F422222

General Info

Members Datasets Scaffolds Average Seq Length
361 177 361 89

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_11763324|Ga0157378_117633242
Length 98
Sequence VRIDRFLFFIRLVKSRTLAQSIIESGHVRIDGKRVEKSSEEVRAGSVVALPLHDRVRILRVLTLPRRRGPSAEARACYEELTEAAAPFSDQVKGSFGT

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
150 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
159 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
163 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
164 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
177 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.11
Nodule 0
Rhizoplane 3.32
Rhizosphere 94.18
Stem 0
Stem Tuber 0
Unclassified 1.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010885 3300001979 Bacteria 3481
2 JGI24740J21852_10011998 3300001979 Bacteria 3279
3 JGI24735J21928_10012890 3300002067 Bacteria 2638
4 JGI24735J21928_10138584 3300002067 Bacteria 702
5 JGI24738J21930_10091136 3300002075 Bacteria 645
6 Ga0070658_10045000 3300005327 Bacteria 3568
7 Ga0070658_10055221 3300005327 Bacteria 3226
8 Ga0070658_10095823 3300005327 Bacteria 2450
9 Ga0070658_10302082 3300005327 Bacteria 1365
10 Ga0070658_10410637 3300005327 Bacteria 1164
11 Ga0070658_11351473 3300005327 Bacteria 618
12 Ga0070683_100054260 3300005329 Bacteria 3716
13 Ga0070683_100136801 3300005329 Bacteria 2320
14 Ga0070690_100231818 3300005330 Bacteria 1299
15 Ga0070670_100089266 3300005331 Bacteria 2650
16 Ga0068869_100097744 3300005334 Bacteria 2217
17 Ga0070666_10151123 3300005335 Bacteria 1620
18 Ga0070666_11223821 3300005335 Bacteria 560
19 Ga0070680_100043155 3300005336 Bacteria 3662
20 Ga0070680_100079044 3300005336 Bacteria 2711
21 Ga0070682_100026226 3300005337 Bacteria 3486
22 Ga0070682_101498734 3300005337 Unclassified 580
23 Ga0068868_100590844 3300005338 Bacteria 983
24 Ga0068868_101247934 3300005338 Bacteria 689
25 Ga0070660_100000156 3300005339 Bacteria 44192
26 Ga0070660_100047686 3300005339 Bacteria 3288
27 Ga0070660_101599499 3300005339 Bacteria 554
28 Ga0070691_10541880 3300005341 Bacteria 679
29 Ga0070687_100955257 3300005343 Bacteria 618
30 Ga0070661_100030483 3300005344 Bacteria 3897
31 Ga0070661_100064643 3300005344 Bacteria 2688
32 Ga0070692_10059567 3300005345 Bacteria 2007
33 Ga0070668_100003974 3300005347 Bacteria 10940
34 Ga0070668_101047720 3300005347 Bacteria 734
35 Ga0070669_100249845 3300005353 Bacteria 1412
36 Ga0070669_100625587 3300005353 Bacteria 904
37 Ga0070669_100937880 3300005353 Bacteria 740
38 Ga0070669_101429064 3300005353 Bacteria 600
39 Ga0070675_101179939 3300005354 Bacteria 705
40 Ga0070671_100000051 3300005355 Bacteria 79207
41 Ga0070671_100007368 3300005355 Bacteria 8789
42 Ga0070671_100586598 3300005355 Bacteria 963
43 Ga0070671_100966068 3300005355 Bacteria 746
44 Ga0070674_100021811 3300005356 Bacteria 4120
45 Ga0070673_100048432 3300005364 Bacteria 3313
46 Ga0070673_100666042 3300005364 Bacteria 954
47 Ga0070659_100764877 3300005366 Bacteria 838
48 Ga0070667_100162418 3300005367 Bacteria 1968
49 Ga0070667_100347763 3300005367 Bacteria 1342
50 Ga0070667_101534515 3300005367 Bacteria 626
51 Ga0070714_100373220 3300005435 Bacteria 1343
52 Ga0070713_100013870 3300005436 Bacteria 5965
53 Ga0070713_102300131 3300005436 Bacteria 522
54 Ga0070663_100013811 3300005455 Bacteria 5166
55 Ga0070663_100774970 3300005455 Bacteria 821
56 Ga0070678_100017156 3300005456 Bacteria 4653
57 Ga0070662_100003196 3300005457 Bacteria 10186
58 Ga0070662_100065025 3300005457 Bacteria 2672
59 Ga0070662_100337797 3300005457 Bacteria 1232
60 Ga0070662_100983171 3300005457 Bacteria 722
61 Ga0070662_101202293 3300005457 Bacteria 652
62 Ga0070681_10036291 3300005458 Bacteria 4949
63 Ga0068867_100000897 3300005459 Bacteria 20193
64 Ga0070679_100001755 3300005530 Bacteria 19530
65 Ga0070679_101216332 3300005530 Bacteria 699
66 Ga0070684_100274881 3300005535 Bacteria 1543
67 Ga0068853_100064071 3300005539 Bacteria 3186
68 Ga0068853_100274659 3300005539 Bacteria 1552
69 Ga0068853_100339070 3300005539 Bacteria 1396
70 Ga0070672_100098605 3300005543 Bacteria 2367
71 Ga0070672_100422164 3300005543 Bacteria 1145
72 Ga0070672_101833208 3300005543 Bacteria 545
73 Ga0070686_100159425 3300005544 Bacteria 1588
74 Ga0070665_100007253 3300005548 Bacteria 11265
75 Ga0070665_100210562 3300005548 Bacteria 1945
76 Ga0070665_101658925 3300005548 Bacteria 647
77 Ga0070665_102296040 3300005548 Bacteria 542
78 Ga0068855_100025477 3300005563 Bacteria 7076
79 Ga0068855_101068001 3300005563 Bacteria 845
80 Ga0070664_100115606 3300005564 Bacteria 2345
81 Ga0070664_100891721 3300005564 Bacteria 834
82 Ga0068857_100053816 3300005577 Bacteria 3570
83 Ga0068854_100036550 3300005578 Bacteria 3444
84 Ga0068854_100107086 3300005578 Bacteria 2104
85 Ga0068856_100323757 3300005614 Bacteria 1559
86 Ga0068856_100806367 3300005614 Bacteria 958
87 Ga0068852_100638041 3300005616 Bacteria 1072
88 Ga0068859_100167621 3300005617 Bacteria 2276
89 Ga0068859_101227853 3300005617 Unclassified 826
90 Ga0068864_100530316 3300005618 Bacteria 1136
91 Ga0068851_10023068 3300005834 Bacteria 3038
92 Ga0068851_10969458 3300005834 Unclassified 535
