F422272

General Info

Members Datasets Scaffolds Average Seq Length
361 110 722 105

Family's Representative Sequence

Representative Sequence 3300032133|Ga0316583_10210060|Ga0316583_102100601
Length 104
Sequence MALFEHGDISIEVDEDGFMQEPDLWTEEVAKALATTEGVDEMTDEHWKVVNYIRDYFAEFGTAPMIRKLCKATFPLKQIYELFPSGPAKGACKVAGLAKPTGCV

Samples

Sample ID Description Type Environment
1 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
47 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
50 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
54 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
55 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
56 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
57 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
58 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
59 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
60 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
63 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
64 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
65 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
66 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
67 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
68 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
77 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
80 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
81 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
82 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
83 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
84 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
85 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
86 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
93 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
110 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.52
Metatranscriptomes 25.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.66
Rhizosphere 96.4
Stem 0
Stem Tuber 0
Unclassified 29.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316583_10210060 3300032133 Bacteria 675
2 Ga0065712_10416724 3300005290 Unclassified 716
3 Ga0070658_11189448 3300005327 Unclassified 663
4 Ga0070683_100239705 3300005329 Bacteria 1725
5 Ga0070670_100335328 3300005331 Bacteria 1327
6 Ga0070670_100355186 3300005331 Bacteria 1288
7 Ga0068869_100676158 3300005334 Unclassified 878
8 Ga0070682_101910207 3300005337 Unclassified 520
9 Ga0070671_100399058 3300005355 Bacteria 1176
10 Ga0070673_101654016 3300005364 Unclassified 605
11 Ga0070663_101428393 3300005455 Unclassified 613
12 Ga0070678_101465491 3300005456 Unclassified 638
13 Ga0070662_101969626 3300005457 Unclassified 505
14 Ga0070681_10566929 3300005458 Unclassified 1049
15 Ga0070681_10712162 3300005458 Unclassified 920
16 Ga0070679_100821852 3300005530 Bacteria 872
17 Ga0070665_101399842 3300005548 Unclassified 708
18 Ga0068855_100303872 3300005563 Unclassified 1766
19 Ga0068855_102368393 3300005563 Unclassified 530
20 Ga0070664_100186360 3300005564 Bacteria 1847
21 Ga0068857_100098693 3300005577 Bacteria 2620
22 Ga0068857_100876657 3300005577 Unclassified 860
23 Ga0068856_100190436 3300005614 Unclassified 2065
24 Ga0070702_101362870 3300005615 Unclassified 578
25 Ga0068852_100287455 3300005616 Unclassified 1587
26 Ga0068864_100318652 3300005618 Unclassified 1460
27 Ga0068864_101515328 3300005618 Unclassified 674
28 Ga0068863_100439167 3300005841 Unclassified 1280
29 Ga0070715_10786218 3300006163 Unclassified 576
30 Ga0105241_10584510 3300009174 Unclassified 1007
31 Ga0105241_10766395 3300009174 Unclassified 886
32 Ga0105241_11619515 3300009174 Bacteria 627
33 Ga0105248_10100233 3300009177 Bacteria 3264
