F422246

General Info

Members Datasets Scaffolds Average Seq Length
361 254 722 87

Family's Representative Sequence

Representative Sequence 3300025918|Ga0207662_10802454|Ga0207662_108024541
Length 97
Sequence MLASNADNPITTAIAIYFLIWWIVLFAVLPWGARAQDEDSPPGTDPGAPRVPRLRAKLIWTTIVSGVVWTLCAWVYVKGLVTIDGLSALLGFPAQNQ

Samples

Sample ID Description Type Environment
1 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
96 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
137 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
140 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
141 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
147 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
157 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
158 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
159 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
160 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
195 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
233 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.14
Nodule 0
Rhizoplane 3.6
Rhizosphere 84.49
Stem 0
Stem Tuber 0
Unclassified 1.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207662_10802454 3300025918 Bacteria 663
2 JGI25406J46586_10080307 3300003203 Bacteria 1002
3 Ga0065712_10018484 3300005290 Bacteria 2386
4 Ga0065715_10689123 3300005293 Bacteria 659
5 Ga0070658_10519783 3300005327 Bacteria 1029
6 Ga0070676_10516426 3300005328 Bacteria 850
7 Ga0070683_100231230 3300005329 Bacteria 1758
8 Ga0070683_100697648 3300005329 Bacteria 972
9 Ga0070690_101517381 3300005330 Bacteria 542
10 Ga0070670_100053338 3300005331 Bacteria 3473
11 Ga0070670_100221831 3300005331 Bacteria 1645
12 Ga0070670_100858430 3300005331 Bacteria 821
13 Ga0070677_10788203 3300005333 Bacteria 542
14 Ga0070666_10146004 3300005335 Bacteria 1649
15 Ga0070666_10420315 3300005335 Bacteria 963
16 Ga0070680_100089704 3300005336 Bacteria 2544
17 Ga0068868_100242147 3300005338 Bacteria 1516
18 Ga0068868_100801300 3300005338 Bacteria 850
19 Ga0070689_100257502 3300005340 Bacteria 1441
20 Ga0070689_100549533 3300005340 Bacteria 995
21 Ga0070691_10264594 3300005341 Bacteria 927
22 Ga0070691_10565826 3300005341 Bacteria 666
23 Ga0070691_10655264 3300005341 Unclassified 626
24 Ga0070661_100215930 3300005344 Bacteria 1469
25 Ga0070661_101090822 3300005344 Bacteria 665
26 Ga0070668_100665513 3300005347 Bacteria 916
27 Ga0070668_101843352 3300005347 Bacteria 557
28 Ga0070669_100214848 3300005353 Bacteria 1519
29 Ga0070669_101274933 3300005353 Bacteria 636
30 Ga0070675_100697363 3300005354 Bacteria 924
31 Ga0070675_101118328 3300005354 Bacteria 724
32 Ga0070671_100333278 3300005355 Bacteria 1293
33 Ga0070674_100040185 3300005356 Bacteria 3163
34 Ga0070674_102029920 3300005356 Bacteria 524
35 Ga0070673_100022515 3300005364 Bacteria 4587
36 Ga0070673_101752787 3300005364 Bacteria 588
37 Ga0070673_102269479 3300005364 Bacteria 516
38 Ga0070688_100033743 3300005365 Bacteria 3095
39 Ga0070688_101242572 3300005365 Bacteria 600
40 Ga0070714_100236607 3300005435 Bacteria 1684
41 Ga0070713_100136566 3300005436 Bacteria 2167
42 Ga0070701_10519744 3300005438 Bacteria 776
43 Ga0070711_100040930 3300005439 Bacteria 3127
44 Ga0070705_101208253 3300005440 Bacteria 623
45 Ga0070663_101635942 3300005455 Bacteria 575
46 Ga0070678_100111164 3300005456 Bacteria 2144
47 Ga0070678_100221088 3300005456 Bacteria 1574
48 Ga0070662_100742351 3300005457 Bacteria 832
49 Ga0068867_100367541 3300005459 Bacteria 1205
50 Ga0068867_100822913 3300005459 Bacteria 830
