F422425

General Info

Members Datasets Scaffolds Average Seq Length
361 242 722 253

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2831905167|2831905858
Length 269
Sequence DKTKIEYVGDSRVPAKKHPNISPSYSEFPGKTEAFWPNFLLKEWMVAAVALMGYLILTVSQPAPLTDMADPTNTSFTPLPDWYFLFLYQLLKYPWASGTPWVLMGTVVLPGLMFGGLMLAPFLDRGPERRWTKRPVASGLMFLGVISVAFLTWEAMDGYKKMEASKAEAAAEAGEPGGDSGGAAAPPAAELDSDDPGAEIWAAQTSCVSCHGADMSGGGGPPLTDVGSRLSADEIKDVIVNGAGIMSAGMFDGTDEELDQLVEFLAEQK

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
13 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
19 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
20 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
21 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
22 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
25 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
26 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
28 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
29 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
35 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
36 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
37 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
38 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
39 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
40 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
41 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
42 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
43 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
44 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
45 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
46 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
47 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
48 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
49 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
50 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
51 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
52 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
53 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
54 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
55 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
56 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
57 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
58 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
59 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
60 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
61 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
62 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
63 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
64 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
65 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
66 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
67 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
68 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
69 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
70 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
71 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
72 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
111 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
112 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
113 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
114 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
115 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
116 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
117 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
118 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
119 2554235283 Bacillus safensis VK Isolate Rhizosphere
120 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
121 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
122 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
123 2643221729 Bacillus sp. Root11 Isolate Unclassified
124 2643221730 Bacillus sp. Root131 Isolate Unclassified
125 2643221731 Bacillus sp. Root147 Isolate Unclassified
126 2643221732 Bacillus sp. Root239 Isolate Unclassified
127 2643221735 Bacillus sp. Root920 Isolate Unclassified
128 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
129 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
130 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