93 Ga0068870_10572511 3300005840 Bacteria 763
94 Ga0068870_11120826 3300005840 Bacteria 566
95 Ga0068863_100248239 3300005841 Bacteria 1719
96 Ga0068858_101687113 3300005842 Bacteria 626
97 Ga0068858_101752292 3300005842 Bacteria 613
98 Ga0068860_100015105 3300005843 Bacteria 7547
99 Ga0068862_100003115 3300005844 Bacteria 14451
100 Ga0068862_100126062 3300005844 Bacteria 2260
101 Ga0070717_10002279 3300006028 Bacteria 13455
102 Ga0075364_10224366 3300006051 Bacteria 1276
103 Ga0070716_100026158 3300006173 Bacteria 3122
104 Ga0070712_101434016 3300006175 Bacteria 603
105 Ga0075366_10063578 3300006195 Bacteria 2194
106 Ga0097621_100056166 3300006237 Bacteria 3216
107 Ga0068871_100033052 3300006358 Bacteria 4092
108 Ga0068871_100108272 3300006358 Bacteria 2335
109 Ga0068865_100130939 3300006881 Bacteria 1879
110 Ga0068865_101683465 3300006881 Bacteria 571
111 Ga0097620_100167605 3300006931 Bacteria 2276
112 Ga0097620_101227901 3300006931 Unclassified 826
113 Ga0105240_10186087 3300009093 Bacteria 2446
114 Ga0105240_10249915 3300009093 Bacteria 2052
115 Ga0105241_10431722 3300009174 Bacteria 1162
116 Ga0105248_10065912 3300009177 Bacteria 4066
117 Ga0105248_10082989 3300009177 Bacteria 3605
118 Ga0105237_10527517 3300009545 Unclassified 1187
119 Ga0105238_10048577 3300009551 Bacteria 4276
120 Ga0105249_11559426 3300009553 Bacteria 733
121 Ga0105239_12160656 3300010375 Bacteria 647
122 Ga0157373_10078112 3300013100 Bacteria 2334
123 Ga0157370_10005529 3300013104 Bacteria 14169
124 Ga0157370_10544396 3300013104 Bacteria 1064
125 Ga0157370_10906538 3300013104 Bacteria 800
126 Ga0157369_10105660 3300013105 Bacteria 2997
127 Ga0157369_10190367 3300013105 Bacteria 2156
128 Ga0157369_11867889 3300013105 Bacteria 610
129 Ga0157374_10036755 3300013296 Bacteria 4489
130 Ga0157378_10151548 3300013297 Bacteria 2161
131 Ga0157378_11253464 3300013297 Bacteria 782
132 Ga0157378_11763324 3300013297 Bacteria 667
133 Ga0157372_11065836 3300013307 Bacteria 935
134 Ga0157375_10381048 3300013308 Bacteria 1577
135 Ga0163163_12553711 3300014325 Unclassified 569
136 Ga0157380_12354055 3300014326 Bacteria 597
137 Ga0157377_10183792 3300014745 Bacteria 1317
138 Ga0157379_10486330 3300014968 Bacteria 1143
139 Ga0206353_10212220 3300020082 Bacteria 785
140 Ga0206353_11509116 3300020082 Bacteria 1427
141 Ga0213874_10279875 3300021377 Bacteria 623
142 Ga0213876_10068666 3300021384 Bacteria 1872
143 Ga0207697_10008967 3300025315 Bacteria 4343
144 Ga0207642_10368982 3300025899 Bacteria 851
145 Ga0207680_10167743 3300025903 Bacteria 1477
146 Ga0207680_10385142 3300025903 Bacteria 989
147 Ga0207680_11004481 3300025903 Bacteria 597
148 Ga0207680_11085321 3300025903 Bacteria 572
149 Ga0207647_10004422 3300025904 Bacteria 10420
150 Ga0207647_10011065 3300025904 Bacteria 6343
151 Ga0207647_10044807 3300025904 Bacteria 2762
152 Ga0207647_10120413 3300025904 Bacteria 1548
153 Ga0207647_10251941 3300025904 Bacteria 1012
154 Ga0207647_10481448 3300025904 Bacteria 693
155 Ga0207699_10439442 3300025906 Bacteria 934
156 Ga0207645_10120726 3300025907 Bacteria 1701
157 Ga0207643_10325009 3300025908 Bacteria 961
158 Ga0207705_10000067 3300025909 Bacteria 136004
159 Ga0207705_10013233 3300025909 Bacteria 5955
160 Ga0207705_10119253 3300025909 Bacteria 1956
161 Ga0207705_10396737 3300025909 Unclassified 1067
162 Ga0207705_10731112 3300025909 Bacteria 769
163 Ga0207705_10889245 3300025909 Bacteria 690
164 Ga0207705_11499752 3300025909 Bacteria 510
165 Ga0207695_10028926 3300025913 Bacteria 6134
166 Ga0207695_10119591 3300025913 Bacteria 2604
167 Ga0207671_10115809 3300025914 Bacteria 2044
168 Ga0207660_10001267 3300025917 Bacteria 16955
169 Ga0207660_10025542 3300025917 Bacteria 4011
170 Ga0207657_10002451 3300025919 Bacteria 20037
171 Ga0207657_10013245 3300025919 Bacteria 8093
172 Ga0207649_10024127 3300025920 Bacteria 3531
173 Ga0207649_10754173 3300025920 Bacteria 757
174 Ga0207649_10909765 3300025920 Bacteria 690
175 Ga0207652_10001335 3300025921 Bacteria 21928
176 Ga0207652_11240863 3300025921 Bacteria 648
177 Ga0207681_10447623 3300025923 Bacteria 1050
178 Ga0207681_10588468 3300025923 Bacteria 918
179 Ga0207681_10736999 3300025923 Bacteria 821
180 Ga0207694_10086106 3300025924 Bacteria 2474
181 Ga0207650_10055058 3300025925 Bacteria 2952
182 Ga0207650_10105826 3300025925 Bacteria 2172
183 Ga0207700_10024719 3300025928 Bacteria 4161
184 Ga0207664_10044150 3300025929 Bacteria 3489
185 Ga0207664_10611098 3300025929 Unclassified 979
186 Ga0207644_10000627 3300025931 Bacteria 22496
187 Ga0207644_10034982 3300025931 Bacteria 3517
188 Ga0207644_10149074 3300025931 Bacteria 1809
189 Ga0207644_10651715 3300025931 Bacteria 877
190 Ga0207690_10303706 3300025932 Bacteria 1250
191 Ga0207690_11038650 3300025932 Bacteria 682
192 Ga0207706_10022573 3300025933 Bacteria 5647
193 Ga0207706_10060687 3300025933 Bacteria 3330
194 Ga0207706_10145017 3300025933 Bacteria 2089
195 Ga0207706_10694248 3300025933 Bacteria 870
196 Ga0207706_11088416 3300025933 Bacteria 668
197 Ga0207706_11160793 3300025933 Unclassified 643
198 Ga0207669_10038418 3300025937 Bacteria 2756
199 Ga0207669_10065427 3300025937 Bacteria 2255