51 Ga0070679_100283768 3300005530 Bacteria 1608
52 Ga0070684_100085756 3300005535 Bacteria 2793
53 Ga0070684_100542625 3300005535 Bacteria 1079
54 Ga0068853_101303821 3300005539 Bacteria 702
55 Ga0070686_100268958 3300005544 Bacteria 1252
56 Ga0070686_101086832 3300005544 Bacteria 660
57 Ga0070696_100545746 3300005546 Bacteria 928
58 Ga0070693_100073050 3300005547 Bacteria 2025
59 Ga0070693_101020312 3300005547 Bacteria 627
60 Ga0070665_100259007 3300005548 Bacteria 1741
61 Ga0070704_100792494 3300005549 Bacteria 846
62 Ga0070704_100907058 3300005549 Bacteria 793
63 Ga0068855_100361250 3300005563 Bacteria 1598
64 Ga0070664_100539025 3300005564 Bacteria 1078
65 Ga0070664_101300010 3300005564 Bacteria 687
66 Ga0070664_102172927 3300005564 Bacteria 527
67 Ga0068854_100791476 3300005578 Bacteria 826
68 Ga0070702_100227906 3300005615 Bacteria 1250
69 Ga0070702_101188676 3300005615 Bacteria 614
70 Ga0068859_101037462 3300005617 Bacteria 901
71 Ga0068864_101495265 3300005618 Unclassified 678
72 Ga0068864_101927931 3300005618 Bacteria 597
73 Ga0068861_102468829 3300005719 Bacteria 523
74 Ga0068863_100862106 3300005841 Bacteria 905
75 Ga0068858_100919637 3300005842 Bacteria 856
76 Ga0068858_101165887 3300005842 Bacteria 757
77 Ga0068862_100901259 3300005844 Bacteria 869
78 Ga0081455_10788527 3300005937 Bacteria 597
79 Ga0081539_10070983 3300005985 Bacteria 1867
80 Ga0081539_10087478 3300005985 Bacteria 1619
81 Ga0070717_10455354 3300006028 Bacteria 1153
82 Ga0075368_10035518 3300006042 Bacteria 1945
83 Ga0075368_10076014 3300006042 Bacteria 1362
84 Ga0075363_100118893 3300006048 Bacteria 1474
85 Ga0075364_10521378 3300006051 Bacteria 812
86 Ga0075364_10795932 3300006051 Bacteria 644
87 Ga0075364_11141696 3300006051 Bacteria 528
88 Ga0075432_10414710 3300006058 Bacteria 584
89 Ga0070716_100197314 3300006173 Bacteria 1335
90 Ga0070712_100028178 3300006175 Bacteria 3755
91 Ga0070712_100905490 3300006175 Bacteria 761
92 Ga0075362_10039652 3300006177 Bacteria 2071
93 Ga0075362_10315088 3300006177 Bacteria 778
94 Ga0075367_10013615 3300006178 Bacteria 4379
95 Ga0075367_10432980 3300006178 Bacteria 833
96 Ga0075367_10460119 3300006178 Bacteria 806
97 Ga0075369_10103784 3300006186 Bacteria 1277
98 Ga0075369_10572947 3300006186 Bacteria 539
99 Ga0075366_10322521 3300006195 Bacteria 946
100 Ga0097621_100141684 3300006237 Bacteria 2055
101 Ga0097621_100498307 3300006237 Bacteria 1103
102 Ga0075370_10004019 3300006353 Bacteria 7072
103 Ga0075370_10303673 3300006353 Bacteria 949
104 Ga0075428_101693698 3300006844 Unclassified 660
105 Ga0075430_100522081 3300006846 Bacteria 980
106 Ga0075430_100803751 3300006846 Bacteria 775
107 Ga0075431_100160368 3300006847 Bacteria 2313
108 Ga0075433_10492753 3300006852 Bacteria 1079
109 Ga0075434_100114831 3300006871 Bacteria 2706
110 Ga0068865_100955157 3300006881 Bacteria 748
111 Ga0097620_101037701 3300006931 Bacteria 901
112 Ga0111539_10142008 3300009094 Bacteria 2811
113 Ga0105245_10408174 3300009098 Bacteria 1359
114 Ga0105247_10111646 3300009101 Bacteria 1760
115 Ga0114129_10113819 3300009147 Bacteria 3730
116 Ga0114129_12877616 3300009147 Bacteria 570
117 Ga0105242_11141182 3300009176 Bacteria 795
118 Ga0105242_11345466 3300009176 Bacteria 739
119 Ga0105242_12342272 3300009176 Bacteria 581
120 Ga0105248_10845370 3300009177 Bacteria 1033
121 Ga0105248_11803267 3300009177 Bacteria 694
122 Ga0105237_10254893 3300009545 Bacteria 1757
123 Ga0105238_10605086 3300009551 Bacteria 1104
124 Ga0105238_11766140 3300009551 Bacteria 650