131 2684622632 Bacillus cereus 905 Isolate Unclassified
132 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
133 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
134 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
135 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
136 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
137 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
138 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
139 2738541295 Bacillus sp. OK085 Isolate Unclassified
140 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
141 2738541358 Bacillus sp. OV752 Isolate Unclassified
142 2738543006 Bacillus sp. OK077 Isolate Unclassified
143 2738543010 Bacillus sp. YR335 Isolate Unclassified
144 2738543017 Bacillus sp. OV186 Isolate Unclassified
145 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
146 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
147 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
148 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
149 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
150 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
151 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
152 2811994870 Bacillus sp. JB4 Isolate Unclassified
153 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
154 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
155 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
156 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
157 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
158 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
159 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
160 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
161 2842682962 Bacillus sp. R-72492 Isolate Unclassified
162 2842882022 Bacillus sp. R-71893 Isolate Unclassified
163 2849139964 Bacillus sp. R-71875 Isolate Unclassified
164 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
165 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
166 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
167 2857581216 Bacillus sp. R-71922 Isolate Unclassified
168 2857586860 Bacillus sp. R-71935 Isolate Unclassified
169 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
170 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
171 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
172 2860837431 Bacillus sp. WR11 Isolate Unclassified
173 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
174 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
175 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
176 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
177 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
178 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
179 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
180 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
181 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
182 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
183 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
184 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
185 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
186 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
187 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
188 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
189 2919720352 Priestia megaterium 4340 Isolate Unclassified
190 2919726948 Bacillus pumilus 4489 Isolate Unclassified
191 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
192 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
193 2929004312 Priestia megaterium 1104 Isolate Unclassified
194 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
195 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
196 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
197 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
198 2938917290 Bacillus sp. CR71 Isolate Unclassified
199 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
200 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
201 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
202 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
203 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
204 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