200 Ga0207669_11231881 3300025937 Bacteria 634
201 Ga0207704_10201833 3300025938 Bacteria 1456
202 Ga0207665_10041381 3300025939 Bacteria 3077
203 Ga0207691_10064998 3300025940 Bacteria 3303
204 Ga0207691_10376948 3300025940 Bacteria 1212
205 Ga0207711_10063847 3300025941 Bacteria 3180
206 Ga0207711_10156018 3300025941 Bacteria 2063
207 Ga0207711_10170484 3300025941 Bacteria 1975
208 Ga0207689_10038581 3300025942 Bacteria 3955
209 Ga0207661_10016378 3300025944 Bacteria 5467
210 Ga0207661_10243855 3300025944 Bacteria 1595
211 Ga0207661_11596376 3300025944 Bacteria 597
212 Ga0207679_10113565 3300025945 Bacteria 2143
213 Ga0207679_10380863 3300025945 Bacteria 1237
214 Ga0207667_10001743 3300025949 Bacteria 27391
215 Ga0207667_10039879 3300025949 Bacteria 5001
216 Ga0207667_11083091 3300025949 Bacteria 785
217 Ga0207651_10077964 3300025960 Bacteria 2374
218 Ga0207651_10789189 3300025960 Bacteria 841
219 Ga0207651_11197058 3300025960 Bacteria 682
220 Ga0207668_10000050 3300025972 Bacteria 98767
221 Ga0207668_11450130 3300025972 Bacteria 619
222 Ga0207640_10067703 3300025981 Bacteria 2391
223 Ga0207640_10086865 3300025981 Bacteria 2155
224 Ga0207640_10154398 3300025981 Bacteria 1690
225 Ga0207640_11212695 3300025981 Bacteria 671
226 Ga0207658_10019610 3300025986 Bacteria 4677
227 Ga0207658_10205478 3300025986 Bacteria 1647
228 Ga0207677_10175723 3300026023 Bacteria 1679
229 Ga0207677_10641554 3300026023 Bacteria 936
230 Ga0207677_11408486 3300026023 Bacteria 642
231 Ga0207703_10025427 3300026035 Bacteria 4656
232 Ga0207639_10123636 3300026041 Bacteria 2130
233 Ga0207639_10143689 3300026041 Bacteria 1991
234 Ga0207678_10062016 3300026067 Bacteria 3215
235 Ga0207678_10174378 3300026067 Bacteria 1836
236 Ga0207702_10095155 3300026078 Bacteria 2616
237 Ga0207702_10276818 3300026078 Bacteria 1585
238 Ga0207702_11619637 3300026078 Bacteria 641
239 Ga0207641_10491640 3300026088 Bacteria 1190
240 Ga0207648_10000477 3300026089 Bacteria 44735
241 Ga0207648_10091749 3300026089 Bacteria 2655
242 Ga0207674_10000086 3300026116 Bacteria 100722
243 Ga0207674_10018771 3300026116 Bacteria 7504
244 Ga0207674_11298859 3300026116 Bacteria 697
245 Ga0207683_10002346 3300026121 Bacteria 16588
246 Ga0207698_10004572 3300026142 Bacteria 8447
247 Ga0207698_10162665 3300026142 Bacteria 1954
248 Ga0207698_10731762 3300026142 Bacteria 987
249 Ga0268266_10005693 3300028379 Bacteria 11551
250 Ga0268266_10173419 3300028379 Bacteria 1959
251 Ga0268266_11231979 3300028379 Bacteria 723
252 Ga0268266_11496949 3300028379 Bacteria 650
253 Ga0268265_10002247 3300028380 Bacteria 14813
254 Ga0268265_10124509 3300028380 Bacteria 2130
255 Ga0268264_10005610 3300028381 Bacteria 10631
256 Ga0307517_10284482 3300028786 Bacteria 940
257 Ga0307408_100256546 3300031548 Bacteria 1445
258 Ga0307413_11693042 3300031824 Unclassified 564
259 Ga0307410_10643639 3300031852 Bacteria 888
260 Ga0307407_10059829 3300031903 Bacteria 2220
261 Ga0307412_10125312 3300031911 Bacteria 1857
262 Ga0307409_100025664 3300031995 Bacteria 4138
263 Ga0307414_10081623 3300032004 Bacteria 2368
264 Ga0307414_10212870 3300032004 Bacteria 1581
265 Ga0307411_10008917 3300032005 Bacteria 5233
266 Ga0307411_10304474 3300032005 Bacteria 1279
267 Ga0373931_0272841 3300035691 Bacteria 1036
268 Ga0395899_0001168 3300037312 Bacteria 23178
269 Ga0395899_0010312 3300037312 Bacteria 7164
270 Ga0395899_0412480 3300037312 Bacteria 891
271 Ga0395899_0541548 3300037312 Bacteria 749
272 Ga0395899_0624037 3300037312 Bacteria 684
273 Ga0395900_0004550 3300037418 Bacteria 14660
274 Ga0395900_0011630 3300037418 Bacteria 9006
275 Ga0395900_0051135 3300037418 Bacteria 4257
276 Ga0395900_0059823 3300037418 Bacteria 3921
277 Ga0395900_0079451 3300037418 Bacteria 3371
278 Ga0395900_0151945 3300037418 Bacteria 2365
279 Ga0395900_0152070 3300037418 Bacteria 2364
280 Ga0395900_0284130 3300037418 Bacteria 1645
281 Ga0395900_0299577 3300037418 Bacteria 1594
282 Ga0395900_0317199 3300037418 Bacteria 1540
283 Ga0395900_0857625 3300037418 Bacteria 833
284 Ga0395900_1258548 3300037418 Bacteria 654
285 Ga0395900_1422021 3300037418 Bacteria 606
286 Ga0395898_0005145 3300037466 Bacteria 14151
287 Ga0395898_0006548 3300037466 Bacteria 12428
288 Ga0395898_0038814 3300037466 Bacteria 4716
289 Ga0395898_0137749 3300037466 Bacteria 2337
290 Ga0395898_0170978 3300037466 Bacteria 2077
291 Ga0395898_1082156 3300037466 Bacteria 735
292 Ga0395905_0000226 3300037471 Bacteria 85938
293 Ga0395905_0001115 3300037471 Bacteria 33668
294 Ga0395905_0004289 3300037471 Bacteria 14867
295 Ga0395905_0011487 3300037471 Bacteria 8557
296 Ga0395905_0023002 3300037471 Bacteria 5891
297 Ga0395905_0030577 3300037471 Bacteria 5072
298 Ga0395905_0032716 3300037471 Bacteria 4888
299 Ga0395905_0041136 3300037471 Bacteria 4336
300 Ga0395905_0051397 3300037471 Bacteria 3860
301 Ga0395905_0065097 3300037471 Bacteria 3412
302 Ga0395905_0072920 3300037471 Bacteria 3218
303 Ga0395905_0142485 3300037471 Bacteria 2254
304 Ga0395905_0193584 3300037471 Bacteria 1907
305 Ga0395905_0197355 3300037471 Bacteria 1887
306 Ga0395905_0223626 3300037471 Bacteria 1761
307 Ga0395905_0763157 3300037471 Bacteria 870