125 Ga0105239_12217114 3300010375 Bacteria 639
126 Ga0105239_12425247 3300010375 Bacteria 611
127 Ga0105239_12724780 3300010375 Bacteria 577
128 Ga0105246_11039710 3300011119 Bacteria 744
129 Ga0157370_10200103 3300013104 Bacteria 1853
130 Ga0157374_10182321 3300013296 Bacteria 2051
131 Ga0157374_11836586 3300013296 Bacteria 631
132 Ga0157378_10215679 3300013297 Bacteria 1822
133 Ga0157378_10749230 3300013297 Bacteria 999
134 Ga0157378_13026782 3300013297 Bacteria 522
135 Ga0163162_10156233 3300013306 Bacteria 2401
136 Ga0163162_12089778 3300013306 Bacteria 650
137 Ga0157372_10084857 3300013307 Bacteria 3591
138 Ga0157372_13359567 3300013307 Bacteria 509
139 Ga0157375_10395725 3300013308 Bacteria 1548
140 Ga0157375_10627613 3300013308 Bacteria 1232
141 Ga0163163_10035776 3300014325 Bacteria 4820
142 Ga0163163_10379398 3300014325 Bacteria 1471
143 Ga0157380_10083232 3300014326 Bacteria 2621
144 Ga0157380_10256139 3300014326 Bacteria 1587
145 Ga0157377_11328451 3300014745 Bacteria 563
146 Ga0157379_11139389 3300014968 Bacteria 748
147 Ga0157379_11777707 3300014968 Bacteria 605
148 Ga0157376_10340610 3300014969 Bacteria 1432
149 Ga0213876_10033890 3300021384 Bacteria 2692
150 Ga0213876_10230094 3300021384 Bacteria 985
151 Ga0224572_1087021 3300024225 Bacteria 576
152 Ga0228598_1006654 3300024227 Bacteria 2386
153 Ga0207699_10186222 3300025906 Bacteria 1398
154 Ga0207643_10694048 3300025908 Bacteria 658
155 Ga0207649_10175393 3300025920 Bacteria 1496
156 Ga0207649_10494128 3300025920 Bacteria 930
157 Ga0207681_11612580 3300025923 Bacteria 543
158 Ga0207694_10358815 3300025924 Bacteria 1207
159 Ga0207650_10039864 3300025925 Bacteria 3434
160 Ga0207650_10394402 3300025925 Bacteria 1145
161 Ga0207659_10046547 3300025926 Bacteria 3064
162 Ga0207700_10235829 3300025928 Bacteria 1557
163 Ga0207664_10330272 3300025929 Bacteria 1347
164 Ga0207644_10025225 3300025931 Bacteria 4087
165 Ga0207644_11843751 3300025931 Bacteria 506
166 Ga0207706_10012596 3300025933 Bacteria 7700
167 Ga0207706_10218365 3300025933 Bacteria 1670
168 Ga0207709_10388613 3300025935 Bacteria 1064
169 Ga0207670_10395298 3300025936 Bacteria 1104
170 Ga0207670_10781299 3300025936 Bacteria 795
171 Ga0207669_10004366 3300025937 Bacteria 6215
172 Ga0207669_10544949 3300025937 Bacteria 935
173 Ga0207691_10156676 3300025940 Bacteria 2000
174 Ga0207691_11655316 3300025940 Bacteria 519
175 Ga0207661_10189025 3300025944 Bacteria 1804
176 Ga0207661_12158348 3300025944 Bacteria 503
177 Ga0207679_11609009 3300025945 Bacteria 595
178 Ga0207667_10185745 3300025949 Bacteria 2134
179 Ga0207651_10002786 3300025960 Bacteria 8399
180 Ga0207668_10136695 3300025972 Bacteria 1879
181 Ga0207668_10603702 3300025972 Bacteria 956
182 Ga0207668_10733289 3300025972 Bacteria 871
183 Ga0207658_10355909 3300025986 Bacteria 1276
184 Ga0207677_10184288 3300026023 Bacteria 1645
185 Ga0207677_11312466 3300026023 Bacteria 665
186 Ga0207703_10930636 3300026035 Bacteria 833
187 Ga0207703_11533898 3300026035 Bacteria 641
188 Ga0207639_11095679 3300026041 Bacteria 747
189 Ga0207639_11682029 3300026041 Bacteria 595
190 Ga0207639_11943364 3300026041 Bacteria 549
191 Ga0207678_10973741 3300026067 Bacteria 751
192 Ga0207648_10397347 3300026089 Bacteria 1248
193 Ga0207683_10150482 3300026121 Bacteria 2100
194 Ga0207683_12026939 3300026121 Bacteria 524
195 Ga0207698_11081283 3300026142 Bacteria 814
196 Ga0209813_10050534 3300027866 Bacteria 1298
197 Ga0209813_10074726 3300027866 Bacteria 1109
198 Ga0268266_10032120 3300028379 Bacteria 4460
199 Ga0268266_10313709 3300028379 Bacteria 1466