205 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
206 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
207 2965761152 Bacillus sp. COPE52 Isolate Unclassified
208 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
209 2969141011 Bacillus velezensis MH25 Isolate Unclassified
210 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
211 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
212 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
213 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
214 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
215 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
216 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
217 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
218 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
219 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
220 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
221 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
222 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
223 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
224 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
225 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
226 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
227 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
228 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
229 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
230 8022653035 Bacillus sp. Rc4 Isolate Unclassified
231 8022792930 Bacillus sp. Xin Isolate Rhizosphere
232 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
233 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
234 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
235 8023438354 Bacillus sp. BH2 Isolate Unclassified
236 8023444577 Bacillus sp. BH32 Isolate Unclassified
237 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
238 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
239 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
240 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
241 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
242 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 33.24
Metatranscriptomes 30.47
Isolates 36.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.8
Nodule 0.28
Rhizoplane 6.37
Rhizosphere 59.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1002218 3300002987 Bacteria 7518
2 JGI25151J46595_10000006 3300003187 Bacteria 419711
3 JGI25151J46595_10000029 3300003187 Bacteria 205878
4 JGI25151J46595_10001244 3300003187 Bacteria 18082
5 JGI25151J46595_10002507 3300003187 Bacteria 10940
6 JGI25151J46595_10006161 3300003187 Bacteria 6074
7 JGI25151J46595_10009909 3300003187 Bacteria 4473
8 JGI25151J46595_10011298 3300003187 Bacteria 4109
9 rootH1_10005212 3300003316 Bacteria 6616
10 rootH2_10159269 3300003320 Bacteria 3407
11 rootL2_10053963 3300003322 Bacteria 19842
12 Ga0006562J51391_1000488 3300003578 Bacteria 9128
13 Ga0006562J51391_1000985 3300003578 Bacteria 7360
14 Ga0006562J51391_1005020 3300003578 Bacteria 2684
15 Ga0006562J51391_1006075 3300003578 Bacteria 2767
16 Ga0055538_1000127 3300003751 Bacteria 57318
17 Ga0055532_1000064 3300003758 Bacteria 143144
18 Ga0055532_1000216 3300003758 Bacteria 45278
19 Ga0055532_1001342 3300003758 Bacteria 7031
20 Ga0055528_1002533 3300003790 Bacteria 9716
21 Ga0070671_100005375 3300005355 Bacteria 10210
22 Ga0070714_100248164 3300005435 Bacteria 1645
23 Ga0070715_10111622 3300006163 Bacteria 1290
24 Ga0105251_10026218 3300009011 Bacteria 2969
25 Ga0105244_10009034 3300009036 Bacteria 6166
26 Ga0105250_10000349 3300009092 Bacteria 35603
27 Ga0105250_10164275 3300009092 Bacteria 928
28 Ga0105243_10007087 3300009148 Bacteria 8622
29 Ga0105242_10006210 3300009176 Bacteria 9206
30 Ga0105246_10000914 3300011119 Bacteria 16895
31 Ga0105246_10004581 3300011119 Bacteria 8417
32 Ga0105246_10060873 3300011119 Bacteria 2625
33 Ga0157371_10001618 3300013102 Bacteria 23022
34 Ga0157374_10035162 3300013296 Bacteria 4582
35 Ga0157378_10012237 3300013297 Bacteria 7514
36 Ga0209784_100031 3300025224 Bacteria 318854
37 Ga0209147_100014 3300025229 Bacteria 597841
38 Ga0209147_100042 3300025229 Bacteria 301263
39 Ga0209147_100461 3300025229 Bacteria 25155
40 Ga0209147_100886 3300025229 Bacteria 13755
41 Ga0209673_1001303 3300025273 Bacteria 25353