308 Ga0395901_0000086 3300038443 Bacteria 125359
309 Ga0395901_0007304 3300038443 Bacteria 11151
310 Ga0395901_0009294 3300038443 Bacteria 9964
311 Ga0395901_0024288 3300038443 Bacteria 6220
312 Ga0395901_0025514 3300038443 Bacteria 6068
313 Ga0395901_0051422 3300038443 Bacteria 4284
314 Ga0395901_0115314 3300038443 Bacteria 2822
315 Ga0395901_0166274 3300038443 Bacteria 2316
316 Ga0395901_0237657 3300038443 Bacteria 1901
317 Ga0395901_0376591 3300038443 Bacteria 1461
318 Ga0395901_0453636 3300038443 Bacteria 1311
319 Ga0395901_0979997 3300038443 Bacteria 822
320 Ga0395901_1556858 3300038443 Bacteria 615
321 Ga0395901_2097824 3300038443 Bacteria 510
322 Ga0436365_0011760 3300039437 Bacteria 6122
323 Ga0436363_1494179 3300039450 Bacteria 708
324 Ga0436362_0020775 3300039453 Bacteria 711
325 Ga0450898_034301 3300042134 Bacteria 942
326 Ga0439464_0129489 3300042439 Bacteria 781
327 Ga0466966_0715502 3300044684 Bacteria 603
328 Ga0466968_0222432 3300044735 Bacteria 889
329 Ga0466957_0452244 3300044842 Bacteria 885
330 Ga0466959_0118039 3300045049 Bacteria 1888
331 Ga0466958_0015404 3300045836 Bacteria 4382
332 Ga0495629_0061928 3300046459 Bacteria 2615
333 Ga0495580_0162998 3300046472 Bacteria 1543
334 Ga0495663_0007957 3300046525 Bacteria 2931
335 Ga0495642_0238825 3300046528 Bacteria 794
336 Ga0495647_0012706 3300046681 Bacteria 2905
337 Ga0495669_0002680 3300046684 Bacteria 7288
338 Ga0495669_0011271 3300046684 Bacteria 3794
339 Ga0495669_0348452 3300046684 Bacteria 716
340 Ga0495669_0462859 3300046684 Bacteria 616
341 Ga0495671_0230912 3300046692 Unclassified 895
342 Ga0495683_0436933 3300047323 Bacteria 539
343 Ga0495677_0020309 3300047445 Bacteria 2408
344 Ga0495677_0433824 3300047445 Unclassified 520
345 Ga0496101_0976678 3300048904 Bacteria 666
346 Ga0496102_1457916 3300048905 Bacteria 603
347 Ga0496102_1527584 3300048905 Bacteria 586
348 Ga0496108_0285311 3300048911 Bacteria 1437
349 Ga0496109_0254412 3300048912 Bacteria 1654
350 Ga0496110_0063358 3300048913 Bacteria 3267
351 Ga0496110_0695402 3300048913 Bacteria 918
352 Ga0496111_0544129 3300048914 Bacteria 853
353 Ga0496112_0011015 3300048915 Bacteria 8241
354 Ga0496112_0025583 3300048915 Bacteria 5668
355 Ga0496112_0287746 3300048915 Bacteria 1590
356 Ga0496113_0870771 3300048916 Bacteria 713
357 Ga0501047_0390694 3300049581 Bacteria 1225
358 Ga0501071_0113917 3300049587 Bacteria 2000
359 nmdc:mga00v17_570464_c1 3300050491 Bacteria 731
360 nmdc:mga0sz30_215231_c1 3300050516 Bacteria 854
361 Ga0495655_0058822 3300053083 Bacteria 1042

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0317199 Ga0395900_0317199_181_453 72
2 3300038443 Ga0395901_0000086 Ga0395901_0000086_35161_35433 72
3 3300005343 Ga0070687_100955257 Ga0070687_1009552571 80
4 3300005353 Ga0070669_100625587 Ga0070669_1006255872 80
5 3300031824 Ga0307413_11693042 Ga0307413_116930421 80
6 3300013297 Ga0157378_11763324 Ga0157378_117633242 81
7 3300032004 Ga0307414_10212870 Ga0307414_102128702 81
8 3300032005 Ga0307411_10304474 Ga0307411_103044742 81
9 3300001979 JGI24740J21852_10010885 JGI24740J21852_100108852 82
10 3300001979 JGI24740J21852_10011998 JGI24740J21852_100119982 82
11 3300002067 JGI24735J21928_10012890 JGI24735J21928_100128904 82
12 3300002067 JGI24735J21928_10138584 JGI24735J21928_101385841 82
13 3300002075 JGI24738J21930_10091136 JGI24738J21930_100911362 82
14 3300005327 Ga0070658_10045000 Ga0070658_100450004 82
15 3300005327 Ga0070658_10055221 Ga0070658_100552214 82
16 3300005327 Ga0070658_10095823 Ga0070658_100958231 82
17 3300005327 Ga0070658_10302082 Ga0070658_103020823 82
18 3300005327 Ga0070658_10410637 Ga0070658_104106373 82
19 3300005327 Ga0070658_11351473 Ga0070658_113514731 82
20 3300005329 Ga0070683_100054260 Ga0070683_1000542602 82
21 3300005329 Ga0070683_100136801 Ga0070683_1001368012 82
22 3300005330 Ga0070690_100231818 Ga0070690_1002318182 82
23 3300005331 Ga0070670_100089266 Ga0070670_1000892662 82
24 3300005334 Ga0068869_100097744 Ga0068869_1000977442 82
25 3300005335 Ga0070666_10151123 Ga0070666_101511232 82
26 3300005335 Ga0070666_11223821 Ga0070666_112238212 82
27 3300005336 Ga0070680_100043155 Ga0070680_1000431552 82
28 3300005336 Ga0070680_100079044 Ga0070680_1000790442 82
29 3300005337 Ga0070682_100026226 Ga0070682_1000262262 82
30 3300005337 Ga0070682_101498734 Ga0070682_1014987342 82
31 3300005338 Ga0068868_100590844 Ga0068868_1005908442 82
32 3300005338 Ga0068868_101247934 Ga0068868_1012479341 82
33 3300005339 Ga0070660_100000156 Ga0070660_10000015634 82
34 3300005339 Ga0070660_100047686 Ga0070660_1000476863 82
35 3300005339 Ga0070660_101599499 Ga0070660_1015994992 82
36 3300005341 Ga0070691_10541880 Ga0070691_105418801 82
37 3300005344 Ga0070661_100030483 Ga0070661_1000304833 82
38 3300005344 Ga0070661_100064643 Ga0070661_1000646432 82
39 3300005345 Ga0070692_10059567 Ga0070692_100595672 82
40 3300005347 Ga0070668_100003974 Ga0070668_1000039747 82
41 3300005347 Ga0070668_101047720 Ga0070668_1010477202 82
42 3300005353 Ga0070669_100249845 Ga0070669_1002498452 82
43 3300005353 Ga0070669_100937880 Ga0070669_1009378802 82
44 3300005353 Ga0070669_101429064 Ga0070669_1014290642 82