34 Ga0105248_11345108 3300009177 Unclassified 808
35 Ga0105248_11433443 3300009177 Bacteria 782
36 Ga0105237_11212961 3300009545 Unclassified 761
37 Ga0105238_10863757 3300009551 Unclassified 922
38 Ga0105238_12152555 3300009551 Unclassified 592
39 Ga0105239_10685636 3300010375 Unclassified 1171
40 Ga0157374_10180743 3300013296 Bacteria 2060
41 Ga0163163_10004519 3300014325 Bacteria 11869
42 Ga0163163_10055168 3300014325 Bacteria 3927
43 Ga0163163_11753834 3300014325 Bacteria 681
44 Ga0207685_10635240 3300025905 Unclassified 576
45 Ga0207654_10148709 3300025911 Bacteria 1501
46 Ga0207707_10738000 3300025912 Bacteria 824
47 Ga0207694_10606595 3300025924 Bacteria 921
48 Ga0207650_11252159 3300025925 Bacteria 631
49 Ga0207650_11829740 3300025925 Unclassified 513
50 Ga0207661_10221726 3300025944 Bacteria 1672
51 Ga0207679_10145577 3300025945 Bacteria 1921
52 Ga0207679_12195547 3300025945 Bacteria 501
53 Ga0207667_10277029 3300025949 Bacteria 1714
54 Ga0207677_10363201 3300026023 Bacteria 1217
55 Ga0207702_10322361 3300026078 Unclassified 1472
56 Ga0207641_10129507 3300026088 Unclassified 2264
57 Ga0207641_12252449 3300026088 Bacteria 545
58 Ga0207676_10083094 3300026095 Unclassified 2607
59 Ga0207676_11186909 3300026095 Bacteria 756
60 Ga0207674_10129553 3300026116 Unclassified 2487
61 Ga0207683_10850173 3300026121 Unclassified 847
62 Ga0265334_10081749 3300028573 Unclassified 1189
63 Ga0265323_10004543 3300028653 Bacteria 5975
64 Ga0265338_10116751 3300028800 Bacteria 2137
65 Ga0265330_10105237 3300031235 Unclassified 1207
66 Ga0265330_10153620 3300031235 Unclassified 978
67 Ga0265332_10138596 3300031238 Bacteria 1020
68 Ga0265320_10143951 3300031240 Unclassified 1078
69 Ga0265325_10001767 3300031241 Bacteria 14980
70 Ga0265329_10047409 3300031242 Bacteria 1371
71 Ga0265340_10000722 3300031247 Bacteria 18732
72 Ga0265339_10019329 3300031249 Bacteria 4003
73 Ga0265331_10004551 3300031250 Bacteria 8640
74 Ga0265331_10217429 3300031250 Bacteria 859
75 Ga0265331_10330974 3300031250 Unclassified 682
76 Ga0265316_10002864 3300031344 Bacteria 17655
77 Ga0265316_10052043 3300031344 Bacteria 3214
78 Ga0265313_10061506 3300031595 Bacteria 1757
79 Ga0316575_10005765 3300031665 Bacteria 4421
80 Ga0316575_10095268 3300031665 Bacteria 1208
81 Ga0316575_10295793 3300031665 Bacteria 684
82 Ga0316575_10386397 3300031665 Bacteria 599
83 Ga0316575_10497161 3300031665 Unclassified 529
84 Ga0316575_10506948 3300031665 Bacteria 524
85 Ga0316579_10047609 3300031691 Bacteria 2002
86 Ga0316579_10098773 3300031691 Bacteria 1397
87 Ga0316579_10134876 3300031691 Bacteria 1189
88 Ga0316579_10201300 3300031691 Bacteria 963
89 Ga0316579_10252347 3300031691 Bacteria 853
90 Ga0316579_10300935 3300031691 Unclassified 775
91 Ga0316579_10631007 3300031691 Bacteria 519
92 Ga0316579_10668226 3300031691 Bacteria 503
93 Ga0265314_10000086 3300031711 Bacteria 139471
94 Ga0265314_10003535 3300031711 Bacteria 15095
95 Ga0265314_10032835 3300031711 Bacteria 3813
96 Ga0265342_10000599 3300031712 Bacteria 38079
97 Ga0316576_10000166 3300031727 Bacteria 26816
98 Ga0316576_10001836 3300031727 Bacteria 11780
99 Ga0316576_10001920 3300031727 Bacteria 11587
100 Ga0316576_10002773 3300031727 Bacteria 10062
101 Ga0316576_10007009 3300031727 Bacteria 7056
102 Ga0316576_10020156 3300031727 Bacteria 4581
103 Ga0316576_10037079 3300031727 Bacteria 3488
104 Ga0316576_10072712 3300031727 Bacteria 2539
105 Ga0316576_10129888 3300031727 Bacteria 1895
106 Ga0316576_10137712 3300031727 Bacteria 1837
107 Ga0316576_10166865 3300031727 Bacteria 1661
108 Ga0316576_10236703 3300031727 Bacteria 1372
109 Ga0316576_10255241 3300031727 Bacteria 1316