42 Ga0209130_1001523 3300025284 Bacteria 14880
43 Ga0209130_1001598 3300025284 Bacteria 14164
44 Ga0209676_1001634 3300025292 Bacteria 19697
45 Ga0209676_1001914 3300025292 Bacteria 16888
46 Ga0209676_1032896 3300025292 Bacteria 1552
47 Ga0209676_1057078 3300025292 Bacteria 991
48 Ga0209025_1000001 3300025294 Bacteria 1888151
49 Ga0209025_1001116 3300025294 Bacteria 38478
50 Ga0209025_1001500 3300025294 Bacteria 30144
51 Ga0209025_1001783 3300025294 Bacteria 25606
52 Ga0209025_1002108 3300025294 Bacteria 22452
53 Ga0209025_1002666 3300025294 Bacteria 18228
54 Ga0209025_1019560 3300025294 Bacteria 3758
55 Ga0209025_1020401 3300025294 Bacteria 3628
56 Ga0209025_1026556 3300025294 Bacteria 2901
57 Ga0209025_1036788 3300025294 Bacteria 2185
58 Ga0209025_1057173 3300025294 Bacteria 1493
59 Ga0209025_1078912 3300025294 Bacteria 1128
60 Ga0209025_1094770 3300025294 Bacteria 963
61 Ga0207426_1013959 3300025302 Bacteria 2959
62 Ga0207696_1001021 3300025711 Bacteria 16702
63 Ga0207696_1008032 3300025711 Bacteria 4078
64 Ga0207696_1010121 3300025711 Bacteria 3476
65 Ga0207655_1000925 3300025728 Bacteria 30529
66 Ga0207655_1005841 3300025728 Bacteria 8258
67 Ga0207713_1001429 3300025735 Bacteria 19109
68 Ga0207663_10342498 3300025916 Bacteria 1129
69 Ga0207709_10009399 3300025935 Bacteria 5380
70 Ga0237817_10030 3300030083 Bacteria 49360
71 Ga0307408_100002786 3300031548 Bacteria 12130
72 Ga0307408_100286304 3300031548 Bacteria 1374
73 Ga0307410_10165151 3300031852 Bacteria 1663
74 Ga0307409_100003336 3300031995 Bacteria 8689
75 Ga0307409_100141375 3300031995 Bacteria 2075
76 Ga0307416_100042278 3300032002 Bacteria 3556
77 Ga0307416_100068418 3300032002 Bacteria 2934
78 Ga0307416_100240414 3300032002 Bacteria 1754
79 Ga0237819_00532 3300038705 Bacteria 12767
80 Ga0237819_02286 3300038705 Bacteria 3989
81 Ga0466957_0163928 3300044842 Bacteria 1445
82 Ga0466967_0000257 3300045976 Bacteria 23336
83 Ga0495627_092208 3300046453 Bacteria 870
84 Ga0495603_0015128 3300046455 Bacteria 4666
85 Ga0495584_0104785 3300046491 Bacteria 1430
86 Ga0495620_0054337 3300046515 Bacteria 1692
87 Ga0495654_0040640 3300046530 Bacteria 2317
88 Ga0495622_0017358 3300046557 Bacteria 3350
89 Ga0495661_0280835 3300046665 Bacteria 839
90 Ga0495683_0003440 3300047323 Bacteria 9238
91 Ga0495626_0067033 3300048091 Bacteria 1622
92 Ga0496100_0006969 3300048903 Bacteria 6195
93 Ga0496101_0015569 3300048904 Bacteria 5127
94 Ga0496102_0019444 3300048905 Bacteria 5981
95 Ga0496102_0021117 3300048905 Bacteria 5757
96 Ga0496103_0003236 3300048906 Bacteria 9994
97 Ga0496104_0001000 3300048907 Bacteria 24172
98 Ga0496105_0000640 3300048908 Bacteria 23445
99 Ga0496105_0346167 3300048908 Bacteria 1188
100 Ga0496106_0000397 3300048909 Bacteria 31022
101 Ga0496106_0074980 3300048909 Bacteria 2591
102 Ga0496107_0000301 3300048910 Bacteria 26448
103 Ga0496107_0607756 3300048910 Bacteria 808
104 Ga0496108_0000932 3300048911 Bacteria 22824
105 Ga0496108_0152926 3300048911 Bacteria 1992
106 Ga0496109_0000685 3300048912 Bacteria 28223
107 Ga0496110_0000915 3300048913 Bacteria 20674
108 Ga0496110_0002131 3300048913 Bacteria 14776
109 Ga0496111_0000104 3300048914 Bacteria 36668
110 Ga0496112_0003728 3300048915 Bacteria 12721
111 Ga0496112_0060573 3300048915 Bacteria 3730
112 Ga0496112_0192833 3300048915 Bacteria 1999
113 Ga0496113_0049513 3300048916 Bacteria 3129
114 Ga0496116_0108856 3300048919 Bacteria 1635
115 Ga0496117_0024007 3300048920 Bacteria 4839
116 Ga0496119_0001853 3300048922 Bacteria 24393
117 Ga0496122_0005523 3300048925 Bacteria 15017
118 Ga0496124_0093141 3300048927 Bacteria 2453
119 Ga0496125_0002951 3300048928 Bacteria 21377
120 Ga0496125_0374322 3300048928 Bacteria 842
121 Ga0496126_0011846 3300048929 Bacteria 8971
122 Ga0496126_0204804 3300048929 Bacteria 1664
123 Ga0501306_001170 3300049127 Bacteria 2378
124 Ga0501308_000862 3300049128 Bacteria 2203
125 Ga0501310_001434 3300049130 Bacteria 2178
126 Ga0501341_00325 3300049131 Bacteria 1896
127 Ga0501341_00433 3300049131 Bacteria 1752
128 Ga0501341_00652 3300049131 Bacteria 1535
129 Ga0501341_03932 3300049131 Bacteria 855
130 Ga0501343_000040 3300049132 Bacteria 5222
131 Ga0501343_000041 3300049132 Bacteria 5181
132 Ga0501344_00176 3300049133 Bacteria 2288
133 Ga0501344_00618 3300049133 Bacteria 1536
