F422495

General Info

Members Datasets Scaffolds Average Seq Length
362 184 724 95

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100879860|Ga0070671_1008798602
Length 96
Sequence MLLHLVCFKYKPAIDQVTRAEHRTRLRGLSGLDGVVDLKVGEDVVRNPVRSYDTGLCVTFPDLAALDRYAKDPRHVPVAQFGIEISEHIVACDFEI

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
127 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
128 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
129 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
130 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
131 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
132 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
133 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
134 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
135 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
136 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
161 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
162 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.14
Rhizosphere 95.3
Stem 0
Stem Tuber 0
Unclassified 27.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100879860 3300005355 Bacteria 782
2 Ga0065712_10095627 3300005290 Bacteria 2191
3 Ga0070676_10856721 3300005328 Bacteria 674
4 Ga0070676_11243636 3300005328 Bacteria 567
5 Ga0070690_100033227 3300005330 Bacteria 3228
6 Ga0070690_100335239 3300005330 Bacteria 1094
7 Ga0070670_100719418 3300005331 Bacteria 898
8 Ga0070670_101455659 3300005331 Bacteria 628
9 Ga0070670_101836681 3300005331 Unclassified 558
10 Ga0070677_10007010 3300005333 Bacteria 3749
11 Ga0068869_100231128 3300005334 Bacteria 1469
12 Ga0068869_100775320 3300005334 Unclassified 822
13 Ga0068869_100843837 3300005334 Bacteria 790
14 Ga0070666_10008768 3300005335 Bacteria 6287
15 Ga0070666_10264399 3300005335 Bacteria 1220
16 Ga0070682_100552182 3300005337 Bacteria 902
17 Ga0068868_100472312 3300005338 Bacteria 1094
18 Ga0068868_100844075 3300005338 Unclassified 829
19 Ga0068868_102093913 3300005338 Unclassified 538
20 Ga0068868_102341581 3300005338 Bacteria 510
21 Ga0070689_100069023 3300005340 Bacteria 2757
22 Ga0070691_10747350 3300005341 Bacteria 591
23 Ga0070687_100002971 3300005343 Bacteria 6504
24 Ga0070687_100480968 3300005343 Unclassified 832
25 Ga0070687_100759027 3300005343 Bacteria 683
26 Ga0070669_101114300 3300005353 Bacteria 680
27 Ga0070669_101548336 3300005353 Bacteria 577
28 Ga0070675_100002368 3300005354 Bacteria 14032
29 Ga0070675_100147242 3300005354 Bacteria 2017
30 Ga0070675_100163000 3300005354 Bacteria 1918
31 Ga0070671_100213328 3300005355 Unclassified 1637
32 Ga0070671_101486609 3300005355 Bacteria 599
33 Ga0070674_100065233 3300005356 Bacteria 2555
34 Ga0070673_100364040 3300005364 Bacteria 1286
35 Ga0070667_100134494 3300005367 Bacteria 2161
36 Ga0070667_101287828 3300005367 Unclassified 685
37 Ga0070667_101815114 3300005367 Bacteria 574
38 Ga0070714_100016047 3300005435 Bacteria 6038
39 Ga0070701_10771109 3300005438 Unclassified 653
40 Ga0070711_101754309 3300005439 Unclassified 544
41 Ga0070705_100456083 3300005440 Bacteria 960
42 Ga0070705_100768793 3300005440 Bacteria 763
43 Ga0070705_101331045 3300005440 Bacteria 596
44 Ga0070705_101658778 3300005440 Unclassified 539
45 Ga0070694_100314324 3300005444 Bacteria 1204
46 Ga0070708_100274161 3300005445 Unclassified 1587
47 Ga0070708_100676642 3300005445 Unclassified 972
48 Ga0070708_101660752 3300005445 Bacteria 594
49 Ga0070708_101844516 3300005445 Unclassified 561
50 Ga0070678_100008709 3300005456 Bacteria 6093
51 Ga0070678_101966809 3300005456 Unclassified 553
52 Ga0070662_100411036 3300005457 Bacteria 1118