45 3300005354 Ga0070675_101179939 Ga0070675_1011799392 82
46 3300005355 Ga0070671_100000051 Ga0070671_10000005166 82
47 3300005355 Ga0070671_100007368 Ga0070671_1000073687 82
48 3300005355 Ga0070671_100586598 Ga0070671_1005865982 82
49 3300005355 Ga0070671_100966068 Ga0070671_1009660682 82
50 3300005356 Ga0070674_100021811 Ga0070674_1000218112 82
51 3300005364 Ga0070673_100048432 Ga0070673_1000484322 82
52 3300005364 Ga0070673_100666042 Ga0070673_1006660421 82
53 3300005366 Ga0070659_100764877 Ga0070659_1007648772 82
54 3300005367 Ga0070667_100162418 Ga0070667_1001624182 82
55 3300005367 Ga0070667_100347763 Ga0070667_1003477632 82
56 3300005367 Ga0070667_101534515 Ga0070667_1015345151 82
57 3300005435 Ga0070714_100373220 Ga0070714_1003732202 82
58 3300005436 Ga0070713_100013870 Ga0070713_1000138704 82
59 3300005436 Ga0070713_102300131 Ga0070713_1023001311 82
60 3300005455 Ga0070663_100013811 Ga0070663_1000138115 82
61 3300005455 Ga0070663_100774970 Ga0070663_1007749702 82
62 3300005456 Ga0070678_100017156 Ga0070678_1000171565 82
63 3300005457 Ga0070662_100003196 Ga0070662_1000031966 82
64 3300005457 Ga0070662_100065025 Ga0070662_1000650252 82
65 3300005457 Ga0070662_100337797 Ga0070662_1003377973 82
66 3300005457 Ga0070662_100983171 Ga0070662_1009831712 82
67 3300005457 Ga0070662_101202293 Ga0070662_1012022931 82
68 3300005458 Ga0070681_10036291 Ga0070681_100362912 82
69 3300005459 Ga0068867_100000897 Ga0068867_1000008978 82
70 3300005530 Ga0070679_100001755 Ga0070679_10000175515 82
71 3300005530 Ga0070679_101216332 Ga0070679_1012163321 82
72 3300005535 Ga0070684_100274881 Ga0070684_1002748814 82
73 3300005539 Ga0068853_100064071 Ga0068853_1000640711 82
74 3300005539 Ga0068853_100274659 Ga0068853_1002746592 82
75 3300005539 Ga0068853_100339070 Ga0068853_1003390702 82
76 3300005543 Ga0070672_100098605 Ga0070672_1000986053 82
77 3300005543 Ga0070672_100422164 Ga0070672_1004221642 82
78 3300005543 Ga0070672_101833208 Ga0070672_1018332082 82
79 3300005544 Ga0070686_100159425 Ga0070686_1001594251 82
80 3300005548 Ga0070665_100007253 Ga0070665_1000072539 82
81 3300005548 Ga0070665_100210562 Ga0070665_1002105623 82
82 3300005548 Ga0070665_101658925 Ga0070665_1016589252 82
83 3300005548 Ga0070665_102296040 Ga0070665_1022960402 82
84 3300005563 Ga0068855_100025477 Ga0068855_1000254775 82
85 3300005563 Ga0068855_101068001 Ga0068855_1010680012 82
86 3300005564 Ga0070664_100115606 Ga0070664_1001156062 82
87 3300005564 Ga0070664_100891721 Ga0070664_1008917212 82
88 3300005577 Ga0068857_100053816 Ga0068857_1000538164 82
89 3300005578 Ga0068854_100036550 Ga0068854_1000365502 82
90 3300005578 Ga0068854_100107086 Ga0068854_1001070861 82
91 3300005614 Ga0068856_100323757 Ga0068856_1003237572 82
92 3300005614 Ga0068856_100806367 Ga0068856_1008063672 82
93 3300005616 Ga0068852_100638041 Ga0068852_1006380412 82
94 3300005617 Ga0068859_100167621 Ga0068859_1001676212 82
95 3300005617 Ga0068859_101227853 Ga0068859_1012278532 82
96 3300005618 Ga0068864_100530316 Ga0068864_1005303162 82
97 3300005834 Ga0068851_10023068 Ga0068851_100230684 82
98 3300005834 Ga0068851_10969458 Ga0068851_109694582 82
99 3300005840 Ga0068870_10572511 Ga0068870_105725112 82
100 3300005840 Ga0068870_11120826 Ga0068870_111208262 82
101 3300005841 Ga0068863_100248239 Ga0068863_1002482393 82
102 3300005842 Ga0068858_101687113 Ga0068858_1016871132 82
103 3300005842 Ga0068858_101752292 Ga0068858_1017522922 82
104 3300005843 Ga0068860_100015105 Ga0068860_1000151054 82
105 3300005844 Ga0068862_100003115 Ga0068862_10000311516 82
106 3300005844 Ga0068862_100126062 Ga0068862_1001260622 82
107 3300006028 Ga0070717_10002279 Ga0070717_1000227910 82
108 3300006051 Ga0075364_10224366 Ga0075364_102243662 82
109 3300006173 Ga0070716_100026158 Ga0070716_1000261584 82
110 3300006175 Ga0070712_101434016 Ga0070712_1014340162 82
111 3300006195 Ga0075366_10063578 Ga0075366_100635782 82
112 3300006237 Ga0097621_100056166 Ga0097621_1000561663 82
113 3300006358 Ga0068871_100033052 Ga0068871_1000330525 82
114 3300006358 Ga0068871_100108272 Ga0068871_1001082722 82
115 3300006881 Ga0068865_100130939 Ga0068865_1001309393 82
116 3300006881 Ga0068865_101683465 Ga0068865_1016834652 82
117 3300006931 Ga0097620_100167605 Ga0097620_1001676052 82
118 3300006931 Ga0097620_101227901 Ga0097620_1012279012 82
119 3300009093 Ga0105240_10186087 Ga0105240_101860872 82
120 3300009093 Ga0105240_10249915 Ga0105240_102499154 82
121 3300009174 Ga0105241_10431722 Ga0105241_104317222 82
122 3300009177 Ga0105248_10065912 Ga0105248_100659125 82
123 3300009177 Ga0105248_10082989 Ga0105248_100829892 82
124 3300009545 Ga0105237_10527517 Ga0105237_105275172 82
125 3300009551 Ga0105238_10048577 Ga0105238_100485772 82
126 3300009553 Ga0105249_11559426 Ga0105249_115594262 82
127 3300010375 Ga0105239_12160656 Ga0105239_121606562 82
128 3300013100 Ga0157373_10078112 Ga0157373_100781121 82
129 3300013104 Ga0157370_10005529 Ga0157370_100055298 82
130 3300013104 Ga0157370_10544396 Ga0157370_105443961 82
131 3300013104 Ga0157370_10906538 Ga0157370_109065382 82
132 3300013105 Ga0157369_10105660 Ga0157369_101056605 82
