
504 Ga0207692_10020732
505 Ga0207710_10001933
506 Ga0207710_10095059
507 Ga0207688_10005436
508 Ga0207680_10007745
509 Ga0207680_10013189
510 Ga0207647_10038438
511 Ga0207699_10044945
512 Ga0207705_10298903
513 Ga0207654_10122780
514 Ga0207695_10048226
515 Ga0207695_10072221
516 Ga0207695_10154591
517 Ga0207695_10178454
518 Ga0207671_10027300
519 Ga0207693_10000761
520 Ga0207657_10030578
521 Ga0207649_10489672
522 Ga0207694_10124640
523 Ga0207659_10123569
524 Ga0207687_10040732
525 Ga0207687_10114380
526 Ga0207664_10000002
527 Ga0207644_10040748
528 Ga0207706_10006255
529 Ga0207665_10000422
530 Ga0207689_10008948
531 Ga0207667_10016618
532 Ga0207667_10034175
533 Ga0207667_10120154
534 Ga0207667_10353724
535 Ga0207667_10973620
536 Ga0207651_10108439
537 Ga0207712_10021402
538 Ga0207712_10153118
539 Ga0207668_10011660
540 Ga0207668_10034693
541 Ga0207640_10106541
542 Ga0207640_10237321
543 Ga0207658_10013680
544 Ga0207677_10138200
545 Ga0207703_10087458
546 Ga0207703_10475659
547 Ga0207678_10001278
548 Ga0207708_10000023
549 Ga0207702_10005937
550 Ga0207702_10007680
551 Ga0207702_10102364
552 Ga0207702_10382823
553 Ga0207641_10038448
554 Ga0207641_10066911
555 Ga0207648_10463590
556 Ga0207676_10144113
557 Ga0207675_100020738
558 Ga0207683_10004856
559 Ga0207698_10025660
560 Ga0207698_10419635
561 Ga0268266_10001967
562 Ga0268266_10715780
563 Ga0268264_10000031
564 Ga0373930_0037794
565 Ga0373952_0005181
566 Ga0373932_0003072
567 Ga0373961_0007495
568 Ga0373931_0002210
569 Ga0373927_0285740
570 Ga0395899_0302595
571 Ga0436364_0516703
572 Ga0436365_1340223
573 Ga0439463_013636
574 Ga0439458_0004053
575 Ga0466969_0008483
576 Ga0466972_0044304
577 Ga0466972_0046374
578 Ga0466972_0080928
579 Ga0466972_0137088
580 Ga0466965_0010965
581 Ga0466966_0012157
582 Ga0466966_0070507
583 Ga0466966_0070590
584 Ga0466966_0073255
585 Ga0466966_0117400
586 Ga0466966_0128649
587 Ga0466966_0142500
588 Ga0466961_0006943
589 Ga0466961_0016441
590 Ga0466961_0021704
591 Ga0466961_0023676
592 Ga0466961_0026300
593 Ga0466963_0001197
594 Ga0466963_0004114
595 Ga0466963_0005135
596 Ga0466963_0020352
597 Ga0466963_0027052
598 Ga0466963_0065795
599 Ga0466963_0067338
600 Ga0466963_0078413
601 Ga0466963_0088964
602 Ga0466963_0106162
603 Ga0466963_0139720
604 Ga0466963_0158666
605 Ga0466963_0195305
606 Ga0466963_0225424
607 Ga0466964_0014548
608 Ga0466964_0017405
609 Ga0466964_0062846
610 Ga0466964_0095374
611 Ga0466971_0075263
612 Ga0466971_0180852
613 Ga0466968_0048607
614 Ga0466970_0001419
615 Ga0466970_0028510
616 Ga0466970_0069251
617 Ga0466970_0077146
618 Ga0466957_0017495
619 Ga0466957_0037187
620 Ga0466957_0067717
621 Ga0466957_0068135
622 Ga0466960_0006393
623 Ga0466959_0001698
624 Ga0466959_0053665
625 Ga0466959_0086790
626 Ga0466959_0089765
627 Ga0466959_0123892
628 Ga0466958_0005815
629 Ga0466958_0009062
630 Ga0466958_0013404
631 Ga0466958_0025828
632 Ga0466958_0030320
633 Ga0466958_0030735
634 Ga0466958_0049719
635 Ga0466958_0117117
636 Ga0466967_0000613
637 Ga0466967_0004748
638 Ga0466967_0004827
639 Ga0466967_0012903
640 Ga0466967_0033125
641 Ga0466967_0057734
642 Ga0466967_0111670
643 Ga0466967_0161609
644 Ga0466967_0180794
645 Ga0466967_0194506
646 Ga0466967_0202263
647 Ga0466967_0205153
648 Ga0466967_0277814
649 Ga0466967_0331723
650 Ga0466967_0405446
651 Ga0466967_0419370
652 Ga0495635_0283961
653 Ga0495676_0075831
654 Ga0496100_0559252
655 Ga0496101_0073521
656 Ga0496101_0192800
657 Ga0496102_0000474
658 Ga0496102_0000735
659 Ga0496102_0104432
660 Ga0496102_0181170
661 Ga0496103_0000976
662 Ga0496103_0005567
663 Ga0496103_0015419
664 Ga0496103_0067370
665 Ga0496104_0004536
666 Ga0496104_0022625
667 Ga0496105_0138715
668 Ga0496106_0156592
669 Ga0496107_0071418
670 Ga0496108_0007637
671 Ga0496108_0016478
672 Ga0496109_0010596
673 Ga0496110_0015465
674 Ga0496110_0169994
675 Ga0496110_0409616
676 Ga0496111_0013474
677 Ga0496112_0083654
678 Ga0496113_0015998
679 Ga0496113_0101853
680 Ga0496114_0063958
681 Ga0496114_0182616
682 Ga0496114_0431550
683 Ga0496115_0007736
684 Ga0496119_0000960
685 Ga0496119_0027393
686 Ga0496120_0001834
687 Ga0496121_0017831
688 Ga0496121_0086440
689 Ga0496126_0000006
690 Ga0496126_0021047
691 Ga0496126_0302167
692 Ga0501031_0002698
693 Ga0501032_0009780
694 Ga0501033_0085199
695 Ga0501033_0152833
696 Ga0501034_0068888
697 Ga0501034_0499740
698 Ga0501037_0036393
699 Ga0501038_0007999
700 Ga0501047_0005402
701 Ga0501047_0049715
702 Ga0501047_0220080
703 Ga0501048_0000405
704 Ga0501070_0378389
705 Ga0501080_0098689
706 Ga0501035_0042132
707 Ga0501044_0138393
708 Ga0501044_0501932
709 nmdc:mga0rr50_85037_c1
710 nmdc:mga08x19_105536_c1
711 Ga0495595_0102879
712 Ga0466962_0002858
713 Ga0466962_0013525
714 Ga0466962_0062804
715 Ga0466962_0064081
716 Ga0466962_0145398
717 2676492167
718 2856745391
719 2884698296
720 2891397538
721 2891561379
722 2891569050
723 2895427369
724 2895450887