134 Ga0501344_01752 3300049133 Bacteria 1076
135 Ga0501345_00009 3300049134 Bacteria 4357
136 Ga0501345_00083 3300049134 Bacteria 2320
137 Ga0501304_000345 3300049160 Bacteria 2280
138 Ga0501305_000229 3300049161 Bacteria 4090
139 Ga0501305_000863 3300049161 Bacteria 2722
140 Ga0501305_001932 3300049161 Bacteria 2143
141 Ga0501305_004334 3300049161 Bacteria 1663
142 Ga0501305_022819 3300049161 Bacteria 933
143 Ga0501307_000559 3300049162 Bacteria 2636
144 Ga0501307_000812 3300049162 Bacteria 2362
145 Ga0501307_001033 3300049162 Bacteria 2196
146 Ga0501342_00257 3300049163 Bacteria 1358
147 Ga0501342_00833 3300049163 Bacteria 893
148 Ga0501311_000793 3300049527 Bacteria 2445
149 Ga0501311_005987 3300049527 Bacteria 1354
150 Ga0501311_026165 3300049527 Bacteria 821
151 Ga0501312_000358 3300049528 Bacteria 3480
152 Ga0501312_000423 3300049528 Bacteria 3342
153 Ga0501312_000586 3300049528 Bacteria 3055
154 Ga0501312_000993 3300049528 Bacteria 2616
155 Ga0501312_002145 3300049528 Bacteria 2091
156 Ga0501312_026866 3300049528 Bacteria 885
157 Ga0501313_000765 3300049529 Bacteria 2429
158 Ga0501313_001469 3300049529 Bacteria 2059
159 Ga0501313_004911 3300049529 Bacteria 1393
160 Ga0501314_000590 3300049530 Bacteria 2297
161 Ga0501314_000690 3300049530 Bacteria 2186
162 Ga0501314_001013 3300049530 Bacteria 1924
163 Ga0501315_000084 3300049531 Bacteria 4562
164 Ga0501315_000163 3300049531 Bacteria 3829
165 Ga0501315_001079 3300049531 Bacteria 2204
166 Ga0501315_002882 3300049531 Bacteria 1671
167 Ga0501315_008615 3300049531 Bacteria 1190
168 Ga0501316_000803 3300049532 Bacteria 2402
169 Ga0501316_002131 3300049532 Bacteria 1799
170 Ga0501316_002703 3300049532 Bacteria 1663
171 Ga0501316_008540 3300049532 Bacteria 1133
172 Ga0501316_013134 3300049532 Bacteria 976
173 Ga0501316_019402 3300049532 Bacteria 847
174 Ga0501317_000090 3300049533 Bacteria 4577
175 Ga0501317_000159 3300049533 Bacteria 3862
176 Ga0501317_000357 3300049533 Bacteria 3071
177 Ga0501317_000539 3300049533 Bacteria 2746
178 Ga0501317_000699 3300049533 Bacteria 2523
179 Ga0501317_006932 3300049533 Bacteria 1263
180 Ga0501318_000087 3300049534 Bacteria 4030
181 Ga0501318_000456 3300049534 Bacteria 2593
182 Ga0501318_002439 3300049534 Bacteria 1610
183 Ga0501319_000254 3300049535 Bacteria 2296
184 Ga0501319_000307 3300049535 Bacteria 2175
185 Ga0501320_000613 3300049536 Bacteria 2188
186 Ga0501321_000112 3300049537 Bacteria 4020
187 Ga0501321_000381 3300049537 Bacteria 2761
188 Ga0501321_000719 3300049537 Bacteria 2304
189 Ga0501321_006345 3300049537 Bacteria 1200
190 Ga0501322_000326 3300049538 Bacteria 2130
191 Ga0501322_001569 3300049538 Bacteria 1306
192 Ga0501323_000634 3300049539 Bacteria 2704
193 Ga0501323_001453 3300049539 Bacteria 2106
194 Ga0501323_008340 3300049539 Bacteria 1201
195 Ga0501323_021331 3300049539 Bacteria 856
196 Ga0501324_002405 3300049540 Bacteria 1351
197 Ga0501325_000429 3300049541 Bacteria 1981
198 Ga0501326_00108 3300049542 Bacteria 2631
199 Ga0501326_00483 3300049542 Bacteria 1588
200 Ga0501328_00256 3300049544 Bacteria 1629
201 Ga0501330_000242 3300049546 Bacteria 2070
202 Ga0501330_001029 3300049546 Bacteria 1375
203 Ga0501330_002535 3300049546 Bacteria 1041
204 Ga0501331_00038 3300049547 Bacteria 3466
205 Ga0501331_01655 3300049547 Bacteria 1110
206 Ga0501332_00063 3300049548 Bacteria 3095
207 Ga0501332_02879 3300049548 Bacteria 978
208 Ga0501333_000094 3300049549 Bacteria 2886
209 Ga0501333_000171 3300049549 Bacteria 2535
210 Ga0501333_000261 3300049549 Bacteria 2230
211 Ga0501334_00123 3300049550 Bacteria 2742
212 Ga0501334_00969 3300049550 Bacteria 1498
213 Ga0501334_02416 3300049550 Bacteria 1108
214 Ga0501335_000071 3300049551 Bacteria 4320
215 Ga0501335_000272 3300049551 Bacteria 2989
216 Ga0501335_000776 3300049551 Bacteria 2218
217 Ga0501335_004994 3300049551 Bacteria 1175
218 Ga0501336_000337 3300049552 Bacteria 2213
219 Ga0501336_000752 3300049552 Bacteria 1739
220 Ga0501336_001663 3300049552 Bacteria 1358
221 Ga0501337_000048 3300049553 Bacteria 4201
222 Ga0501337_000115 3300049553 Bacteria 3108
223 Ga0501338_00018 3300049554 Bacteria 4497
224 Ga0501338_00214 3300049554 Bacteria 2337
225 Ga0501338_02679 3300049554 Bacteria 1022
226 Ga0501338_03403 3300049554 Bacteria 939
227 Ga0501340_000156 3300049556 Bacteria 2407
228 Ga0501340_000313 3300049556 Bacteria 1962