110 Ga0316576_10313468 3300031727 Bacteria 1171
111 Ga0316576_10362239 3300031727 Bacteria 1078
112 Ga0316576_10407590 3300031727 Unclassified 1007
113 Ga0316576_10423523 3300031727 Bacteria 985
114 Ga0316576_11015524 3300031727 Bacteria 590
115 Ga0316576_11079697 3300031727 Bacteria 570
116 Ga0316576_11264838 3300031727 Bacteria 520
117 Ga0316576_11325373 3300031727 Bacteria 506
118 Ga0316576_11348838 3300031727 Unclassified 501
119 Ga0316578_10000591 3300031728 Bacteria 12648
120 Ga0316578_10001040 3300031728 Bacteria 10683
121 Ga0316578_10010189 3300031728 Bacteria 4868
122 Ga0316578_10019033 3300031728 Bacteria 3773
123 Ga0316578_10039815 3300031728 Bacteria 2715
124 Ga0316578_10045858 3300031728 Bacteria 2546
125 Ga0316578_10050155 3300031728 Bacteria 2441
126 Ga0316578_10069409 3300031728 Bacteria 2085
127 Ga0316578_10251120 3300031728 Bacteria 1061
128 Ga0316578_10320828 3300031728 Unclassified 925
129 Ga0316578_10352294 3300031728 Bacteria 876
130 Ga0316578_10417707 3300031728 Bacteria 794
131 Ga0316578_10475976 3300031728 Bacteria 737
132 Ga0316578_10516343 3300031728 Bacteria 703
133 Ga0316578_10553061 3300031728 Bacteria 676
134 Ga0316578_10599607 3300031728 Bacteria 645
135 Ga0316578_10600236 3300031728 Bacteria 645
136 Ga0316578_10747466 3300031728 Unclassified 568
137 Ga0316578_10761465 3300031728 Bacteria 562
138 Ga0316578_10882215 3300031728 Unclassified 517
139 Ga0316577_10000346 3300031733 Bacteria 17315
140 Ga0316577_10008611 3300031733 Bacteria 5472
141 Ga0316577_10012849 3300031733 Bacteria 4569
142 Ga0316577_10393604 3300031733 Bacteria 787
143 Ga0316577_10617913 3300031733 Unclassified 616
144 Ga0316577_10744066 3300031733 Bacteria 556
145 Ga0316577_10834501 3300031733 Bacteria 523
146 Ga0316583_10000112 3300032133 Bacteria 18727
147 Ga0316583_10001343 3300032133 Bacteria 8140
148 Ga0316583_10010429 3300032133 Bacteria 3350
149 Ga0316583_10028336 3300032133 Bacteria 1998
150 Ga0316583_10046312 3300032133 Unclassified 1535
151 Ga0316583_10064827 3300032133 Bacteria 1279
152 Ga0316583_10071342 3300032133 Unclassified 1215
153 Ga0316583_10071434 3300032133 Bacteria 1214
154 Ga0316583_10073355 3300032133 Bacteria 1197
155 Ga0316583_10088393 3300032133 Bacteria 1081
156 Ga0316583_10183322 3300032133 Bacteria 728
157 Ga0316583_10191723 3300032133 Bacteria 710
158 Ga0316585_10010365 3300032137 Bacteria 2734
159 Ga0316585_10035228 3300032137 Bacteria 1585
160 Ga0316585_10058743 3300032137 Bacteria 1240
161 Ga0316585_10060931 3300032137 Bacteria 1219
162 Ga0316585_10094923 3300032137 Bacteria 976
163 Ga0316580_10014256 3300032139 Bacteria 2427
164 Ga0316580_10119659 3300032139 Bacteria 806
165 Ga0316580_10125583 3300032139 Unclassified 786
166 Ga0316580_10129145 3300032139 Bacteria 775
167 Ga0316593_10084741 3300032168 Bacteria 1110
168 Ga0316593_10172619 3300032168 Bacteria 793
169 Ga0316593_10214140 3300032168 Bacteria 714
170 Ga0316593_10273726 3300032168 Unclassified 635
171 Ga0316593_10408047 3300032168 Bacteria 526
172 Ga0316592_1051316 3300033524 Bacteria 921
173 Ga0316592_1115278 3300033524 Unclassified 622
174 Ga0316592_1127347 3300033524 Unclassified 593
175 Ga0316592_1133515 3300033524 Bacteria 580
176 Ga0316592_1143581 3300033524 Bacteria 561
177 Ga0316592_1147830 3300033524 Bacteria 553
178 Ga0316592_1150275 3300033524 Unclassified 549
179 Ga0316592_1167455 3300033524 Bacteria 523
180 Ga0316592_1168841 3300033524 Bacteria 521
181 Ga0316592_1174857 3300033524 Unclassified 512
182 Ga0316592_1176515 3300033524 Bacteria 510
183 Ga0316592_1181675 3300033524 Bacteria 503
184 Ga0316586_1000614 3300033527 Bacteria 3553
185 Ga0316586_1004525 3300033527 Bacteria 1906