200 Ga0268266_11562454 3300028379 Bacteria 635
201 Ga0268265_10602390 3300028380 Bacteria 1050
202 Ga0268264_10638554 3300028381 Bacteria 1053
203 Ga0265760_10038194 3300031090 Bacteria 1427
204 Ga0265325_10000252 3300031241 Bacteria 38198
205 Ga0265339_10394884 3300031249 Bacteria 647
206 Ga0307405_10583136 3300031731 Bacteria 910
207 Ga0307410_11326043 3300031852 Bacteria 630
208 Ga0307407_10913654 3300031903 Bacteria 674
209 Ga0307416_100961427 3300032002 Bacteria 956
210 Ga0307416_101089632 3300032002 Bacteria 903
211 Ga0373938_0038936 3300034957 Bacteria 1050
212 Ga0373926_0166450 3300035083 Bacteria 843
213 Ga0373936_0069678 3300035113 Bacteria 1448
214 Ga0373939_0001413 3300035114 Bacteria 5828
215 Ga0373941_0032843 3300035115 Bacteria 1556
216 Ga0373953_0052932 3300035117 Bacteria 1644
217 Ga0373956_0289812 3300035119 Bacteria 779
218 Ga0373943_0017362 3300035170 Bacteria 3292
219 Ga0373943_0098869 3300035170 Bacteria 1523
220 Ga0373946_0492223 3300035171 Bacteria 628
221 Ga0373955_0003500 3300035172 Bacteria 6905
222 Ga0373961_0016274 3300035241 Bacteria 1914
223 Ga0373924_0217146 3300035410 Bacteria 845
224 Ga0373931_1038598 3300035691 Bacteria 556
225 Ga0373935_0083408 3300035692 Bacteria 2080
226 Ga0373935_0132948 3300035692 Bacteria 1673
227 Ga0373933_0235278 3300035724 Bacteria 1177
228 Ga0373933_0604820 3300035724 Bacteria 720
229 Ga0373947_0091054 3300035725 Bacteria 1902
230 Ga0373937_0602832 3300036401 Bacteria 1042
231 Ga0373925_1057131 3300037068 Bacteria 668
232 Ga0373925_1416699 3300037068 Bacteria 569
233 Ga0436365_0172167 3300039437 Bacteria 872
234 Ga0436365_0592364 3300039437 Bacteria 2713
235 Ga0436365_1074300 3300039437 Bacteria 916
236 Ga0436365_1504174 3300039437 Bacteria 979
237 Ga0436365_1904294 3300039437 Bacteria 10904
238 Ga0436365_1933704 3300039437 Bacteria 1752
239 Ga0436363_0156710 3300039450 Bacteria 1018
240 Ga0436362_1114863 3300039453 Bacteria 831
241 Ga0451853_0404056 3300041512 Bacteria 816
242 Ga0439441_044309 3300042001 Bacteria 900
243 Ga0439434_0234802 3300042435 Bacteria 625
244 Ga0439435_0037133 3300042436 Bacteria 1349
245 Ga0453683_0376101 3300044673 Bacteria 914
246 Ga0495629_0212885 3300046459 Bacteria 1334
247 Ga0495651_0081052 3300046462 Bacteria 2450
248 Ga0495653_0093606 3300046463 Bacteria 2191
249 Ga0495662_0596351 3300046476 Bacteria 540
250 Ga0495664_0724782 3300046477 Bacteria 587
251 Ga0495608_0119915 3300046511 Bacteria 1687
252 Ga0495618_0410978 3300046514 Bacteria 826
253 Ga0495618_0784912 3300046514 Bacteria 555
254 Ga0495630_0814614 3300046517 Bacteria 713
255 Ga0495630_1090096 3300046517 Bacteria 606
256 Ga0495663_0195851 3300046525 Bacteria 704
257 Ga0495652_0131839 3300046529 Bacteria 1977
258 Ga0495640_0836686 3300046533 Bacteria 547
259 Ga0495587_0157047 3300046536 Bacteria 1295
260 Ga0495587_0258425 3300046536 Bacteria 978
261 Ga0495621_0019133 3300046539 Bacteria 2233
262 Ga0495621_0274783 3300046539 Bacteria 693
263 Ga0495645_0409856 3300046543 Bacteria 862
264 Ga0495656_0029507 3300046615 Bacteria 2209
265 Ga0495634_0154487 3300046642 Bacteria 1449
266 Ga0495635_0202034 3300046663 Bacteria 1348
267 Ga0495659_0508967 3300046664 Bacteria 528
268 Ga0495657_0175157 3300046675 Bacteria 1319
269 Ga0495599_0036933 3300046678 Bacteria 3069
270 Ga0495599_0630904 3300046678 Bacteria 622
271 Ga0495623_0161414 3300046679 Bacteria 1317
272 Ga0495646_0127972 3300046680 Bacteria 1432
273 Ga0495647_0181508 3300046681 Bacteria 916
274 Ga0495658_0377153 3300046683 Bacteria 903