53 Ga0070662_101245073 3300005457 Bacteria 640
54 Ga0068867_101189576 3300005459 Bacteria 700
55 Ga0070707_100062807 3300005468 Bacteria 3564
56 Ga0070707_100137725 3300005468 Unclassified 2375
57 Ga0070707_100579888 3300005468 Unclassified 1084
58 Ga0070707_102006683 3300005468 Bacteria 546
59 Ga0070698_100091133 3300005471 Bacteria 3031
60 Ga0070698_100099386 3300005471 Bacteria 2883
61 Ga0070698_101258075 3300005471 Bacteria 690
62 Ga0070699_100008612 3300005518 Bacteria 8840
63 Ga0070699_100036371 3300005518 Bacteria 4260
64 Ga0070699_100589286 3300005518 Unclassified 1013
65 Ga0070684_100223480 3300005535 Bacteria 1718
66 Ga0070697_100040422 3300005536 Bacteria 3773
67 Ga0070697_100378341 3300005536 Unclassified 1226
68 Ga0070697_100821548 3300005536 Unclassified 823
69 Ga0070697_100924543 3300005536 Unclassified 774
70 Ga0068853_100254692 3300005539 Bacteria 1612
71 Ga0068853_100264476 3300005539 Bacteria 1582
72 Ga0070686_100008500 3300005544 Bacteria 5749
73 Ga0070686_101055268 3300005544 Bacteria 669
74 Ga0070695_100014328 3300005545 Bacteria 4778
75 Ga0070695_100930724 3300005545 Unclassified 703
76 Ga0070695_101320733 3300005545 Unclassified 596
77 Ga0070696_100044673 3300005546 Bacteria 3068
78 Ga0070696_100470171 3300005546 Unclassified 995
79 Ga0070693_100040857 3300005547 Bacteria 2606
80 Ga0070704_100404014 3300005549 Bacteria 1166
81 Ga0070704_100553058 3300005549 Bacteria 1006
82 Ga0070704_101613396 3300005549 Bacteria 598
83 Ga0070704_102121471 3300005549 Bacteria 522
84 Ga0068855_100373914 3300005563 Unclassified 1566
85 Ga0068857_100929719 3300005577 Unclassified 835
86 Ga0068854_100052705 3300005578 Bacteria 2918
87 Ga0068854_100117982 3300005578 Bacteria 2010
88 Ga0068854_101004284 3300005578 Bacteria 739
89 Ga0070702_100693375 3300005615 Unclassified 775
90 Ga0070702_101477524 3300005615 Bacteria 558
91 Ga0068852_101345865 3300005616 Unclassified 736
92 Ga0068859_100096959 3300005617 Bacteria 3001
93 Ga0068859_100726539 3300005617 Bacteria 1083
94 Ga0068859_101500988 3300005617 Bacteria 744
95 Ga0068859_101555994 3300005617 Unclassified 730
96 Ga0068859_101961384 3300005617 Bacteria 646
97 Ga0068864_100377206 3300005618 Bacteria 1343
98 Ga0068864_101160924 3300005618 Bacteria 770
99 Ga0068866_10439065 3300005718 Bacteria 851
100 Ga0068861_100068733 3300005719 Bacteria 2738
101 Ga0068861_100412064 3300005719 Bacteria 1202
102 Ga0068861_101931178 3300005719 Unclassified 588
103 Ga0068870_10136793 3300005840 Bacteria 1429
104 Ga0068863_100229158 3300005841 Unclassified 1792
105 Ga0068863_101335436 3300005841 Bacteria 724
106 Ga0068863_101397829 3300005841 Unclassified 708
107 Ga0068858_100273129 3300005842 Bacteria 1609
108 Ga0068858_100990147 3300005842 Bacteria 824
109 Ga0068860_100782362 3300005843 Bacteria 967
110 Ga0068860_101175474 3300005843 Unclassified 787
111 Ga0068862_101087754 3300005844 Bacteria 794
112 Ga0068862_101390515 3300005844 Bacteria 705
113 Ga0081539_10014098 3300005985 Bacteria 5943
114 Ga0075432_10028027 3300006058 Bacteria 1942
115 Ga0070716_100145732 3300006173 Bacteria 1517
116 Ga0097621_100061505 3300006237 Bacteria 3080
117 Ga0068871_100002177 3300006358 Bacteria 13307
118 Ga0068871_100284163 3300006358 Bacteria 1448
119 Ga0075433_10074779 3300006852 Unclassified 2981
120 Ga0075433_10312169 3300006852 Bacteria 1391
121 Ga0075433_11082398 3300006852 Bacteria 697
122 Ga0075433_11219394 3300006852 Bacteria 653
123 Ga0075433_11609165 3300006852 Unclassified 560
124 Ga0075434_100039505 3300006871 Bacteria 4676
125 Ga0075434_100075574 3300006871 Bacteria 3363
126 Ga0075434_100126383 3300006871 Bacteria 2574