186 Ga0316586_1013635 3300033527 Bacteria 1273
187 Ga0316586_1032428 3300033527 Unclassified 899
188 Ga0316586_1050613 3300033527 Unclassified 743
189 Ga0316586_1053755 3300033527 Unclassified 723
190 Ga0316586_1062513 3300033527 Unclassified 678
191 Ga0316586_1067084 3300033527 Bacteria 658
192 Ga0316586_1068745 3300033527 Unclassified 650
193 Ga0316586_1099384 3300033527 Bacteria 555
194 Ga0316586_1099511 3300033527 Unclassified 555
195 Ga0316586_1122431 3300033527 Unclassified 508
196 Ga0316586_1124656 3300033527 Bacteria 504
197 Ga0316588_1000734 3300033528 Bacteria 4838
198 Ga0316588_1004280 3300033528 Bacteria 2688
199 Ga0316588_1056239 3300033528 Unclassified 957
200 Ga0316588_1075787 3300033528 Bacteria 829
201 Ga0316588_1077560 3300033528 Bacteria 820
202 Ga0316588_1092519 3300033528 Bacteria 754
203 Ga0316588_1092929 3300033528 Bacteria 752
204 Ga0316588_1096038 3300033528 Unclassified 740
205 Ga0316588_1098975 3300033528 Unclassified 729
206 Ga0316588_1107141 3300033528 Unclassified 702
207 Ga0316588_1109814 3300033528 Bacteria 694
208 Ga0316588_1122851 3300033528 Bacteria 657
209 Ga0316588_1127199 3300033528 Unclassified 647
210 Ga0316588_1128405 3300033528 Bacteria 644
211 Ga0316588_1129873 3300033528 Bacteria 640
212 Ga0316588_1133746 3300033528 Bacteria 631
213 Ga0316588_1135247 3300033528 Unclassified 628
214 Ga0316588_1170049 3300033528 Bacteria 563
215 Ga0316588_1170206 3300033528 Unclassified 563
216 Ga0316588_1174479 3300033528 Bacteria 556
217 Ga0316588_1174779 3300033528 Bacteria 556
218 Ga0316588_1176847 3300033528 Unclassified 553
219 Ga0316588_1188064 3300033528 Bacteria 538
220 Ga0316588_1190358 3300033528 Bacteria 535
221 Ga0316588_1195536 3300033528 Bacteria 528
222 Ga0316588_1202953 3300033528 Bacteria 519
223 Ga0316588_1216295 3300033528 Bacteria 503
224 Ga0316588_1217774 3300033528 Bacteria 502
225 Ga0316588_1218335 3300033528 Bacteria 501
226 Ga0316588_1219529 3300033528 Bacteria 500
227 Ga0316587_1000350 3300033529 Bacteria 4399
228 Ga0316587_1014145 3300033529 Bacteria 1315
229 Ga0316587_1014470 3300033529 Bacteria 1302
230 Ga0316587_1027807 3300033529 Bacteria 990
231 Ga0316587_1033596 3300033529 Bacteria 912
232 Ga0316587_1069757 3300033529 Unclassified 657
233 Ga0316587_1070693 3300033529 Bacteria 653
234 Ga0316587_1077047 3300033529 Unclassified 628
235 Ga0316587_1081232 3300033529 Unclassified 613
236 Ga0316587_1085817 3300033529 Bacteria 598
237 Ga0316587_1093927 3300033529 Unclassified 574
238 Ga0316587_1095826 3300033529 Bacteria 569
239 Ga0316587_1109745 3300033529 Unclassified 535
240 Ga0316587_1116992 3300033529 Unclassified 520
241 Ga0316587_1117818 3300033529 Unclassified 519
242 Ga0316587_1119685 3300033529 Unclassified 515
243 Ga0316587_1125822 3300033529 Unclassified 504
244 Ga0316587_1125980 3300033529 Bacteria 504
245 Ga0316596_1007655 3300033541 Bacteria 2557
246 Ga0316596_1076661 3300033541 Bacteria 897
247 Ga0316596_1086027 3300033541 Bacteria 846
248 Ga0316596_1115976 3300033541 Unclassified 728
249 Ga0316596_1128051 3300033541 Bacteria 692
250 Ga0316596_1150699 3300033541 Unclassified 639
251 Ga0316596_1150959 3300033541 Bacteria 638
252 Ga0316596_1151143 3300033541 Bacteria 638
253 Ga0316596_1177409 3300033541 Bacteria 589
254 Ga0316596_1181036 3300033541 Bacteria 583
255 Ga0316596_1182633 3300033541 Bacteria 581
256 Ga0316596_1182759 3300033541 Bacteria 581
257 Ga0316596_1248638 3300033541 Unclassified 501
258 Ga0316574_0005266 3300035398 Bacteria 6885
259 Ga0316574_0018850 3300035398 Bacteria 4063
260 Ga0316574_0019246 3300035398 Bacteria 4024
261 Ga0316574_0036144 3300035398 Bacteria 3023