275 Ga0495669_0080358 3300046684 Bacteria 1496
276 Ga0495613_0085476 3300046689 Bacteria 2289
277 Ga0495649_0459175 3300046694 Bacteria 636
278 Ga0495600_0209340 3300046809 Bacteria 1250
279 Ga0495581_0420922 3300047315 Bacteria 779
280 Ga0495604_0036860 3300047317 Bacteria 3854
281 Ga0495680_0365491 3300047322 Bacteria 1002
282 Ga0495675_0062414 3300047444 Bacteria 2359
283 Ga0495677_0395513 3300047445 Bacteria 547
284 Ga0495685_179092 3300047447 Bacteria 683
285 Ga0495684_0199352 3300047471 Bacteria 1476
286 Ga0495593_0660997 3300047673 Bacteria 525
287 Ga0495602_0024971 3300048088 Bacteria 5790
288 Ga0495615_0009964 3300048090 Bacteria 1885
289 Ga0495615_0048590 3300048090 Bacteria 1085
290 Ga0496100_0966895 3300048903 Bacteria 670
291 Ga0496106_0228675 3300048909 Bacteria 1485
292 Ga0496108_0176093 3300048911 Bacteria 1852
293 Ga0496109_0012759 3300048912 Bacteria 7263
294 Ga0496109_1972954 3300048912 Bacteria 516
295 Ga0496110_0387831 3300048913 Bacteria 1273
296 Ga0496110_0705702 3300048913 Bacteria 910
297 Ga0496111_0219772 3300048914 Bacteria 1412
298 Ga0496111_0675991 3300048914 Bacteria 752
299 Ga0496112_0512547 3300048915 Bacteria 1134
300 Ga0496113_0129523 3300048916 Bacteria 1979
301 Ga0496114_0659065 3300048917 Bacteria 920
302 Ga0496115_0162378 3300048918 Bacteria 1847
303 Ga0501032_0930432 3300049569 Bacteria 547
304 Ga0501033_0343466 3300049570 Bacteria 1046
305 Ga0501036_0164101 3300049572 Bacteria 1873
306 Ga0501036_0630486 3300049572 Bacteria 888
307 Ga0501038_0792913 3300049574 Bacteria 704
308 Ga0501039_0451612 3300049575 Bacteria 1009
309 Ga0501041_0308022 3300049577 Bacteria 998
310 Ga0501042_0523942 3300049578 Bacteria 861
311 Ga0501043_1136569 3300049579 Unclassified 551
312 Ga0501048_0797714 3300049582 Bacteria 678
313 Ga0501069_0272692 3300049585 Bacteria 989
314 Ga0501070_1326811 3300049586 Unclassified 549
315 Ga0501071_0686649 3300049587 Bacteria 788
316 Ga0501072_0274894 3300049588 Bacteria 1340
317 Ga0501073_0090769 3300049589 Bacteria 2123
318 Ga0501073_0103671 3300049589 Bacteria 1975
319 Ga0501073_0107580 3300049589 Bacteria 1935
320 Ga0501073_1040582 3300049589 Bacteria 563
321 Ga0501074_0199260 3300049590 Bacteria 1427
322 Ga0501075_0069454 3300049591 Bacteria 2662
323 Ga0501076_0435496 3300049592 Bacteria 1079
324 Ga0501077_0281045 3300049593 Bacteria 1059
325 Ga0501079_0123286 3300049741 Bacteria 2016
326 Ga0501079_0186019 3300049741 Bacteria 1621
327 Ga0501080_0632631 3300049742 Bacteria 948
328 Ga0501080_1434424 3300049742 Bacteria 588
329 Ga0501081_0096246 3300049743 Bacteria 2088
330 Ga0501045_0123898 3300049824 Bacteria 1919
331 nmdc:mga03683_264890_c1 3300050489 Bacteria 801
332 nmdc:mga03683_384282_c1 3300050489 Bacteria 669
333 nmdc:mga03n38_58811_c1 3300050490 Bacteria 1743
334 nmdc:mga00v17_597572_c1 3300050491 Bacteria 712
335 nmdc:mga00v17_90456_c1 3300050491 Bacteria 1922
336 nmdc:mga0yw44_130477_c1 3300050492 Bacteria 1627
337 nmdc:mga0k408_271371_c1 3300050493 Bacteria 1013
338 nmdc:mga0k408_589933_c1 3300050493 Unclassified 656
339 nmdc:mga0k408_83311_c1 3300050493 Bacteria 1875
340 nmdc:mga06z11_185540_c1 3300050494 Bacteria 1202
341 nmdc:mga04h51_16920_c1 3300050495 Bacteria 2124
342 nmdc:mga07m45_70130_c1 3300050496 Bacteria 1994
343 nmdc:mga05p37_437667_c1 3300050507 Bacteria 1517
344 nmdc:mga0qj67_691367_c1 3300050509 Bacteria 812
345 nmdc:mga06r32_54810_c1 3300050510 Bacteria 3823
346 nmdc:mga06r32_832455_c1 3300050510 Bacteria 882
347 nmdc:mga08y16_93776_c1 3300050511 Bacteria 3127
348 nmdc:mga0a205_189470_c1 3300050515 Bacteria 1949