127 Ga0075434_100141564 3300006871 Unclassified 2425
128 Ga0075434_101154440 3300006871 Unclassified 787
129 Ga0075434_101187817 3300006871 Archaea 775
130 Ga0075434_101844192 3300006871 Bacteria 611
131 Ga0075434_102394683 3300006871 Bacteria 530
132 Ga0068865_100018107 3300006881 Bacteria 4541
133 Ga0068865_102088857 3300006881 Bacteria 515
134 Ga0075436_100002635 3300006914 Bacteria 12338
135 Ga0075436_100024412 3300006914 Bacteria 4155
136 Ga0075436_100131878 3300006914 Bacteria 1752
137 Ga0075436_100166229 3300006914 Bacteria 1557
138 Ga0075436_101111783 3300006914 Bacteria 595
139 Ga0097620_100096952 3300006931 Bacteria 3001
140 Ga0097620_100726529 3300006931 Bacteria 1083
141 Ga0097620_101500260 3300006931 Bacteria 744
142 Ga0097620_101555599 3300006931 Unclassified 730
143 Ga0097620_101961422 3300006931 Bacteria 646
144 Ga0075435_100000780 3300007076 Bacteria 19791
145 Ga0075435_100005241 3300007076 Bacteria 9025
146 Ga0075435_100037983 3300007076 Bacteria 3838
147 Ga0075435_101008358 3300007076 Bacteria 727
148 Ga0075435_101991548 3300007076 Unclassified 510
149 Ga0105240_10077434 3300009093 Bacteria 4097
150 Ga0105245_10249257 3300009098 Bacteria 1725
151 Ga0105245_10311166 3300009098 Bacteria 1549
152 Ga0105245_10722266 3300009098 Bacteria 1031
153 Ga0105247_11101889 3300009101 Bacteria 626
154 Ga0114129_10006247 3300009147 Bacteria 16889
155 Ga0114129_10012455 3300009147 Bacteria 12109
156 Ga0114129_10031036 3300009147 Bacteria 7558
157 Ga0114129_10098682 3300009147 Bacteria 4043
158 Ga0114129_10292468 3300009147 Unclassified 2173
159 Ga0114129_10392292 3300009147 Bacteria 1831
160 Ga0114129_10667350 3300009147 Bacteria 1340
161 Ga0114129_10678270 3300009147 Unclassified 1327
162 Ga0105243_10516003 3300009148 Bacteria 1135
163 Ga0105243_10605432 3300009148 Bacteria 1055
164 Ga0105243_11296997 3300009148 Bacteria 745
165 Ga0105241_10173525 3300009174 Bacteria 1782
166 Ga0105242_10040420 3300009176 Bacteria 3759
167 Ga0105248_10150825 3300009177 Bacteria 2622
168 Ga0105248_10160083 3300009177 Bacteria 2540
169 Ga0105248_10740901 3300009177 Unclassified 1109
170 Ga0105248_10794847 3300009177 Unclassified 1068
171 Ga0105248_10952818 3300009177 Bacteria 969
172 Ga0105248_11298173 3300009177 Bacteria 823
173 Ga0105248_12074174 3300009177 Unclassified 646
174 Ga0105238_10268982 3300009551 Bacteria 1685
175 Ga0105249_10609398 3300009553 Bacteria 1147
176 Ga0105249_11457394 3300009553 Bacteria 757
177 Ga0105239_10764676 3300010375 Bacteria 1106
178 Ga0105239_11528312 3300010375 Unclassified 771
179 Ga0105246_10742059 3300011119 Bacteria 865
180 Ga0157374_10201129 3300013296 Bacteria 1951
181 Ga0157374_11708060 3300013296 Unclassified 654
182 Ga0157378_11283092 3300013297 Unclassified 773
183 Ga0163162_12219289 3300013306 Bacteria 630
184 Ga0157375_10880592 3300013308 Bacteria 1040
185 Ga0163163_10093504 3300014325 Bacteria 3023
186 Ga0163163_10334347 3300014325 Bacteria 1570
187 Ga0163163_10865017 3300014325 Bacteria 967
188 Ga0163163_10881719 3300014325 Bacteria 958
189 Ga0157380_10234963 3300014326 Bacteria 1649
190 Ga0157380_12276754 3300014326 Unclassified 606
191 Ga0157377_10219056 3300014745 Bacteria 1217
192 Ga0157377_10356460 3300014745 Unclassified 983
193 Ga0157379_10569958 3300014968 Bacteria 1055
194 Ga0157379_10625211 3300014968 Bacteria 1007
195 Ga0157376_10139891 3300014969 Bacteria 2170
196 Ga0157376_10176416 3300014969 Bacteria 1950
197 Ga0157376_11936205 3300014969 Bacteria 627
198 Ga0207682_10024550 3300025893 Bacteria 2387
199 Ga0207642_10665976 3300025899 Bacteria 653
200 Ga0207680_10030359 3300025903 Bacteria 3048
201 Ga0207680_10037251 3300025903 Bacteria 2807