133 3300013105 Ga0157369_10190367 Ga0157369_101903674 82
134 3300013105 Ga0157369_11867889 Ga0157369_118678892 82
135 3300013296 Ga0157374_10036755 Ga0157374_100367552 82
136 3300013297 Ga0157378_10151548 Ga0157378_101515484 82
137 3300013297 Ga0157378_11253464 Ga0157378_112534642 82
138 3300013307 Ga0157372_11065836 Ga0157372_110658362 82
139 3300013308 Ga0157375_10381048 Ga0157375_103810482 82
140 3300014325 Ga0163163_12553711 Ga0163163_125537112 82
141 3300014326 Ga0157380_12354055 Ga0157380_123540552 82
142 3300014745 Ga0157377_10183792 Ga0157377_101837923 82
143 3300014968 Ga0157379_10486330 Ga0157379_104863302 82
144 3300020082 Ga0206353_10212220 Ga0206353_102122202 82
145 3300020082 Ga0206353_11509116 Ga0206353_115091161 82
146 3300021377 Ga0213874_10279875 Ga0213874_102798752 82
147 3300021384 Ga0213876_10068666 Ga0213876_100686663 82
148 3300025315 Ga0207697_10008967 Ga0207697_100089675 82
149 3300025899 Ga0207642_10368982 Ga0207642_103689822 82
150 3300025903 Ga0207680_10167743 Ga0207680_101677431 82
151 3300025903 Ga0207680_10385142 Ga0207680_103851422 82
152 3300025903 Ga0207680_11004481 Ga0207680_110044812 82
153 3300025903 Ga0207680_11085321 Ga0207680_110853212 82
154 3300025904 Ga0207647_10004422 Ga0207647_100044227 82
155 3300025904 Ga0207647_10011065 Ga0207647_100110652 82
156 3300025904 Ga0207647_10044807 Ga0207647_100448072 82
157 3300025904 Ga0207647_10120413 Ga0207647_101204133 82
158 3300025904 Ga0207647_10251941 Ga0207647_102519412 82
159 3300025904 Ga0207647_10481448 Ga0207647_104814482 82
160 3300025906 Ga0207699_10439442 Ga0207699_104394422 82
161 3300025907 Ga0207645_10120726 Ga0207645_101207262 82
162 3300025908 Ga0207643_10325009 Ga0207643_103250092 82
163 3300025909 Ga0207705_10000067 Ga0207705_10000067121 82
164 3300025909 Ga0207705_10013233 Ga0207705_100132331 82
165 3300025909 Ga0207705_10119253 Ga0207705_101192533 82
166 3300025909 Ga0207705_10396737 Ga0207705_103967372 82
167 3300025909 Ga0207705_10731112 Ga0207705_107311122 82
168 3300025909 Ga0207705_10889245 Ga0207705_108892452 82
169 3300025909 Ga0207705_11499752 Ga0207705_114997521 82
170 3300025913 Ga0207695_10028926 Ga0207695_100289264 82
171 3300025913 Ga0207695_10119591 Ga0207695_101195912 82
172 3300025914 Ga0207671_10115809 Ga0207671_101158092 82
173 3300025917 Ga0207660_10001267 Ga0207660_100012672 82
174 3300025917 Ga0207660_10025542 Ga0207660_100255423 82
175 3300025919 Ga0207657_10002451 Ga0207657_1000245115 82
176 3300025919 Ga0207657_10013245 Ga0207657_100132452 82
177 3300025920 Ga0207649_10024127 Ga0207649_100241273 82
178 3300025920 Ga0207649_10754173 Ga0207649_107541732 82
179 3300025920 Ga0207649_10909765 Ga0207649_109097652 82
180 3300025921 Ga0207652_10001335 Ga0207652_100013359 82
181 3300025921 Ga0207652_11240863 Ga0207652_112408631 82
182 3300025923 Ga0207681_10447623 Ga0207681_104476232 82
183 3300025923 Ga0207681_10588468 Ga0207681_105884682 82
184 3300025923 Ga0207681_10736999 Ga0207681_107369991 82
185 3300025924 Ga0207694_10086106 Ga0207694_100861064 82
186 3300025925 Ga0207650_10055058 Ga0207650_100550582 82
187 3300025925 Ga0207650_10105826 Ga0207650_101058262 82
188 3300025928 Ga0207700_10024719 Ga0207700_100247192 82
189 3300025929 Ga0207664_10044150 Ga0207664_100441504 82
190 3300025929 Ga0207664_10611098 Ga0207664_106110982 82
191 3300025931 Ga0207644_10000627 Ga0207644_1000062714 82
192 3300025931 Ga0207644_10034982 Ga0207644_100349822 82
193 3300025931 Ga0207644_10149074 Ga0207644_101490742 82
194 3300025931 Ga0207644_10651715 Ga0207644_106517152 82
195 3300025932 Ga0207690_10303706 Ga0207690_103037062 82
196 3300025932 Ga0207690_11038650 Ga0207690_110386502 82
197 3300025933 Ga0207706_10022573 Ga0207706_100225734 82
198 3300025933 Ga0207706_10060687 Ga0207706_100606874 82
199 3300025933 Ga0207706_10145017 Ga0207706_101450172 82
200 3300025933 Ga0207706_10694248 Ga0207706_106942481 82
201 3300025933 Ga0207706_11088416 Ga0207706_110884162 82
202 3300025933 Ga0207706_11160793 Ga0207706_111607931 82
203 3300025937 Ga0207669_10038418 Ga0207669_100384182 82
204 3300025937 Ga0207669_10065427 Ga0207669_100654272 82
205 3300025937 Ga0207669_11231881 Ga0207669_112318812 82
206 3300025938 Ga0207704_10201833 Ga0207704_102018332 82
207 3300025939 Ga0207665_10041381 Ga0207665_100413812 82
208 3300025940 Ga0207691_10064998 Ga0207691_100649984 82
209 3300025940 Ga0207691_10376948 Ga0207691_103769482 82
210 3300025941 Ga0207711_10063847 Ga0207711_100638472 82
211 3300025941 Ga0207711_10156018 Ga0207711_101560183 82
212 3300025941 Ga0207711_10170484 Ga0207711_101704843 82
213 3300025942 Ga0207689_10038581 Ga0207689_100385812 82
214 3300025944 Ga0207661_10016378 Ga0207661_100163782 82
215 3300025944 Ga0207661_10243855 Ga0207661_102438552 82
216 3300025944 Ga0207661_11596376 Ga0207661_115963762 82
217 3300025945 Ga0207679_10113565 Ga0207679_101135652 82
218 3300025945 Ga0207679_10380863 Ga0207679_103808632 82
219 3300025949 Ga0207667_10001743 Ga0207667_100017435 82
220 3300025949 Ga0207667_10039879 Ga0207667_100398793 82
221 3300025949 Ga0207667_11083091 Ga0207667_110830911 82
222 3300025960 Ga0207651_10077964 Ga0207651_100779643 82