349 nmdc:mga0sz30_16155_c1 3300050516 Bacteria 2959
350 nmdc:mga0sz30_231598_c1 3300050516 Bacteria 822
351 Ga0495601_0116433 3300053077 Bacteria 1733
352 Ga0495612_0019885 3300053078 Bacteria 2690
353 Ga0495655_0018203 3300053083 Bacteria 1541
354 Ga0495595_0073554 3300053084 Bacteria 1618
355 Ga0495619_0205490 3300053085 Bacteria 1363
356 Ga0495619_0293510 3300053085 Bacteria 1126
357 Ga0500616_0067121 3300053153 Bacteria 1840
358 Ga0501084_0202216 3300054114 Bacteria 1676
359 Ga0501082_0118344 3300060353 Bacteria 2295
360 Ga0501082_1109523 3300060353 Bacteria 692
361 Ga0530510_0485951 3300061734 Bacteria 936
362 Ga0207662_10802454
363 JGI25406J46586_10080307
364 Ga0065712_10018484
365 Ga0065715_10689123
366 Ga0070658_10519783
367 Ga0070676_10516426
368 Ga0070683_100231230
369 Ga0070683_100697648
370 Ga0070690_101517381
371 Ga0070670_100053338
372 Ga0070670_100221831
373 Ga0070670_100858430
374 Ga0070677_10788203
375 Ga0070666_10146004
376 Ga0070666_10420315
377 Ga0070680_100089704
378 Ga0068868_100242147
379 Ga0068868_100801300
380 Ga0070689_100257502
381 Ga0070689_100549533
382 Ga0070691_10264594
383 Ga0070691_10565826
384 Ga0070691_10655264
385 Ga0070661_100215930
386 Ga0070661_101090822
387 Ga0070668_100665513
388 Ga0070668_101843352
389 Ga0070669_100214848
390 Ga0070669_101274933
391 Ga0070675_100697363
392 Ga0070675_101118328
393 Ga0070671_100333278
394 Ga0070674_100040185
395 Ga0070674_102029920
396 Ga0070673_100022515
397 Ga0070673_101752787
398 Ga0070673_102269479
399 Ga0070688_100033743
400 Ga0070688_101242572
401 Ga0070714_100236607
402 Ga0070713_100136566
403 Ga0070701_10519744
404 Ga0070711_100040930
405 Ga0070705_101208253
406 Ga0070663_101635942
407 Ga0070678_100111164
408 Ga0070678_100221088
409 Ga0070662_100742351
410 Ga0068867_100367541
411 Ga0068867_100822913
412 Ga0070679_100283768
413 Ga0070684_100085756
414 Ga0070684_100542625
415 Ga0068853_101303821
416 Ga0070686_100268958
417 Ga0070686_101086832
418 Ga0070696_100545746
419 Ga0070693_100073050
420 Ga0070693_101020312
421 Ga0070665_100259007
422 Ga0070704_100792494
423 Ga0070704_100907058
424 Ga0068855_100361250
425 Ga0070664_100539025
426 Ga0070664_101300010
427 Ga0070664_102172927
428 Ga0068854_100791476
429 Ga0070702_100227906
430 Ga0070702_101188676
431 Ga0068859_101037462
432 Ga0068864_101495265
433 Ga0068864_101927931
434 Ga0068861_102468829
435 Ga0068863_100862106
436 Ga0068858_100919637
437 Ga0068858_101165887
438 Ga0068862_100901259
439 Ga0081455_10788527
440 Ga0081539_10070983
441 Ga0081539_10087478
442 Ga0070717_10455354
443 Ga0075368_10035518
444 Ga0075368_10076014
445 Ga0075363_100118893
446 Ga0075364_10521378
447 Ga0075364_10795932
448 Ga0075364_11141696
449 Ga0075432_10414710
450 Ga0070716_100197314
451 Ga0070712_100028178
452 Ga0070712_100905490
453 Ga0075362_10039652
454 Ga0075362_10315088
455 Ga0075367_10013615
456 Ga0075367_10432980
457 Ga0075367_10460119
458 Ga0075369_10103784
459 Ga0075369_10572947
460 Ga0075366_10322521
461 Ga0097621_100141684
462 Ga0097621_100498307
463 Ga0075370_10004019
464 Ga0075370_10303673
465 Ga0075428_101693698
466 Ga0075430_100522081
467 Ga0075430_100803751
468 Ga0075431_100160368
469 Ga0075433_10492753
470 Ga0075434_100114831
471 Ga0068865_100955157
472 Ga0097620_101037701
473 Ga0111539_10142008
474 Ga0105245_10408174
475 Ga0105247_10111646
476 Ga0114129_10113819
477 Ga0114129_12877616
478 Ga0105242_11141182
479 Ga0105242_11345466
480 Ga0105242_12342272
481 Ga0105248_10845370
482 Ga0105248_11803267
483 Ga0105237_10254893