202 Ga0207645_10545143 3300025907 Bacteria 787
203 Ga0207654_10114852 3300025911 Unclassified 1681
204 Ga0207695_10800811 3300025913 Bacteria 822
205 Ga0207695_11096144 3300025913 Unclassified 676
206 Ga0207662_10034636 3300025918 Bacteria 2947
207 Ga0207662_11257845 3300025918 Unclassified 526
208 Ga0207646_10040314 3300025922 Bacteria 4200
209 Ga0207646_10517358 3300025922 Unclassified 1074
210 Ga0207681_11199802 3300025923 Bacteria 637
211 Ga0207694_10369574 3300025924 Bacteria 1189
212 Ga0207650_10056448 3300025925 Unclassified 2918
213 Ga0207650_11066302 3300025925 Bacteria 688
214 Ga0207650_11417962 3300025925 Bacteria 591
215 Ga0207659_10006092 3300025926 Bacteria 7365
216 Ga0207659_10129666 3300025926 Bacteria 1944
217 Ga0207659_10739534 3300025926 Bacteria 843
218 Ga0207687_10184996 3300025927 Unclassified 1617
219 Ga0207687_10362408 3300025927 Bacteria 1183
220 Ga0207664_10622072 3300025929 Unclassified 970
221 Ga0207644_10109493 3300025931 Bacteria 2087
222 Ga0207644_11801387 3300025931 Bacteria 512
223 Ga0207690_11834084 3300025932 Unclassified 506
224 Ga0207706_10559683 3300025933 Unclassified 984
225 Ga0207706_10995131 3300025933 Bacteria 705
226 Ga0207686_10486503 3300025934 Bacteria 955
227 Ga0207709_10035207 3300025935 Bacteria 2959
228 Ga0207709_11209189 3300025935 Unclassified 623
229 Ga0207704_10401856 3300025938 Unclassified 1081
230 Ga0207704_11534175 3300025938 Bacteria 572
231 Ga0207665_10055763 3300025939 Bacteria 2667
232 Ga0207711_10134120 3300025941 Bacteria 2223
233 Ga0207711_11184017 3300025941 Bacteria 706
234 Ga0207711_11611452 3300025941 Bacteria 592
235 Ga0207689_10034711 3300025942 Bacteria 4188
236 Ga0207689_10419756 3300025942 Bacteria 1116
237 Ga0207689_10645031 3300025942 Unclassified 892
238 Ga0207689_11447465 3300025942 Unclassified 575
239 Ga0207689_11534537 3300025942 Unclassified 556
240 Ga0207651_10543454 3300025960 Bacteria 1009
241 Ga0207651_11025976 3300025960 Bacteria 738
242 Ga0207712_10283647 3300025961 Bacteria 1352
243 Ga0207712_10393738 3300025961 Unclassified 1162
244 Ga0207640_10013750 3300025981 Bacteria 4646
245 Ga0207658_10773786 3300025986 Bacteria 870
246 Ga0207677_10187753 3300026023 Bacteria 1632
247 Ga0207677_11116901 3300026023 Unclassified 719
248 Ga0207677_12211107 3300026023 Archaea 512
249 Ga0207703_10177073 3300026035 Bacteria 1880
250 Ga0207703_11074020 3300026035 Bacteria 773
251 Ga0207639_11142046 3300026041 Unclassified 731
252 Ga0207641_10187445 3300026088 Unclassified 1899
253 Ga0207641_10841361 3300026088 Bacteria 909
254 Ga0207641_11274934 3300026088 Bacteria 735
255 Ga0207676_10359317 3300026095 Bacteria 1349
256 Ga0207676_10730200 3300026095 Bacteria 962
257 Ga0207676_10956514 3300026095 Bacteria 842
258 Ga0207676_10982008 3300026095 Bacteria 831
259 Ga0207674_10821669 3300026116 Unclassified 897
260 Ga0207675_100086392 3300026118 Bacteria 2945
261 Ga0207683_10024966 3300026121 Bacteria 5152
262 Ga0207698_11331792 3300026142 Unclassified 733
263 Ga0268265_10687564 3300028380 Bacteria 987
264 Ga0268264_10268903 3300028381 Bacteria 1592
265 Ga0268264_10680915 3300028381 Bacteria 1020
266 Ga0268264_10808405 3300028381 Bacteria 937
267 Ga0268264_11360444 3300028381 Unclassified 720
268 Ga0268264_11665031 3300028381 Unclassified 648
269 Ga0268264_12281388 3300028381 Bacteria 548
270 Ga0307511_10124875 3300030521 Bacteria 1575
271 Ga0307513_10742891 3300031456 Unclassified 687
272 Ga0307416_101151844 3300032002 Bacteria 881
273 Ga0373930_0003751 3300034816 Bacteria 2435
274 Ga0373950_0005404 3300034818 Bacteria 1907
275 Ga0373959_0001774 3300034820 Bacteria 3441
276 Ga0373938_0003546 3300034957 Bacteria 2565