223 3300025960 Ga0207651_10789189 Ga0207651_107891892 82
224 3300025960 Ga0207651_11197058 Ga0207651_111970582 82
225 3300025972 Ga0207668_10000050 Ga0207668_1000005069 82
226 3300025972 Ga0207668_11450130 Ga0207668_114501302 82
227 3300025981 Ga0207640_10067703 Ga0207640_100677035 82
228 3300025981 Ga0207640_10086865 Ga0207640_100868652 82
229 3300025981 Ga0207640_10154398 Ga0207640_101543981 82
230 3300025981 Ga0207640_11212695 Ga0207640_112126952 82
231 3300025986 Ga0207658_10019610 Ga0207658_100196105 82
232 3300025986 Ga0207658_10205478 Ga0207658_102054781 82
233 3300026023 Ga0207677_10175723 Ga0207677_101757233 82
234 3300026023 Ga0207677_10641554 Ga0207677_106415542 82
235 3300026023 Ga0207677_11408486 Ga0207677_114084862 82
236 3300026035 Ga0207703_10025427 Ga0207703_100254272 82
237 3300026041 Ga0207639_10123636 Ga0207639_101236362 82
238 3300026041 Ga0207639_10143689 Ga0207639_101436894 82
239 3300026067 Ga0207678_10062016 Ga0207678_100620162 82
240 3300026067 Ga0207678_10174378 Ga0207678_101743782 82
241 3300026078 Ga0207702_10095155 Ga0207702_100951552 82
242 3300026078 Ga0207702_10276818 Ga0207702_102768182 82
243 3300026078 Ga0207702_11619637 Ga0207702_116196372 82
244 3300026088 Ga0207641_10491640 Ga0207641_104916403 82
245 3300026089 Ga0207648_10000477 Ga0207648_100004777 82
246 3300026089 Ga0207648_10091749 Ga0207648_100917492 82
247 3300026116 Ga0207674_10000086 Ga0207674_1000008620 82
248 3300026116 Ga0207674_10018771 Ga0207674_100187712 82
249 3300026116 Ga0207674_11298859 Ga0207674_112988591 82
250 3300026121 Ga0207683_10002346 Ga0207683_100023468 82
251 3300026142 Ga0207698_10004572 Ga0207698_100045726 82
252 3300026142 Ga0207698_10162665 Ga0207698_101626652 82
253 3300026142 Ga0207698_10731762 Ga0207698_107317621 82
254 3300028379 Ga0268266_10005693 Ga0268266_1000569310 82
255 3300028379 Ga0268266_10173419 Ga0268266_101734193 82
256 3300028379 Ga0268266_11231979 Ga0268266_112319792 82
257 3300028379 Ga0268266_11496949 Ga0268266_114969492 82
258 3300028380 Ga0268265_10002247 Ga0268265_1000224716 82
259 3300028380 Ga0268265_10124509 Ga0268265_101245092 82
260 3300028381 Ga0268264_10005610 Ga0268264_100056102 82
261 3300028786 Ga0307517_10284482 Ga0307517_102844822 82
262 3300031548 Ga0307408_100256546 Ga0307408_1002565462 82
263 3300031852 Ga0307410_10643639 Ga0307410_106436392 82
264 3300031903 Ga0307407_10059829 Ga0307407_100598292 82
265 3300031911 Ga0307412_10125312 Ga0307412_101253121 82
266 3300031995 Ga0307409_100025664 Ga0307409_1000256643 82
267 3300032004 Ga0307414_10081623 Ga0307414_100816232 82
268 3300032005 Ga0307411_10008917 Ga0307411_100089173 82
269 3300035691 Ga0373931_0272841 Ga0373931_0272841_211_483 82
270 3300037312 Ga0395899_0001168 Ga0395899_0001168_18606_18878 82
271 3300037312 Ga0395899_0010312 Ga0395899_0010312_1295_1567 82
272 3300037312 Ga0395899_0412480 Ga0395899_0412480_187_459 82
273 3300037312 Ga0395899_0541548 Ga0395899_0541548_409_681 82
274 3300037312 Ga0395899_0624037 Ga0395899_0624037_296_568 82
275 3300037418 Ga0395900_0004550 Ga0395900_0004550_11348_11620 82
276 3300037418 Ga0395900_0011630 Ga0395900_0011630_2803_3051 82
277 3300037418 Ga0395900_0051135 Ga0395900_0051135_501_773 82
278 3300037418 Ga0395900_0059823 Ga0395900_0059823_3384_3656 82
279 3300037418 Ga0395900_0079451 Ga0395900_0079451_2615_2887 82
280 3300037418 Ga0395900_0151945 Ga0395900_0151945_347_619 82
281 3300037418 Ga0395900_0152070 Ga0395900_0152070_1718_1990 82
282 3300037418 Ga0395900_0284130 Ga0395900_0284130_884_1156 82
283 3300037418 Ga0395900_0299577 Ga0395900_0299577_607_879 82
284 3300037418 Ga0395900_0857625 Ga0395900_0857625_341_613 82
285 3300037418 Ga0395900_1258548 Ga0395900_1258548_91_363 82
286 3300037418 Ga0395900_1422021 Ga0395900_1422021_230_502 82
287 3300037466 Ga0395898_0005145 Ga0395898_0005145_11648_11920 82
288 3300037466 Ga0395898_0006548 Ga0395898_0006548_9312_9584 82
289 3300037466 Ga0395898_0038814 Ga0395898_0038814_3699_3947 82
290 3300037466 Ga0395898_0137749 Ga0395898_0137749_1229_1501 82
291 3300037466 Ga0395898_0170978 Ga0395898_0170978_1169_1441 82
292 3300037466 Ga0395898_1082156 Ga0395898_1082156_317_589 82
293 3300037471 Ga0395905_0000226 Ga0395905_0000226_4207_4479 82
294 3300037471 Ga0395905_0001115 Ga0395905_0001115_22051_22323 82
295 3300037471 Ga0395905_0004289 Ga0395905_0004289_6752_7024 82
296 3300037471 Ga0395905_0011487 Ga0395905_0011487_1299_1571 82
297 3300037471 Ga0395905_0023002 Ga0395905_0023002_3010_3267 82
298 3300037471 Ga0395905_0030577 Ga0395905_0030577_730_1002 82
299 3300037471 Ga0395905_0032716 Ga0395905_0032716_3871_4119 82
300 3300037471 Ga0395905_0041136 Ga0395905_0041136_1086_1358 82
301 3300037471 Ga0395905_0051397 Ga0395905_0051397_2832_3104 82
302 3300037471 Ga0395905_0065097 Ga0395905_0065097_196_468 82
303 3300037471 Ga0395905_0072920 Ga0395905_0072920_2718_2990 82
304 3300037471 Ga0395905_0142485 Ga0395905_0142485_1796_2068 82
305 3300037471 Ga0395905_0193584 Ga0395905_0193584_794_1066 82
306 3300037471 Ga0395905_0197355 Ga0395905_0197355_223_495 82
307 3300037471 Ga0395905_0223626 Ga0395905_0223626_69_341 82
308 3300037471 Ga0395905_0763157 Ga0395905_0763157_74_346 82