262 Ga0316574_0098507 3300035398 Bacteria 1870
263 Ga0316574_0162494 3300035398 Bacteria 1438
264 Ga0316574_0340550 3300035398 Bacteria 950
265 Ga0316574_0345271 3300035398 Unclassified 942
266 Ga0316574_0527141 3300035398 Unclassified 735
267 Ga0316574_0578782 3300035398 Unclassified 695
268 Ga0316574_0640176 3300035398 Unclassified 655
269 Ga0316574_0677645 3300035398 Bacteria 633
270 Ga0373935_0530307 3300035692 Bacteria 857
271 Ga0316582_0004340 3300036647 Bacteria 7143
272 Ga0316582_0005912 3300036647 Bacteria 6365
273 Ga0316582_0010697 3300036647 Bacteria 5036
274 Ga0316582_0031503 3300036647 Bacteria 3242
275 Ga0316582_0119694 3300036647 Bacteria 1761
276 Ga0316582_0200714 3300036647 Bacteria 1361
277 Ga0316582_0221184 3300036647 Unclassified 1295
278 Ga0316582_0248394 3300036647 Bacteria 1219
279 Ga0316582_0269771 3300036647 Bacteria 1167
280 Ga0316582_0428142 3300036647 Bacteria 912
281 Ga0316582_0457258 3300036647 Bacteria 880
282 Ga0316582_0540323 3300036647 Unclassified 803
283 Ga0316582_0602827 3300036647 Bacteria 756
284 Ga0316582_0723896 3300036647 Bacteria 683
285 Ga0316582_0934193 3300036647 Unclassified 593
286 Ga0316582_1052082 3300036647 Bacteria 555
287 Ga0316582_1163910 3300036647 Unclassified 525
288 Ga0316582_1232999 3300036647 Bacteria 509
289 Ga0316582_1256068 3300036647 Bacteria 504
290 Ga0316584_0000574 3300036712 Bacteria 19837
291 Ga0316584_0004410 3300036712 Bacteria 9318
292 Ga0316584_0005667 3300036712 Bacteria 8404
293 Ga0316584_0010884 3300036712 Bacteria 6373
294 Ga0316584_0026747 3300036712 Bacteria 4243
295 Ga0316584_0053676 3300036712 Bacteria 3016
296 Ga0316584_0132511 3300036712 Bacteria 1861
297 Ga0316584_0187658 3300036712 Bacteria 1529
298 Ga0316584_0202694 3300036712 Bacteria 1463
299 Ga0316584_0210702 3300036712 Unclassified 1430
300 Ga0316584_0324185 3300036712 Bacteria 1111
301 Ga0316584_0379139 3300036712 Bacteria 1011
302 Ga0316584_0398615 3300036712 Unclassified 981
303 Ga0316584_0677383 3300036712 Unclassified 709
304 Ga0316584_0804461 3300036712 Bacteria 638
305 Ga0395898_1051643 3300037466 Bacteria 749
306 Ga0316581_0004795 3300037588 Bacteria 3481
307 Ga0316581_0052490 3300037588 Bacteria 1249
308 Ga0316581_0180953 3300037588 Bacteria 650
309 Ga0400490_22447 3300038726 Bacteria 76643
310 Ga0400491_09790 3300038727 Unclassified 1625
311 Ga0400491_15598 3300038727 Bacteria 1276
312 Ga0400486_15255 3300038742 Bacteria 1128
313 Ga0400489_36395 3300039093 Bacteria 1687
314 Ga0400487_52849 3300039110 Bacteria 1529
315 Ga0451795_0712639 3300041456 Bacteria 773
316 Ga0451852_28266 3300041508 Bacteria 1721
317 Ga0451577_0011924 3300042876 Bacteria 8195
318 Ga0451577_0088364 3300042876 Bacteria 2765
319 Ga0451577_0392968 3300042876 Unclassified 1259
320 Ga0453683_0081738 3300044673 Unclassified 2024
321 Ga0453683_0119865 3300044673 Unclassified 1656
322 Ga0453683_0369727 3300044673 Unclassified 922
323 Ga0453683_0401666 3300044673 Unclassified 883
324 Ga0453684_0001209 3300044712 Bacteria 79474
325 Ga0453684_0036729 3300044712 Bacteria 6745
326 Ga0453684_0177541 3300044712 Bacteria 2503
327 Ga0453684_0195713 3300044712 Unclassified 2361
328 Ga0453684_0265500 3300044712 Bacteria 1964
329 Ga0453684_0356312 3300044712 Bacteria 1648
330 Ga0453684_0536941 3300044712 Bacteria 1290
331 Ga0453684_0572657 3300044712 Bacteria 1241
332 Ga0453684_1086322 3300044712 Bacteria 846
333 Ga0453684_2164580 3300044712 Bacteria 556
334 Ga0453684_2493041 3300044712 Unclassified 510
335 Ga0466971_0668113 3300044719 Bacteria 521
336 Ga0451576_0619720 3300045051 Bacteria 1137
337 Ga0451576_0872559 3300045051 Bacteria 944
338 Ga0451576_0929850 3300045051 Unclassified 912