277 Ga0373928_0062022 3300035084 Unclassified 906
278 Ga0373929_0004462 3300035085 Bacteria 2508
279 Ga0373940_0002093 3300035088 Bacteria 3799
280 Ga0373949_0010052 3300035090 Bacteria 2070
281 Ga0373951_0000764 3300035091 Bacteria 8811
282 Ga0373952_0083102 3300035092 Bacteria 820
283 Ga0373932_0000524 3300035112 Bacteria 11788
284 Ga0373939_0002027 3300035114 Bacteria 4831
285 Ga0373941_0003447 3300035115 Bacteria 3581
286 Ga0373945_0237001 3300035116 Bacteria 767
287 Ga0373956_0164590 3300035119 Unclassified 1046
288 Ga0373960_0002851 3300035121 Bacteria 3913
289 Ga0373946_0454356 3300035171 Bacteria 653
290 Ga0373942_0000642 3300035207 Bacteria 9769
291 Ga0373961_0024216 3300035241 Bacteria 1640
292 Ga0373962_0028860 3300035242 Bacteria 1508
293 Ga0373935_0160300 3300035692 Bacteria 1533
294 Ga0373927_0275799 3300035695 Bacteria 1106
295 Ga0373947_0165641 3300035725 Bacteria 1431
296 Ga0373937_0973018 3300036401 Unclassified 797
297 Ga0373937_1620010 3300036401 Bacteria 594
298 Ga0373925_0292709 3300037068 Bacteria 1313
299 Ga0373925_0567560 3300037068 Unclassified 934
300 Ga0395900_0761751 3300037418 Bacteria 898
301 Ga0395901_0610319 3300038443 Bacteria 1099
302 Ga0451576_0030292 3300045051 Bacteria 5784
303 Ga0466967_1894804 3300045976 Bacteria 593
304 Ga0495603_0073725 3300046455 Bacteria 2005
305 Ga0495590_0337503 3300046457 Unclassified 571
306 Ga0495629_0036891 3300046459 Bacteria 3448
307 Ga0495582_0033225 3300046473 Bacteria 2836
308 Ga0495582_0728716 3300046473 Unclassified 574
309 Ga0495639_0049595 3300046475 Unclassified 1906
310 Ga0495664_0531927 3300046477 Unclassified 701
311 Ga0495610_0193462 3300046512 Bacteria 838
312 Ga0495622_0442014 3300046557 Bacteria 558
313 Ga0495633_0130567 3300046558 Bacteria 1162
314 Ga0495635_0257703 3300046663 Unclassified 1175
315 Ga0495647_0038331 3300046681 Bacteria 1812
316 Ga0495658_0356954 3300046683 Bacteria 929
317 Ga0495670_0202422 3300046691 Bacteria 1052
318 Ga0496100_0779309 3300048903 Unclassified 749
319 Ga0496102_0441780 3300048905 Bacteria 1221
320 Ga0496102_0866847 3300048905 Unclassified 825
321 Ga0496102_1618172 3300048905 Unclassified 566
322 Ga0496103_0206617 3300048906 Unclassified 1263
323 Ga0496103_0354896 3300048906 Bacteria 943
324 Ga0496106_0137101 3300048909 Bacteria 1923
325 Ga0496107_0622915 3300048910 Unclassified 796
326 Ga0496107_0851599 3300048910 Bacteria 666
327 Ga0496109_0080935 3300048912 Unclassified 2993
328 Ga0496112_0159765 3300048915 Unclassified 2220
329 Ga0496112_0698118 3300048915 Unclassified 943
330 Ga0496113_0197487 3300048916 Unclassified 1598
331 Ga0496114_0098367 3300048917 Bacteria 2494
332 Ga0496114_0425348 3300048917 Unclassified 1177
333 Ga0501067_0586128 3300049583 Unclassified 625
334 Ga0501083_0022763 3300049744 Bacteria 4348
335 nmdc:mga05p37_163660_c1 3300050507 Bacteria 2716
336 nmdc:mga05p37_369804_c1 3300050507 Bacteria 1683
337 nmdc:mga05p37_486857_c1 3300050507 Bacteria 1419
338 nmdc:mga05p37_51184_c1 3300050507 Bacteria 5080
339 nmdc:mga05p37_604142_c1 3300050507 Unclassified 1238
340 nmdc:mga05p37_7684_c1 3300050507 Bacteria 12722
341 nmdc:mga0n895_131076_c1 3300050512 Bacteria 2532
342 nmdc:mga0n895_137975_c1 3300050512 Bacteria 2466
343 nmdc:mga0n895_169728_c1 3300050512 Bacteria 2214
344 nmdc:mga0n895_466982_c1 3300050512 Unclassified 1273
345 nmdc:mga0n895_5101_c1 3300050512 Bacteria 10910
346 nmdc:mga0n895_944881_c1 3300050512 Unclassified 846
347 nmdc:mga0rr50_1386137_c1 3300050513 Unclassified 595
348 nmdc:mga0rr50_418_c1 3300050513 Bacteria 22918
349 nmdc:mga0rr50_43391_c1 3300050513 Bacteria 3291