229 Ga0501217_010290 3300049661 Bacteria 2045
230 Ga0501081_0446886 3300049743 Bacteria 960
231 2831905858 2831905167 Bacteria 3319172
232 2511179913 2510917027 Bacteria 5287437
233 2511700025 2511231119 Bacteria 4019861
234 2512640158 2512564013 Bacteria 6286191
235 2540607188 2540341094 Bacteria 4061186
236 2545556711 2545555800 Bacteria 4222588
237 2553391640 2551306519 Bacteria 5465154
238 2555467427 2554235283 Bacteria 3683090
239 2578930959 2576861599 Bacteria 4217202
240 2595087755 2593339131 Bacteria 5116855
241 2631984379 2630968484 Bacteria 3876276
242 2644704017 2643221729 Bacteria 6621700
243 2644708710 2643221730 Bacteria 6523787
244 2644716004 2643221731 Bacteria 5623886
245 2644724126 2643221732 Bacteria 5756404
246 2644740601 2643221735 Bacteria 3676263
247 2651532096 2648501850 Bacteria 3975476
248 2672336732 2671180330 Bacteria 5521719
249 2674419127 2671180844 Bacteria 4164150
250 2685149447 2684622632 Bacteria 5380049
251 2686997253 2684623153 Bacteria 3878815
252 2687498560 2687453109 Bacteria 3860091
253 2695628003 2695420354 Bacteria 3922431
254 2698323733 2695420987 Bacteria 6152737
255 2705993494 2703719227 Bacteria 5631989
256 2717916283 2716884898 Bacteria 3928789
257 2721504827 2718218445 Bacteria 5113413
258 2738814258 2738541295 Bacteria 5730091
259 2738840258 2738541299 Bacteria 4020721
260 2739156202 2738541358 Bacteria 5932299
261 2739210859 2738543006 Bacteria 5904091
262 2739230522 2738543010 Bacteria 5583595
263 2739270039 2738543017 Bacteria 4271950
264 2745168747 2744054657 Bacteria 5016802
265 2757565741 2757320391 Bacteria 4746095
266 2777761338 2775507177 Bacteria 4384303
267 2777838831 2775507192 Bacteria 4622234
268 2791212729 2788500588 Bacteria 4584915
269 2808869206 2808606364 Bacteria 4465927
270 2809057020 2808606399 Bacteria 4021018
271 2812316445 2811994870 Bacteria 3776934
272 2816862807 2816332186 Bacteria 5331395
273 2817480492 2816332295 Bacteria 4352468
274 2817618301 2816332336 Bacteria 5207640
275 2819579406 2818991443 Bacteria 6598732
276 2819626872 2818991451 Bacteria 4697364
277 2819709476 2818991465 Bacteria 5388835
278 2819723514 2818991468 Bacteria 3723169
279 2823528426 2823526263 Bacteria 3765752
280 2842684269 2842682962 Bacteria 5589973
281 2842884273 2842882022 Bacteria 6158489
282 2849144235 2849139964 Bacteria 5613304
283 2852675294 2852673933 Bacteria 3347676
284 2857461354 2857460504 Bacteria 5194327
285 2857469870 2857465823 Bacteria 6772595
286 2857582542 2857581216 Bacteria 5522813
287 2857587413 2857586860 Bacteria 4354574
288 2857591796 2857591370 Bacteria 6569758
289 2857604293 2857604169 Bacteria 5111450
290 2857610952 2857609550 Bacteria 3753890
291 2860839871 2860837431 Bacteria 4202080
292 2877770906 2877768649 Bacteria 3957164
293 2880171771 2880169592 Bacteria 3900066
294 2881646738 2881644220 Bacteria 5302661
295 2897111996 2897109615 Bacteria 4009619
296 2898909787 2898907183 Bacteria 4067722
297 2904524698 2904524088 Bacteria 5887454
298 2904563669 2904560550 Bacteria 4029838
299 2904606989 2904606771 Bacteria 4684500
300 2908668370 2908665501 Bacteria 3678115
301 2915601128 2915597211 Bacteria 6475886
302 2915607376 2915606848 Bacteria 6032732
303 2916974317 2916971899 Bacteria 4250608
304 2919096139 2919093281 Bacteria 3660974
305 2919146706 2919143609 Bacteria 6219228
306 2919415220 2919414237 Bacteria 5429133
307 2919518629 2919517244 Bacteria 5858162
308 2919722996 2919720352 Bacteria 5986006
309 2919728143 2919726948 Bacteria 3696050
310 2928096476 2928093941 Bacteria 5965005
311 2928513928 2928510474 Bacteria 4815308
312 2929006149 2929004312 Bacteria 5678476
313 2929186268 2929183550 Bacteria 6377511
314 2929234722 2929233124 Bacteria 5948380
315 2936341614 2936340661 Bacteria 5139038
316 2936367173 2936361878 Bacteria 5632809
317 2938918896 2938917290 Bacteria 5914775
318 2939595396 2939593269 Bacteria 4798695
319 2947428268 2947426588 Bacteria 5357194
320 2954774059 2954773129 Bacteria 3741715
321 2956898086 2956897341 Bacteria 5447711
322 2960320620 2960319331 Bacteria 5502575
323 2960380692 2960375949 Bacteria 5361395
324 2962293141 2962290636 Bacteria 4072939
325 2964377207 2964375228 Bacteria 4909004
326 2965762761 2965761152 Bacteria 5806513
327 2969139154 2969136845 Bacteria 3923176
328 2969143350 2969141011 Bacteria 4118468