339 Ga0495669_0059738 3300046684 Bacteria 1722
340 Ga0496105_1209634 3300048908 Unclassified 556
341 Ga0496108_0056285 3300048911 Bacteria 3304
342 Ga0496109_0113635 3300048912 Bacteria 2519
343 Ga0496112_0061189 3300048915 Bacteria 3711
344 Ga0496113_0385202 3300048916 Unclassified 1125
345 Ga0501031_0475051 3300049568 Bacteria 807
346 Ga0501031_0549190 3300049568 Bacteria 744
347 Ga0501036_0148536 3300049572 Bacteria 1977
348 Ga0501039_1057743 3300049575 Bacteria 630
349 Ga0501041_0138190 3300049577 Bacteria 1519
350 Ga0501042_0296439 3300049578 Bacteria 1168
351 Ga0501048_0517388 3300049582 Bacteria 856
352 Ga0501074_0343003 3300049590 Bacteria 1060
353 Ga0501075_0637759 3300049591 Bacteria 812
354 Ga0501080_0450714 3300049742 Bacteria 1154
355 Ga0501081_0150254 3300049743 Bacteria 1673
356 Ga0501081_0368540 3300049743 Bacteria 1060
357 Ga0501035_0527241 3300049822 Bacteria 970
358 Ga0501035_0656582 3300049822 Bacteria 850
359 Ga0501045_0097676 3300049824 Bacteria 2173
360 Ga0501045_0699505 3300049824 Unclassified 748
361 Ga0501084_0313965 3300054114 Bacteria 1324
362 Ga0316583_10210060
363 Ga0065712_10416724
364 Ga0070658_11189448
365 Ga0070683_100239705
366 Ga0070670_100335328
367 Ga0070670_100355186
368 Ga0068869_100676158
369 Ga0070682_101910207
370 Ga0070671_100399058
371 Ga0070673_101654016
372 Ga0070663_101428393
373 Ga0070678_101465491
374 Ga0070662_101969626
375 Ga0070681_10566929
376 Ga0070681_10712162
377 Ga0070679_100821852
378 Ga0070665_101399842
379 Ga0068855_100303872
380 Ga0068855_102368393
381 Ga0070664_100186360
382 Ga0068857_100098693
383 Ga0068857_100876657
384 Ga0068856_100190436
385 Ga0070702_101362870
386 Ga0068852_100287455
387 Ga0068864_100318652
388 Ga0068864_101515328
389 Ga0068863_100439167
390 Ga0070715_10786218
391 Ga0105241_10584510
392 Ga0105241_10766395
393 Ga0105241_11619515
394 Ga0105248_10100233
395 Ga0105248_11345108
396 Ga0105248_11433443
397 Ga0105237_11212961
398 Ga0105238_10863757
399 Ga0105238_12152555
400 Ga0105239_10685636
401 Ga0157374_10180743
402 Ga0163163_10004519
403 Ga0163163_10055168
404 Ga0163163_11753834
405 Ga0207685_10635240
406 Ga0207654_10148709
407 Ga0207707_10738000
408 Ga0207694_10606595
409 Ga0207650_11252159
410 Ga0207650_11829740
411 Ga0207661_10221726
412 Ga0207679_10145577
413 Ga0207679_12195547
414 Ga0207667_10277029
415 Ga0207677_10363201
416 Ga0207702_10322361
417 Ga0207641_10129507
418 Ga0207641_12252449
419 Ga0207676_10083094
420 Ga0207676_11186909
421 Ga0207674_10129553
422 Ga0207683_10850173
423 Ga0265334_10081749
424 Ga0265323_10004543
425 Ga0265338_10116751
426 Ga0265330_10105237
427 Ga0265330_10153620
428 Ga0265332_10138596
429 Ga0265320_10143951
430 Ga0265325_10001767
431 Ga0265329_10047409
432 Ga0265340_10000722
433 Ga0265339_10019329
434 Ga0265331_10004551
435 Ga0265331_10217429
436 Ga0265331_10330974
437 Ga0265316_10002864
438 Ga0265316_10052043
439 Ga0265313_10061506
440 Ga0316575_10005765
441 Ga0316575_10095268
442 Ga0316575_10295793
443 Ga0316575_10386397
444 Ga0316575_10497161
445 Ga0316575_10506948
446 Ga0316579_10047609
447 Ga0316579_10098773
448 Ga0316579_10134876
449 Ga0316579_10201300
450 Ga0316579_10252347
451 Ga0316579_10300935
452 Ga0316579_10631007
453 Ga0316579_10668226
454 Ga0265314_10000086
455 Ga0265314_10003535
456 Ga0265314_10032835
457 Ga0265342_10000599
458 Ga0316576_10000166
459 Ga0316576_10001836
460 Ga0316576_10001920
461 Ga0316576_10002773
462 Ga0316576_10007009
463 Ga0316576_10020156
464 Ga0316576_10037079
465 Ga0316576_10072712
466 Ga0316576_10129888
467 Ga0316576_10137712
468 Ga0316576_10166865
469 Ga0316576_10236703
470 Ga0316576_10255241
471 Ga0316576_10313468
472 Ga0316576_10362239