350 nmdc:mga0rr50_49246_c1 3300050513 Bacteria 3119
351 nmdc:mga0rr50_830121_c1 3300050513 Unclassified 788
352 nmdc:mga08x19_111066_c1 3300050514 Bacteria 1829
353 nmdc:mga08x19_1353076_c1 3300050514 Bacteria 504
354 nmdc:mga08x19_60281_c1 3300050514 Bacteria 2458
355 nmdc:mga08x19_87779_c1 3300050514 Bacteria 2049
356 nmdc:mga08x19_98101_c1 3300050514 Unclassified 1941
357 nmdc:mga0a205_410904_c1 3300050515 Bacteria 1216
358 nmdc:mga0a205_498823_c1 3300050515 Bacteria 1074
359 nmdc:mga0a205_82992_c1 3300050515 Unclassified 3095
360 nmdc:mga0a205_88184_c1 3300050515 Unclassified 2998
361 nmdc:mga0a205_98048_c1 3300050515 Bacteria 2830
362 Ga0495601_0540032 3300053077 Unclassified 751
363 Ga0070671_100879860
364 Ga0065712_10095627
365 Ga0070676_10856721
366 Ga0070676_11243636
367 Ga0070690_100033227
368 Ga0070690_100335239
369 Ga0070670_100719418
370 Ga0070670_101455659
371 Ga0070670_101836681
372 Ga0070677_10007010
373 Ga0068869_100231128
374 Ga0068869_100775320
375 Ga0068869_100843837
376 Ga0070666_10008768
377 Ga0070666_10264399
378 Ga0070682_100552182
379 Ga0068868_100472312
380 Ga0068868_100844075
381 Ga0068868_102093913
382 Ga0068868_102341581
383 Ga0070689_100069023
384 Ga0070691_10747350
385 Ga0070687_100002971
386 Ga0070687_100480968
387 Ga0070687_100759027
388 Ga0070669_101114300
389 Ga0070669_101548336
390 Ga0070675_100002368
391 Ga0070675_100147242
392 Ga0070675_100163000
393 Ga0070671_100213328
394 Ga0070671_101486609
395 Ga0070674_100065233
396 Ga0070673_100364040
397 Ga0070667_100134494
398 Ga0070667_101287828
399 Ga0070667_101815114
400 Ga0070714_100016047
401 Ga0070701_10771109
402 Ga0070711_101754309
403 Ga0070705_100456083
404 Ga0070705_100768793
405 Ga0070705_101331045
406 Ga0070705_101658778
407 Ga0070694_100314324
408 Ga0070708_100274161
409 Ga0070708_100676642
410 Ga0070708_101660752
411 Ga0070708_101844516
412 Ga0070678_100008709
413 Ga0070678_101966809
414 Ga0070662_100411036
415 Ga0070662_101245073
416 Ga0068867_101189576
417 Ga0070707_100062807
418 Ga0070707_100137725
419 Ga0070707_100579888
420 Ga0070707_102006683
421 Ga0070698_100091133
422 Ga0070698_100099386
423 Ga0070698_101258075
424 Ga0070699_100008612
425 Ga0070699_100036371
426 Ga0070699_100589286
427 Ga0070684_100223480
428 Ga0070697_100040422
429 Ga0070697_100378341
430 Ga0070697_100821548
431 Ga0070697_100924543
432 Ga0068853_100254692
433 Ga0068853_100264476
434 Ga0070686_100008500
435 Ga0070686_101055268
436 Ga0070695_100014328
437 Ga0070695_100930724
438 Ga0070695_101320733
439 Ga0070696_100044673
440 Ga0070696_100470171
441 Ga0070693_100040857
442 Ga0070704_100404014
443 Ga0070704_100553058
444 Ga0070704_101613396
445 Ga0070704_102121471
446 Ga0068855_100373914
447 Ga0068857_100929719
448 Ga0068854_100052705
449 Ga0068854_100117982
450 Ga0068854_101004284
451 Ga0070702_100693375
452 Ga0070702_101477524
453 Ga0068852_101345865
454 Ga0068859_100096959
455 Ga0068859_100726539
456 Ga0068859_101500988
457 Ga0068859_101555994
458 Ga0068859_101961384
459 Ga0068864_100377206
460 Ga0068864_101160924
461 Ga0068866_10439065
462 Ga0068861_100068733
463 Ga0068861_100412064
464 Ga0068861_101931178
465 Ga0068870_10136793
466 Ga0068863_100229158
467 Ga0068863_101335436
468 Ga0068863_101397829
469 Ga0068858_100273129
470 Ga0068858_100990147
471 Ga0068860_100782362
472 Ga0068860_101175474
473 Ga0068862_101087754
474 Ga0068862_101390515
475 Ga0081539_10014098
476 Ga0075432_10028027
477 Ga0070716_100145732
478 Ga0097621_100061505
479 Ga0068871_100002177
480 Ga0068871_100284163
481 Ga0075433_10074779
482 Ga0075433_10312169
483 Ga0075433_11082398
484 Ga0075433_11219394
485 Ga0075433_11609165
486 Ga0075434_100039505