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13411

MerR_1

MerR HTH family regulatory protein

35

94

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zhh-assembly1.cif.gz_A-2 crystal structure of soxr 0.9231 15 88
7tea-assembly2.cif.gz_C crystal structure of s. aureus glnr-dna complex 0.9145 13 87
4r24-assembly1.cif.gz_B complete dissection of b. subtilis nitrogen homeostatic circuitry 0.9073 13 92
2zhg-assembly1.cif.gz_A-2 crystal structure of soxr in complex with dna 0.9073 13 86
5d90-assembly2.cif.gz_C crystal structure of hinmlr, a merr family regulator lacking the sensor domain, bound to promoter dna 0.905 15 92
ID Description Score Start End Superfamily
2zhhA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9231 15 88 1.10.1660.10
af_P9WME7_10_96_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.907 13 99 1.10.1660.10
5d90C00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8991 14 92 1.10.1660.10
af_P9WME7_10_96_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.897 13 99 1.10.1660.10
4r22B00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8949 13 92 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A359FDL3-F1-model_v4 deleted 0.9808 11 88
AF-A0A6L8JQ65-F1-model_v4 deleted 0.9807 11 87
AF-A0A538H2E3-F1-model_v4 MerR family transcriptional regulator 0.9733 13 92 GO:0003677
GO:0003700
AF-A0A349U4K1-F1-model_v4 MerR family DNA-binding transcriptional regulator 0.9574 13 92 GO:0003677
GO:0003700
AF-A0A5N9HHJ6-F1-model_v4 MerR family transcriptional regulator 0.9559 12 91 GO:0003677
GO:0003700

Map