473 Ga0316576_10407590
474 Ga0316576_10423523
475 Ga0316576_11015524
476 Ga0316576_11079697
477 Ga0316576_11264838
478 Ga0316576_11325373
479 Ga0316576_11348838
480 Ga0316578_10000591
481 Ga0316578_10001040
482 Ga0316578_10010189
483 Ga0316578_10019033
484 Ga0316578_10039815
485 Ga0316578_10045858
486 Ga0316578_10050155
487 Ga0316578_10069409
488 Ga0316578_10251120
489 Ga0316578_10320828
490 Ga0316578_10352294
491 Ga0316578_10417707
492 Ga0316578_10475976
493 Ga0316578_10516343
494 Ga0316578_10553061
495 Ga0316578_10599607
496 Ga0316578_10600236
497 Ga0316578_10747466
498 Ga0316578_10761465
499 Ga0316578_10882215
500 Ga0316577_10000346
501 Ga0316577_10008611
502 Ga0316577_10012849
503 Ga0316577_10393604
504 Ga0316577_10617913
505 Ga0316577_10744066
506 Ga0316577_10834501
507 Ga0316583_10000112
508 Ga0316583_10001343
509 Ga0316583_10010429
510 Ga0316583_10028336
511 Ga0316583_10046312
512 Ga0316583_10064827
513 Ga0316583_10071342
514 Ga0316583_10071434
515 Ga0316583_10073355
516 Ga0316583_10088393
517 Ga0316583_10183322
518 Ga0316583_10191723
519 Ga0316585_10010365
520 Ga0316585_10035228
521 Ga0316585_10058743
522 Ga0316585_10060931
523 Ga0316585_10094923
524 Ga0316580_10014256
525 Ga0316580_10119659
526 Ga0316580_10125583
527 Ga0316580_10129145
528 Ga0316593_10084741
529 Ga0316593_10172619
530 Ga0316593_10214140
531 Ga0316593_10273726
532 Ga0316593_10408047
533 Ga0316592_1051316
534 Ga0316592_1115278
535 Ga0316592_1127347
536 Ga0316592_1133515
537 Ga0316592_1143581
538 Ga0316592_1147830
539 Ga0316592_1150275
540 Ga0316592_1167455
541 Ga0316592_1168841
542 Ga0316592_1174857
543 Ga0316592_1176515
544 Ga0316592_1181675
545 Ga0316586_1000614
546 Ga0316586_1004525
547 Ga0316586_1013635
548 Ga0316586_1032428
549 Ga0316586_1050613
550 Ga0316586_1053755
551 Ga0316586_1062513
552 Ga0316586_1067084
553 Ga0316586_1068745
554 Ga0316586_1099384
555 Ga0316586_1099511
556 Ga0316586_1122431
557 Ga0316586_1124656
558 Ga0316588_1000734
559 Ga0316588_1004280
560 Ga0316588_1056239
561 Ga0316588_1075787
562 Ga0316588_1077560
563 Ga0316588_1092519
564 Ga0316588_1092929
565 Ga0316588_1096038
566 Ga0316588_1098975
567 Ga0316588_1107141
568 Ga0316588_1109814
569 Ga0316588_1122851
570 Ga0316588_1127199
571 Ga0316588_1128405
572 Ga0316588_1129873
573 Ga0316588_1133746
574 Ga0316588_1135247
575 Ga0316588_1170049
576 Ga0316588_1170206
577 Ga0316588_1174479
578 Ga0316588_1174779
579 Ga0316588_1176847
580 Ga0316588_1188064
581 Ga0316588_1190358
582 Ga0316588_1195536
583 Ga0316588_1202953
584 Ga0316588_1216295
585 Ga0316588_1217774
586 Ga0316588_1218335
587 Ga0316588_1219529
588 Ga0316587_1000350
589 Ga0316587_1014145
590 Ga0316587_1014470
591 Ga0316587_1027807
592 Ga0316587_1033596
593 Ga0316587_1069757
594 Ga0316587_1070693
595 Ga0316587_1077047
596 Ga0316587_1081232
597 Ga0316587_1085817
598 Ga0316587_1093927
599 Ga0316587_1095826
600 Ga0316587_1109745
601 Ga0316587_1116992
602 Ga0316587_1117818
603 Ga0316587_1119685
604 Ga0316587_1125822
605 Ga0316587_1125980
606 Ga0316596_1007655
607 Ga0316596_1076661
608 Ga0316596_1086027
609 Ga0316596_1115976
610 Ga0316596_1128051
611 Ga0316596_1150699
612 Ga0316596_1150959
613 Ga0316596_1151143
614 Ga0316596_1177409
615 Ga0316596_1181036
616 Ga0316596_1182633
617 Ga0316596_1182759
618 Ga0316596_1248638
619 Ga0316574_0005266
620 Ga0316574_0018850
621 Ga0316574_0019246
622 Ga0316574_0036144
623 Ga0316574_0098507
624 Ga0316574_0162494
625 Ga0316574_0340550
626 Ga0316574_0345271
627 Ga0316574_0527141
628 Ga0316574_0578782
629 Ga0316574_0640176
630 Ga0316574_0677645
631 Ga0373935_0530307
632 Ga0316582_0004340
633 Ga0316582_0005912
634 Ga0316582_0010697
635 Ga0316582_0031503