329 2969767118 2969765954 Bacteria 4216713
330 2969773566 2969770375 Bacteria 4271280
331 2971895551 2971893375 Bacteria 3929648
332 2977256823 2977254563 Bacteria 4828420
333 2979085194 2979083700 Bacteria 5894929
334 2980494886 2980492589 Bacteria 4072961
335 2990277698 2990275345 Bacteria 4887158
336 3001268176 3001267043 Bacteria 4823521
337 3001273674 3001272096 Bacteria 4729684
338 3001898017 3001892409 Bacteria 6328293
339 3006831618 3006826541 Bacteria 4678913
340 3006860837 3006858327 Bacteria 4317835
341 3006881374 3006879489 Bacteria 4064221
342 3006972964 3006969106 Bacteria 4739423
343 3006975638 3006973921 Bacteria 4423788
344 3006981541 3006978542 Bacteria 5328100
345 3006984809 3006984091 Bacteria 4207523
346 3006989154 3006988479 Bacteria 4767936
347 8022622691 8022621104 Bacteria 5241040
348 8022633606 8022630665 Bacteria 3886130
349 8022657381 8022653035 Bacteria 4035078
350 8022798100 8022792930 Bacteria 5693794
351 8022897946 8022893055 Bacteria 5300455
352 8022917128 8022914991 Bacteria 5584517
353 8022949604 8022948649 Bacteria 5366783
354 8023442424 8023438354 Bacteria 5779374
355 8023447980 8023444577 Bacteria 5661597
356 8051955509 8051952484 Bacteria 3926774
357 8052176778 8052174270 Bacteria 3881265
358 8054281487 8054280661 Bacteria 4232245
359 8055533465 8055531788 Bacteria 5249694
360 8057584278 8057582654 Bacteria 5218944
361 8057635170 8057632132 Bacteria 4726859
362 JGI25159J45721_1002218
363 JGI25151J46595_10000006
364 JGI25151J46595_10000029
365 JGI25151J46595_10001244
366 JGI25151J46595_10002507
367 JGI25151J46595_10006161
368 JGI25151J46595_10009909
369 JGI25151J46595_10011298
370 rootH1_10005212
371 rootH2_10159269
372 rootL2_10053963
373 Ga0006562J51391_1000488
374 Ga0006562J51391_1000985
375 Ga0006562J51391_1005020
376 Ga0006562J51391_1006075
377 Ga0055538_1000127
378 Ga0055532_1000064
379 Ga0055532_1000216
380 Ga0055532_1001342
381 Ga0055528_1002533
382 Ga0070671_100005375
383 Ga0070714_100248164
384 Ga0070715_10111622
385 Ga0105251_10026218
386 Ga0105244_10009034
387 Ga0105250_10000349
388 Ga0105250_10164275
389 Ga0105243_10007087
390 Ga0105242_10006210
391 Ga0105246_10000914
392 Ga0105246_10004581
393 Ga0105246_10060873
394 Ga0157371_10001618
395 Ga0157374_10035162
396 Ga0157378_10012237
397 Ga0209784_100031
398 Ga0209147_100014
399 Ga0209147_100042
400 Ga0209147_100461
401 Ga0209147_100886
402 Ga0209673_1001303
403 Ga0209130_1001523
404 Ga0209130_1001598
405 Ga0209676_1001634
406 Ga0209676_1001914
407 Ga0209676_1032896
408 Ga0209676_1057078
409 Ga0209025_1000001
410 Ga0209025_1001116
411 Ga0209025_1001500
412 Ga0209025_1001783
413 Ga0209025_1002108
414 Ga0209025_1002666
415 Ga0209025_1019560
416 Ga0209025_1020401
417 Ga0209025_1026556
418 Ga0209025_1036788
419 Ga0209025_1057173
420 Ga0209025_1078912
421 Ga0209025_1094770
422 Ga0207426_1013959
423 Ga0207696_1001021
424 Ga0207696_1008032
425 Ga0207696_1010121
426 Ga0207655_1000925
427 Ga0207655_1005841
428 Ga0207713_1001429
429 Ga0207663_10342498
430 Ga0207709_10009399
431 Ga0237817_10030
432 Ga0307408_100002786
433 Ga0307408_100286304
434 Ga0307410_10165151
435 Ga0307409_100003336
436 Ga0307409_100141375
437 Ga0307416_100042278
438 Ga0307416_100068418
439 Ga0307416_100240414
440 Ga0237819_00532
441 Ga0237819_02286
442 Ga0466957_0163928
443 Ga0466967_0000257
444 Ga0495627_092208
445 Ga0495603_0015128
446 Ga0495584_0104785
447 Ga0495620_0054337
448 Ga0495654_0040640
449 Ga0495622_0017358
450 Ga0495661_0280835
451 Ga0495683_0003440
452 Ga0495626_0067033
453 Ga0496100_0006969
454 Ga0496101_0015569
455 Ga0496102_0019444
456 Ga0496102_0021117
457 Ga0496103_0003236
458 Ga0496104_0001000
459 Ga0496105_0000640
460 Ga0496105_0346167
461 Ga0496106_0000397
462 Ga0496106_0074980
463 Ga0496107_0000301
464 Ga0496107_0607756
465 Ga0496108_0000932
466 Ga0496108_0152926
467 Ga0496109_0000685
468 Ga0496110_0000915
469 Ga0496110_0002131
470 Ga0496111_0000104
471 Ga0496112_0003728
472 Ga0496112_0060573
473 Ga0496112_0192833
474 Ga0496113_0049513
475 Ga0496116_0108856
476 Ga0496117_0024007
477 Ga0496119_0001853
478 Ga0496122_0005523
479 Ga0496124_0093141
480 Ga0496125_0002951
481 Ga0496125_0374322
482 Ga0496126_0011846
483 Ga0496126_0204804
484 Ga0501306_001170
485 Ga0501308_000862
486 Ga0501310_001434
487 Ga0501341_00325
488 Ga0501341_00433