487 Ga0075434_100075574
488 Ga0075434_100126383
489 Ga0075434_100141564
490 Ga0075434_101154440
491 Ga0075434_101187817
492 Ga0075434_101844192
493 Ga0075434_102394683
494 Ga0068865_100018107
495 Ga0068865_102088857
496 Ga0075436_100002635
497 Ga0075436_100024412
498 Ga0075436_100131878
499 Ga0075436_100166229
500 Ga0075436_101111783
501 Ga0097620_100096952
502 Ga0097620_100726529
503 Ga0097620_101500260
504 Ga0097620_101555599
505 Ga0097620_101961422
506 Ga0075435_100000780
507 Ga0075435_100005241
508 Ga0075435_100037983
509 Ga0075435_101008358
510 Ga0075435_101991548
511 Ga0105240_10077434
512 Ga0105245_10249257
513 Ga0105245_10311166
514 Ga0105245_10722266
515 Ga0105247_11101889
516 Ga0114129_10006247
517 Ga0114129_10012455
518 Ga0114129_10031036
519 Ga0114129_10098682
520 Ga0114129_10292468
521 Ga0114129_10392292
522 Ga0114129_10667350
523 Ga0114129_10678270
524 Ga0105243_10516003
525 Ga0105243_10605432
526 Ga0105243_11296997
527 Ga0105241_10173525
528 Ga0105242_10040420
529 Ga0105248_10150825
530 Ga0105248_10160083
531 Ga0105248_10740901
532 Ga0105248_10794847
533 Ga0105248_10952818
534 Ga0105248_11298173
535 Ga0105248_12074174
536 Ga0105238_10268982
537 Ga0105249_10609398
538 Ga0105249_11457394
539 Ga0105239_10764676
540 Ga0105239_11528312
541 Ga0105246_10742059
542 Ga0157374_10201129
543 Ga0157374_11708060
544 Ga0157378_11283092
545 Ga0163162_12219289
546 Ga0157375_10880592
547 Ga0163163_10093504
548 Ga0163163_10334347
549 Ga0163163_10865017
550 Ga0163163_10881719
551 Ga0157380_10234963
552 Ga0157380_12276754
553 Ga0157377_10219056
554 Ga0157377_10356460
555 Ga0157379_10569958
556 Ga0157379_10625211
557 Ga0157376_10139891
558 Ga0157376_10176416
559 Ga0157376_11936205
560 Ga0207682_10024550
561 Ga0207642_10665976
562 Ga0207680_10030359
563 Ga0207680_10037251
564 Ga0207645_10545143
565 Ga0207654_10114852
566 Ga0207695_10800811
567 Ga0207695_11096144
568 Ga0207662_10034636
569 Ga0207662_11257845
570 Ga0207646_10040314
571 Ga0207646_10517358
572 Ga0207681_11199802
573 Ga0207694_10369574
574 Ga0207650_10056448
575 Ga0207650_11066302
576 Ga0207650_11417962
577 Ga0207659_10006092
578 Ga0207659_10129666
579 Ga0207659_10739534
580 Ga0207687_10184996
581 Ga0207687_10362408
582 Ga0207664_10622072
583 Ga0207644_10109493
584 Ga0207644_11801387
585 Ga0207690_11834084
586 Ga0207706_10559683
587 Ga0207706_10995131
588 Ga0207686_10486503
589 Ga0207709_10035207
590 Ga0207709_11209189
591 Ga0207704_10401856
592 Ga0207704_11534175
593 Ga0207665_10055763
594 Ga0207711_10134120
595 Ga0207711_11184017
596 Ga0207711_11611452
597 Ga0207689_10034711
598 Ga0207689_10419756
599 Ga0207689_10645031
600 Ga0207689_11447465
601 Ga0207689_11534537
602 Ga0207651_10543454
603 Ga0207651_11025976
604 Ga0207712_10283647
605 Ga0207712_10393738
606 Ga0207640_10013750
607 Ga0207658_10773786
608 Ga0207677_10187753
609 Ga0207677_11116901
610 Ga0207677_12211107
611 Ga0207703_10177073
612 Ga0207703_11074020
613 Ga0207639_11142046
614 Ga0207641_10187445
615 Ga0207641_10841361
616 Ga0207641_11274934
617 Ga0207676_10359317
618 Ga0207676_10730200
619 Ga0207676_10956514
620 Ga0207676_10982008
621 Ga0207674_10821669
622 Ga0207675_100086392
623 Ga0207683_10024966
624 Ga0207698_11331792
625 Ga0268265_10687564
626 Ga0268264_10268903
627 Ga0268264_10680915
628 Ga0268264_10808405
629 Ga0268264_11360444
630 Ga0268264_11665031
631 Ga0268264_12281388
632 Ga0307511_10124875
633 Ga0307513_10742891
634 Ga0307416_101151844
635 Ga0373930_0003751
636 Ga0373950_0005404
637 Ga0373959_0001774
638 Ga0373938_0003546
639 Ga0373928_0062022
640 Ga0373929_0004462
641 Ga0373940_0002093
642 Ga0373949_0010052
643 Ga0373951_0000764