484 Ga0105238_10605086
485 Ga0105238_11766140
486 Ga0105239_12217114
487 Ga0105239_12425247
488 Ga0105239_12724780
489 Ga0105246_11039710
490 Ga0157370_10200103
491 Ga0157374_10182321
492 Ga0157374_11836586
493 Ga0157378_10215679
494 Ga0157378_10749230
495 Ga0157378_13026782
496 Ga0163162_10156233
497 Ga0163162_12089778
498 Ga0157372_10084857
499 Ga0157372_13359567
500 Ga0157375_10395725
501 Ga0157375_10627613
502 Ga0163163_10035776
503 Ga0163163_10379398
504 Ga0157380_10083232
505 Ga0157380_10256139
506 Ga0157377_11328451
507 Ga0157379_11139389
508 Ga0157379_11777707
509 Ga0157376_10340610
510 Ga0213876_10033890
511 Ga0213876_10230094
512 Ga0224572_1087021
513 Ga0228598_1006654
514 Ga0207699_10186222
515 Ga0207643_10694048
516 Ga0207649_10175393
517 Ga0207649_10494128
518 Ga0207681_11612580
519 Ga0207694_10358815
520 Ga0207650_10039864
521 Ga0207650_10394402
522 Ga0207659_10046547
523 Ga0207700_10235829
524 Ga0207664_10330272
525 Ga0207644_10025225
526 Ga0207644_11843751
527 Ga0207706_10012596
528 Ga0207706_10218365
529 Ga0207709_10388613
530 Ga0207670_10395298
531 Ga0207670_10781299
532 Ga0207669_10004366
533 Ga0207669_10544949
534 Ga0207691_10156676
535 Ga0207691_11655316
536 Ga0207661_10189025
537 Ga0207661_12158348
538 Ga0207679_11609009
539 Ga0207667_10185745
540 Ga0207651_10002786
541 Ga0207668_10136695
542 Ga0207668_10603702
543 Ga0207668_10733289
544 Ga0207658_10355909
545 Ga0207677_10184288
546 Ga0207677_11312466
547 Ga0207703_10930636
548 Ga0207703_11533898
549 Ga0207639_11095679
550 Ga0207639_11682029
551 Ga0207639_11943364
552 Ga0207678_10973741
553 Ga0207648_10397347
554 Ga0207683_10150482
555 Ga0207683_12026939
556 Ga0207698_11081283
557 Ga0209813_10050534
558 Ga0209813_10074726
559 Ga0268266_10032120
560 Ga0268266_10313709
561 Ga0268266_11562454
562 Ga0268265_10602390
563 Ga0268264_10638554
564 Ga0265760_10038194
565 Ga0265325_10000252
566 Ga0265339_10394884
567 Ga0307405_10583136
568 Ga0307410_11326043
569 Ga0307407_10913654
570 Ga0307416_100961427
571 Ga0307416_101089632
572 Ga0373938_0038936
573 Ga0373926_0166450
574 Ga0373936_0069678
575 Ga0373939_0001413
576 Ga0373941_0032843
577 Ga0373953_0052932
578 Ga0373956_0289812
579 Ga0373943_0017362
580 Ga0373943_0098869
581 Ga0373946_0492223
582 Ga0373955_0003500
583 Ga0373961_0016274
584 Ga0373924_0217146
585 Ga0373931_1038598
586 Ga0373935_0083408
587 Ga0373935_0132948
588 Ga0373933_0235278
589 Ga0373933_0604820
590 Ga0373947_0091054
591 Ga0373937_0602832
592 Ga0373925_1057131
593 Ga0373925_1416699
594 Ga0436365_0172167
595 Ga0436365_0592364
596 Ga0436365_1074300
597 Ga0436365_1504174
598 Ga0436365_1904294
599 Ga0436365_1933704
600 Ga0436363_0156710
601 Ga0436362_1114863
602 Ga0451853_0404056
603 Ga0439441_044309
604 Ga0439434_0234802
605 Ga0439435_0037133
606 Ga0453683_0376101
607 Ga0495629_0212885
608 Ga0495651_0081052
609 Ga0495653_0093606
610 Ga0495662_0596351
611 Ga0495664_0724782
612 Ga0495608_0119915
613 Ga0495618_0410978
614 Ga0495618_0784912
615 Ga0495630_0814614
616 Ga0495630_1090096
617 Ga0495663_0195851
618 Ga0495652_0131839
619 Ga0495640_0836686
620 Ga0495587_0157047
621 Ga0495587_0258425
622 Ga0495621_0019133
623 Ga0495621_0274783
624 Ga0495645_0409856
625 Ga0495656_0029507
626 Ga0495634_0154487
627 Ga0495635_0202034
628 Ga0495659_0508967
629 Ga0495657_0175157
630 Ga0495599_0036933
631 Ga0495599_0630904
632 Ga0495623_0161414
633 Ga0495646_0127972
634 Ga0495647_0181508
635 Ga0495658_0377153
636 Ga0495669_0080358
637 Ga0495613_0085476
638 Ga0495649_0459175
639 Ga0495600_0209340
640 Ga0495581_0420922