489 Ga0501341_00652
490 Ga0501341_03932
491 Ga0501343_000040
492 Ga0501343_000041
493 Ga0501344_00176
494 Ga0501344_00618
495 Ga0501344_01752
496 Ga0501345_00009
497 Ga0501345_00083
498 Ga0501304_000345
499 Ga0501305_000229
500 Ga0501305_000863
501 Ga0501305_001932
502 Ga0501305_004334
503 Ga0501305_022819
504 Ga0501307_000559
505 Ga0501307_000812
506 Ga0501307_001033
507 Ga0501342_00257
508 Ga0501342_00833
509 Ga0501311_000793
510 Ga0501311_005987
511 Ga0501311_026165
512 Ga0501312_000358
513 Ga0501312_000423
514 Ga0501312_000586
515 Ga0501312_000993
516 Ga0501312_002145
517 Ga0501312_026866
518 Ga0501313_000765
519 Ga0501313_001469
520 Ga0501313_004911
521 Ga0501314_000590
522 Ga0501314_000690
523 Ga0501314_001013
524 Ga0501315_000084
525 Ga0501315_000163
526 Ga0501315_001079
527 Ga0501315_002882
528 Ga0501315_008615
529 Ga0501316_000803
530 Ga0501316_002131
531 Ga0501316_002703
532 Ga0501316_008540
533 Ga0501316_013134
534 Ga0501316_019402
535 Ga0501317_000090
536 Ga0501317_000159
537 Ga0501317_000357
538 Ga0501317_000539
539 Ga0501317_000699
540 Ga0501317_006932
541 Ga0501318_000087
542 Ga0501318_000456
543 Ga0501318_002439
544 Ga0501319_000254
545 Ga0501319_000307
546 Ga0501320_000613
547 Ga0501321_000112
548 Ga0501321_000381
549 Ga0501321_000719
550 Ga0501321_006345
551 Ga0501322_000326
552 Ga0501322_001569
553 Ga0501323_000634
554 Ga0501323_001453
555 Ga0501323_008340
556 Ga0501323_021331
557 Ga0501324_002405
558 Ga0501325_000429
559 Ga0501326_00108
560 Ga0501326_00483
561 Ga0501328_00256
562 Ga0501330_000242
563 Ga0501330_001029
564 Ga0501330_002535
565 Ga0501331_00038
566 Ga0501331_01655
567 Ga0501332_00063
568 Ga0501332_02879
569 Ga0501333_000094
570 Ga0501333_000171
571 Ga0501333_000261
572 Ga0501334_00123
573 Ga0501334_00969
574 Ga0501334_02416
575 Ga0501335_000071
576 Ga0501335_000272
577 Ga0501335_000776
578 Ga0501335_004994
579 Ga0501336_000337
580 Ga0501336_000752
581 Ga0501336_001663
582 Ga0501337_000048
583 Ga0501337_000115
584 Ga0501338_00018
585 Ga0501338_00214
586 Ga0501338_02679
587 Ga0501338_03403
588 Ga0501340_000156
589 Ga0501340_000313
590 Ga0501217_010290
591 Ga0501081_0446886
592 2831905858
593 2511179913
594 2511700025
595 2512640158
596 2540607188
597 2545556711
598 2553391640
599 2555467427
600 2578930959
601 2595087755
602 2631984379
603 2644704017
604 2644708710
605 2644716004
606 2644724126
607 2644740601
608 2651532096
609 2672336732
610 2674419127
611 2685149447
612 2686997253
613 2687498560
614 2695628003
615 2698323733
616 2705993494
617 2717916283
618 2721504827
619 2738814258
620 2738840258
621 2739156202
622 2739210859
623 2739230522
624 2739270039
625 2745168747
626 2757565741
627 2777761338
628 2777838831
629 2791212729
630 2808869206
631 2809057020
632 2812316445
633 2816862807
634 2817480492
635 2817618301
636 2819579406
637 2819626872
638 2819709476
639 2819723514
640 2823528426
641 2842684269
642 2842884273
643 2849144235
644 2852675294
645 2857461354
646 2857469870
647 2857582542
648 2857587413
649 2857591796
650 2857604293
651 2857610952
652 2860839871
653 2877770906
654 2880171771
655 2881646738
656 2897111996
657 2898909787
658 2904524698
659 2904563669
660 2904606989
661 2908668370
662 2915601128
663 2915607376
664 2916974317
665 2919096139
666 2919146706
667 2919415220
668 2919518629
669 2919722996
670 2919728143
671 2928096476
672 2928513928
673 2929006149
674 2929186268
675 2929234722
676 2936341614
677 2936367173
678 2938918896
679 2939595396
680 2947428268
681 2954774059
682 2956898086
683 2960320620
684 2960380692
685 2962293141
686 2964377207
687 2965762761
688 2969139154
689 2969143350
690 2969767118
691 2969773566
692 2971895551
693 2977256823
694 2979085194
695 2980494886
696 2990277698
697 3001268176
698 3001273674
699 3001898017
700 3006831618
701 3006860837
702 3006881374
703 3006972964
704 3006975638
705 3006981541
706 3006984809
707 3006989154
708 8022622691
709 8022633606
710 8022657381
711 8022798100
712 8022897946
713 8022917128
714 8022949604
715 8023442424
716 8023447980
717 8051955509
718 8052176778
719 8054281487
720 8055533465
721 8057584278
722 8057635170

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

192

265

0.92

PF00032

Cytochrom_B_C

Cytochrome b(C-terminal)/b6/petD

68

171

0.86

PF00034

Cytochrom_C

Cytochrome c

194

269

0.84

Map