636 Ga0316582_0119694
637 Ga0316582_0200714
638 Ga0316582_0221184
639 Ga0316582_0248394
640 Ga0316582_0269771
641 Ga0316582_0428142
642 Ga0316582_0457258
643 Ga0316582_0540323
644 Ga0316582_0602827
645 Ga0316582_0723896
646 Ga0316582_0934193
647 Ga0316582_1052082
648 Ga0316582_1163910
649 Ga0316582_1232999
650 Ga0316582_1256068
651 Ga0316584_0000574
652 Ga0316584_0004410
653 Ga0316584_0005667
654 Ga0316584_0010884
655 Ga0316584_0026747
656 Ga0316584_0053676
657 Ga0316584_0132511
658 Ga0316584_0187658
659 Ga0316584_0202694
660 Ga0316584_0210702
661 Ga0316584_0324185
662 Ga0316584_0379139
663 Ga0316584_0398615
664 Ga0316584_0677383
665 Ga0316584_0804461
666 Ga0395898_1051643
667 Ga0316581_0004795
668 Ga0316581_0052490
669 Ga0316581_0180953
670 Ga0400490_22447
671 Ga0400491_09790
672 Ga0400491_15598
673 Ga0400486_15255
674 Ga0400489_36395
675 Ga0400487_52849
676 Ga0451795_0712639
677 Ga0451852_28266
678 Ga0451577_0011924
679 Ga0451577_0088364
680 Ga0451577_0392968
681 Ga0453683_0081738
682 Ga0453683_0119865
683 Ga0453683_0369727
684 Ga0453683_0401666
685 Ga0453684_0001209
686 Ga0453684_0036729
687 Ga0453684_0177541
688 Ga0453684_0195713
689 Ga0453684_0265500
690 Ga0453684_0356312
691 Ga0453684_0536941
692 Ga0453684_0572657
693 Ga0453684_1086322
694 Ga0453684_2164580
695 Ga0453684_2493041
696 Ga0466971_0668113
697 Ga0451576_0619720
698 Ga0451576_0872559
699 Ga0451576_0929850
700 Ga0495669_0059738
701 Ga0496105_1209634
702 Ga0496108_0056285
703 Ga0496109_0113635
704 Ga0496112_0061189
705 Ga0496113_0385202
706 Ga0501031_0475051
707 Ga0501031_0549190
708 Ga0501036_0148536
709 Ga0501039_1057743
710 Ga0501041_0138190
711 Ga0501042_0296439
712 Ga0501048_0517388
713 Ga0501074_0343003
714 Ga0501075_0637759
715 Ga0501080_0450714
716 Ga0501081_0150254
717 Ga0501081_0368540
718 Ga0501035_0527241
719 Ga0501035_0656582
720 Ga0501045_0097676
721 Ga0501045_0699505
722 Ga0501084_0313965

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04358

DsrC

DsrC like protein

5

104

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jhh-assembly1.cif.gz_A lexa s119a mutant 0.9466 41 74
2v4j-assembly1.cif.gz_F the crystal structure of desulfovibrio vulgaris dissimilatory sulfite reductase bound to dsrc provides novel insights into the mechanism of sulfate respiration 0.9332 4 105
3or1-assembly1.cif.gz_F crystal structure of dissimilatory sulfite reductase i (dsri) 0.9248 2 105
3or2-assembly1.cif.gz_F crystal structure of dissimilatory sulfite reductase ii (dsrii) 0.9236 2 105
2xsj-assembly1.cif.gz_F structure of desulforubidin from desulfomicrobium norvegicum 0.9197 2 105
ID Description Score Start End Superfamily
1jhhA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9466 41 74 1.10.10.10
3or1F02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DsrC protein, C-terminal domain 0.9431 43 105 1.10.10.370
2v4jF02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DsrC protein, C-terminal domain 0.9353 43 105 1.10.10.370
3or1F02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DsrC protein, C-terminal domain 0.9147 43 105 1.10.10.370
af_Q6ZHH2_135_223_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9138 46 71 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7C2J3U7-F1-model_v4 deleted 0.9757 1 85
AF-A0A1F9MX02-F1-model_v4 Sulfurtransferase TusE 0.9741 1 100 GO:0002143
GO:0005737
GO:0016740
GO:0097163
AF-A0A523BH78-F1-model_v4 Sulfurtransferase TusE 0.9708 1 105 GO:0002143
GO:0005737
GO:0016740
GO:0097163
AF-A0A7V1ZV15-F1-model_v4 Uncharacterized protein 0.9689 41 99 GO:0005737
AF-A0A1F9MX02-F1-model_v4 Sulfurtransferase TusE 0.9647 1 100 GO:0002143
GO:0005737
GO:0016740
GO:0097163

Map