641 Ga0495604_0036860
642 Ga0495680_0365491
643 Ga0495675_0062414
644 Ga0495677_0395513
645 Ga0495685_179092
646 Ga0495684_0199352
647 Ga0495593_0660997
648 Ga0495602_0024971
649 Ga0495615_0009964
650 Ga0495615_0048590
651 Ga0496100_0966895
652 Ga0496106_0228675
653 Ga0496108_0176093
654 Ga0496109_0012759
655 Ga0496109_1972954
656 Ga0496110_0387831
657 Ga0496110_0705702
658 Ga0496111_0219772
659 Ga0496111_0675991
660 Ga0496112_0512547
661 Ga0496113_0129523
662 Ga0496114_0659065
663 Ga0496115_0162378
664 Ga0501032_0930432
665 Ga0501033_0343466
666 Ga0501036_0164101
667 Ga0501036_0630486
668 Ga0501038_0792913
669 Ga0501039_0451612
670 Ga0501041_0308022
671 Ga0501042_0523942
672 Ga0501043_1136569
673 Ga0501048_0797714
674 Ga0501069_0272692
675 Ga0501070_1326811
676 Ga0501071_0686649
677 Ga0501072_0274894
678 Ga0501073_0090769
679 Ga0501073_0103671
680 Ga0501073_0107580
681 Ga0501073_1040582
682 Ga0501074_0199260
683 Ga0501075_0069454
684 Ga0501076_0435496
685 Ga0501077_0281045
686 Ga0501079_0123286
687 Ga0501079_0186019
688 Ga0501080_0632631
689 Ga0501080_1434424
690 Ga0501081_0096246
691 Ga0501045_0123898
692 nmdc:mga03683_264890_c1
693 nmdc:mga03683_384282_c1
694 nmdc:mga03n38_58811_c1
695 nmdc:mga00v17_597572_c1
696 nmdc:mga00v17_90456_c1
697 nmdc:mga0yw44_130477_c1
698 nmdc:mga0k408_271371_c1
699 nmdc:mga0k408_589933_c1
700 nmdc:mga0k408_83311_c1
701 nmdc:mga06z11_185540_c1
702 nmdc:mga04h51_16920_c1
703 nmdc:mga07m45_70130_c1
704 nmdc:mga05p37_437667_c1
705 nmdc:mga0qj67_691367_c1
706 nmdc:mga06r32_54810_c1
707 nmdc:mga06r32_832455_c1
708 nmdc:mga08y16_93776_c1
709 nmdc:mga0a205_189470_c1
710 nmdc:mga0sz30_16155_c1
711 nmdc:mga0sz30_231598_c1
712 Ga0495601_0116433
713 Ga0495612_0019885
714 Ga0495655_0018203
715 Ga0495595_0073554
716 Ga0495619_0205490
717 Ga0495619_0293510
718 Ga0500616_0067121
719 Ga0501084_0202216
720 Ga0501082_0118344
721 Ga0501082_1109523
722 Ga0530510_0485951

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07330

DUF1467

Protein of unknown function (DUF1467)

9

87

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bgi-assembly1.cif.gz_G photosystem i of a temperature sensitive mutant chlamydomonas reinhardtii 0.6344 10 70
7zqc-assembly1.cif.gz_G monomeric psi of chlamydomonas reinhardtii at 2.31 a resolution 0.6297 10 70
6sl5-assembly1.cif.gz_K dunaliella photosystem i supercomplex 0.5606 6 75
7y5e-assembly1.cif.gz_KN in situ single-pbs-psii-psi-lhcs megacomplex. 0.5595 1 66
7dr2-assembly1.cif.gz_cK structure of grafix psi tetramer from cyanophora paradoxa 0.5524 7 66
ID Description Score Start End Superfamily
af_Q96M86_1496_1658_1.20.58.1120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dynein motor heavy chain, linker domain, subdomain 4 0.5064 3 75 1.20.58.1120
af_Q9M1V8_17_377_3.60.40.10 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.498 6 75 3.60.40.10
af_A0A0S0WNY8_233_344_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.4642 4 80 1.20.58.390
af_F1R808_247_356_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.462 4 80 1.20.58.390
af_Q98880_236_357_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.4618 4 80 1.20.58.390
ID Description Score Start End GO Terms
AF-A0A1G9V916-F1-model_v4 Predicted secreted protein 0.8958 2 76 GO:0016020
AF-A0A1U7JFN5-F1-model_v4 Secreted protein 0.8882 1 76 GO:0016020
AF-A0A5C7NQW5-F1-model_v4 deleted 0.8847 1 81
AF-A0A3P3DNM8-F1-model_v4 DUF1467 family protein 0.8836 1 81 GO:0016020
AF-X5MN49-F1-model_v4 Glycine/D-amino acid oxidases (Deaminating) 0.8815 1 81 GO:0016020

Map