644 Ga0373952_0083102
645 Ga0373932_0000524
646 Ga0373939_0002027
647 Ga0373941_0003447
648 Ga0373945_0237001
649 Ga0373956_0164590
650 Ga0373960_0002851
651 Ga0373946_0454356
652 Ga0373942_0000642
653 Ga0373961_0024216
654 Ga0373962_0028860
655 Ga0373935_0160300
656 Ga0373927_0275799
657 Ga0373947_0165641
658 Ga0373937_0973018
659 Ga0373937_1620010
660 Ga0373925_0292709
661 Ga0373925_0567560
662 Ga0395900_0761751
663 Ga0395901_0610319
664 Ga0451576_0030292
665 Ga0466967_1894804
666 Ga0495603_0073725
667 Ga0495590_0337503
668 Ga0495629_0036891
669 Ga0495582_0033225
670 Ga0495582_0728716
671 Ga0495639_0049595
672 Ga0495664_0531927
673 Ga0495610_0193462
674 Ga0495622_0442014
675 Ga0495633_0130567
676 Ga0495635_0257703
677 Ga0495647_0038331
678 Ga0495658_0356954
679 Ga0495670_0202422
680 Ga0496100_0779309
681 Ga0496102_0441780
682 Ga0496102_0866847
683 Ga0496102_1618172
684 Ga0496103_0206617
685 Ga0496103_0354896
686 Ga0496106_0137101
687 Ga0496107_0622915
688 Ga0496107_0851599
689 Ga0496109_0080935
690 Ga0496112_0159765
691 Ga0496112_0698118
692 Ga0496113_0197487
693 Ga0496114_0098367
694 Ga0496114_0425348
695 Ga0501067_0586128
696 Ga0501083_0022763
697 nmdc:mga05p37_163660_c1
698 nmdc:mga05p37_369804_c1
699 nmdc:mga05p37_486857_c1
700 nmdc:mga05p37_51184_c1
701 nmdc:mga05p37_604142_c1
702 nmdc:mga05p37_7684_c1
703 nmdc:mga0n895_131076_c1
704 nmdc:mga0n895_137975_c1
705 nmdc:mga0n895_169728_c1
706 nmdc:mga0n895_466982_c1
707 nmdc:mga0n895_5101_c1
708 nmdc:mga0n895_944881_c1
709 nmdc:mga0rr50_1386137_c1
710 nmdc:mga0rr50_418_c1
711 nmdc:mga0rr50_43391_c1
712 nmdc:mga0rr50_49246_c1
713 nmdc:mga0rr50_830121_c1
714 nmdc:mga08x19_111066_c1
715 nmdc:mga08x19_1353076_c1
716 nmdc:mga08x19_60281_c1
717 nmdc:mga08x19_87779_c1
718 nmdc:mga08x19_98101_c1
719 nmdc:mga0a205_410904_c1
720 nmdc:mga0a205_498823_c1
721 nmdc:mga0a205_82992_c1
722 nmdc:mga0a205_88184_c1
723 nmdc:mga0a205_98048_c1
724 Ga0495601_0540032

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07876

Dabb

Stress responsive A/B Barrel Domain

2

96

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bgu-assembly1.cif.gz_A crystal structure of a dimeric ferredoxin-like protein of unknown function (tfu_0763) from thermobifida fusca yx at 1.50 a resolution 0.9235 2 95
3bgu-assembly1.cif.gz_A crystal structure of a dimeric ferredoxin-like protein of unknown function (tfu_0763) from thermobifida fusca yx at 1.50 a resolution 0.9054 2 95
5xzq-assembly2.cif.gz_D hydroxynitrile lyase from passiflora edulis (pehnl) 0.8914 2 95
5b0b-assembly2.cif.gz_B polyketide cyclase oac from cannabis sativa, i7f mutant 0.8906 1 95
5b0g-assembly1.cif.gz_A-2 polyketide cyclase oac from cannabis sativa, h78s mutant 0.8868 1 95
ID Description Score Start End Superfamily
3bguB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9271 1 95 3.30.70.100
af_Q67XD6_173_269_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9228 4 95 3.30.70.100
af_I1LY42_1_101_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9225 2 93 3.30.70.100
af_C0HHH9_33_145_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9212 2 93 3.30.70.100
af_A0A1D6PLI0_180_283_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.916 2 95 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A1Q8AVP8-F1-model_v4 Stress-response A/B barrel domain-containing protein 0.9923 1 95
AF-A0A2V8QJN9-F1-model_v4 Stress responsive protein 0.9891 1 95
AF-A0A2V8C935-F1-model_v4 Stress-response A/B barrel domain-containing protein 0.9889 2 95
AF-A0A352EV44-F1-model_v4 Stress responsive protein 0.9876 2 95
AF-A0A399WK14-F1-model_v4 Stress-response A/B barrel domain-containing protein 0.9851 2 93

Map