309 3300038443 Ga0395901_0007304 Ga0395901_0007304_10134_10382 82
310 3300038443 Ga0395901_0009294 Ga0395901_0009294_6506_6778 82
311 3300038443 Ga0395901_0024288 Ga0395901_0024288_1181_1453 82
312 3300038443 Ga0395901_0025514 Ga0395901_0025514_3185_3457 82
313 3300038443 Ga0395901_0051422 Ga0395901_0051422_3997_4269 82
314 3300038443 Ga0395901_0115314 Ga0395901_0115314_552_824 82
315 3300038443 Ga0395901_0166274 Ga0395901_0166274_1649_1921 82
316 3300038443 Ga0395901_0237657 Ga0395901_0237657_1444_1716 82
317 3300038443 Ga0395901_0376591 Ga0395901_0376591_440_712 82
318 3300038443 Ga0395901_0453636 Ga0395901_0453636_108_380 82
319 3300038443 Ga0395901_0979997 Ga0395901_0979997_267_539 82
320 3300038443 Ga0395901_1556858 Ga0395901_1556858_187_459 82
321 3300038443 Ga0395901_2097824 Ga0395901_2097824_40_312 82
322 3300039437 Ga0436365_0011760 Ga0436365_0011760_4240_4512 82
323 3300039450 Ga0436363_1494179 Ga0436363_1494179_153_425 82
324 3300039453 Ga0436362_0020775 Ga0436362_0020775_397_669 82
325 3300042134 Ga0450898_034301 Ga0450898_034301_336_608 82
326 3300042439 Ga0439464_0129489 Ga0439464_0129489_435_707 82
327 3300044684 Ga0466966_0715502 Ga0466966_0715502_110_382 82
328 3300044735 Ga0466968_0222432 Ga0466968_0222432_453_725 82
329 3300044842 Ga0466957_0452244 Ga0466957_0452244_514_786 82
330 3300045049 Ga0466959_0118039 Ga0466959_0118039_493_765 82
331 3300045836 Ga0466958_0015404 Ga0466958_0015404_3763_4014 82
332 3300046459 Ga0495629_0061928 Ga0495629_0061928_433_705 82
333 3300046472 Ga0495580_0162998 Ga0495580_0162998_573_845 82
334 3300046525 Ga0495663_0007957 Ga0495663_0007957_33_317 82
335 3300046528 Ga0495642_0238825 Ga0495642_0238825_85_357 82
336 3300046681 Ga0495647_0012706 Ga0495647_0012706_1313_1585 82
337 3300046684 Ga0495669_0002680 Ga0495669_0002680_6919_7203 82
338 3300046684 Ga0495669_0011271 Ga0495669_0011271_1856_2128 82
339 3300046684 Ga0495669_0348452 Ga0495669_0348452_143_394 82
340 3300046684 Ga0495669_0462859 Ga0495669_0462859_190_462 82
341 3300046692 Ga0495671_0230912 Ga0495671_0230912_591_863 82
342 3300047323 Ga0495683_0436933 Ga0495683_0436933_26_298 82
343 3300047445 Ga0495677_0020309 Ga0495677_0020309_2008_2292 82
344 3300047445 Ga0495677_0433824 Ga0495677_0433824_211_483 82
345 3300048904 Ga0496101_0976678 Ga0496101_0976678_92_364 82
346 3300048905 Ga0496102_1457916 Ga0496102_1457916_73_360 82
347 3300048905 Ga0496102_1527584 Ga0496102_1527584_118_390 82
348 3300048911 Ga0496108_0285311 Ga0496108_0285311_871_1143 82
349 3300048912 Ga0496109_0254412 Ga0496109_0254412_1127_1399 82
350 3300048913 Ga0496110_0063358 Ga0496110_0063358_1498_1770 82
351 3300048913 Ga0496110_0695402 Ga0496110_0695402_625_897 82
352 3300048914 Ga0496111_0544129 Ga0496111_0544129_68_340 82
353 3300048915 Ga0496112_0011015 Ga0496112_0011015_4896_5168 82
354 3300048915 Ga0496112_0025583 Ga0496112_0025583_1993_2265 82
355 3300048915 Ga0496112_0287746 Ga0496112_0287746_706_978 82
356 3300048916 Ga0496113_0870771 Ga0496113_0870771_361_633 82
357 3300049581 Ga0501047_0390694 Ga0501047_0390694_823_1125 82
358 3300049587 Ga0501071_0113917 Ga0501071_0113917_112_414 82
359 3300050491 nmdc:mga00v17_570464_c1 nmdc:mga00v17_570464_c1_385_657 82
360 3300050516 nmdc:mga0sz30_215231_c1 nmdc:mga0sz30_215231_c1_32_304 82
361 3300053083 Ga0495655_0058822 Ga0495655_0058822_416_688 82

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

1

48

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z81-assembly1.cif.gz_C trimeric structure of vibrio cholerae heat shock protein 15 at 2.3 angstrom resolution 0.951 1 81
7asa-assembly1.cif.gz_1 bacillus subtilis ribosome-associated quality control complex state b, multibody refinement focussed on rqch. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo 0.9476 1 82
7ope-assembly1.cif.gz_1 rqch dr variant bound to 50s-peptidyl-trna-rqcp rqc complex (rigid body refinement) 0.9369 1 82
7aqc-assembly1.cif.gz_Y structure of the bacterial rqc complex (decoding state) 0.9327 1 82
1dm9-assembly1.cif.gz_A heat shock protein 15 kd 0.9319 1 81
ID Description Score Start End Superfamily
af_Q2G0R5_1_87_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9508 1 82 3.10.290.10
af_Q25804_3_135_1.10.1050.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S4 Delta 41; Chain A, domain 1;Ribosomal protein S4/S9, N-terminal domain 0.9355 2 47 1.10.1050.10
1dm9A00 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9319 1 81 3.10.290.10
af_Q9XPI8_145_195_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9285 2 48 3.10.290.10
3dh3A01 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9186 1 50 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A437J9H9-F1-model_v4 RNA-binding S4 domain-containing protein 0.9945 2 82 GO:0003723
AF-A0A1S1HCA5-F1-model_v4 RNA-binding S4 domain-containing protein 0.9943 1 81 GO:0003723
AF-A0A4Y9EMD4-F1-model_v4 RNA-binding S4 domain-containing protein 0.9942 1 80 GO:0003723
AF-A0A7Y5IAZ3-F1-model_v4 deleted 0.9932 1 81
AF-A0A258V6S7-F1-model_v4 RNA-binding protein 0.9926 1 82 GO:0003723

Feature Viewer

pLDDT pTM Quality
91.66 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map