F422222
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 361 | 177 | 361 | 89 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_11763324|Ga0157378_117633242 |
| Length | 98 |
| Sequence | VRIDRFLFFIRLVKSRTLAQSIIESGHVRIDGKRVEKSSEEVRAGSVVALPLHDRVRILRVLTLPRRRGPSAEARACYEELTEAAAPFSDQVKGSFGT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 82 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 83 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 132 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 133 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 134 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 135 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 136 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 137 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 138 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 139 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 140 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 141 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 142 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 143 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 144 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 145 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 146 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 147 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 148 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 149 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 150 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 151 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 152 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 153 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 154 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 155 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 156 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 167 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 170 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 171 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 172 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 173 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 176 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 177 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.45 |
| Metatranscriptomes | 0.55 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.11 |
| Nodule | 0 |
| Rhizoplane | 3.32 |
| Rhizosphere | 94.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10010885 | 3300001979 | Bacteria | 3481 |
| 2 | JGI24740J21852_10011998 | 3300001979 | Bacteria | 3279 |
| 3 | JGI24735J21928_10012890 | 3300002067 | Bacteria | 2638 |
| 4 | JGI24735J21928_10138584 | 3300002067 | Bacteria | 702 |
| 5 | JGI24738J21930_10091136 | 3300002075 | Bacteria | 645 |
| 6 | Ga0070658_10045000 | 3300005327 | Bacteria | 3568 |
| 7 | Ga0070658_10055221 | 3300005327 | Bacteria | 3226 |
| 8 | Ga0070658_10095823 | 3300005327 | Bacteria | 2450 |
| 9 | Ga0070658_10302082 | 3300005327 | Bacteria | 1365 |
| 10 | Ga0070658_10410637 | 3300005327 | Bacteria | 1164 |
| 11 | Ga0070658_11351473 | 3300005327 | Bacteria | 618 |
| 12 | Ga0070683_100054260 | 3300005329 | Bacteria | 3716 |
| 13 | Ga0070683_100136801 | 3300005329 | Bacteria | 2320 |
| 14 | Ga0070690_100231818 | 3300005330 | Bacteria | 1299 |
| 15 | Ga0070670_100089266 | 3300005331 | Bacteria | 2650 |
| 16 | Ga0068869_100097744 | 3300005334 | Bacteria | 2217 |
| 17 | Ga0070666_10151123 | 3300005335 | Bacteria | 1620 |
| 18 | Ga0070666_11223821 | 3300005335 | Bacteria | 560 |
| 19 | Ga0070680_100043155 | 3300005336 | Bacteria | 3662 |
| 20 | Ga0070680_100079044 | 3300005336 | Bacteria | 2711 |
| 21 | Ga0070682_100026226 | 3300005337 | Bacteria | 3486 |
| 22 | Ga0070682_101498734 | 3300005337 | Unclassified | 580 |
| 23 | Ga0068868_100590844 | 3300005338 | Bacteria | 983 |
| 24 | Ga0068868_101247934 | 3300005338 | Bacteria | 689 |
| 25 | Ga0070660_100000156 | 3300005339 | Bacteria | 44192 |
| 26 | Ga0070660_100047686 | 3300005339 | Bacteria | 3288 |
| 27 | Ga0070660_101599499 | 3300005339 | Bacteria | 554 |
| 28 | Ga0070691_10541880 | 3300005341 | Bacteria | 679 |
| 29 | Ga0070687_100955257 | 3300005343 | Bacteria | 618 |
| 30 | Ga0070661_100030483 | 3300005344 | Bacteria | 3897 |
| 31 | Ga0070661_100064643 | 3300005344 | Bacteria | 2688 |
| 32 | Ga0070692_10059567 | 3300005345 | Bacteria | 2007 |
| 33 | Ga0070668_100003974 | 3300005347 | Bacteria | 10940 |
| 34 | Ga0070668_101047720 | 3300005347 | Bacteria | 734 |
| 35 | Ga0070669_100249845 | 3300005353 | Bacteria | 1412 |
| 36 | Ga0070669_100625587 | 3300005353 | Bacteria | 904 |
| 37 | Ga0070669_100937880 | 3300005353 | Bacteria | 740 |
| 38 | Ga0070669_101429064 | 3300005353 | Bacteria | 600 |
| 39 | Ga0070675_101179939 | 3300005354 | Bacteria | 705 |
| 40 | Ga0070671_100000051 | 3300005355 | Bacteria | 79207 |
| 41 | Ga0070671_100007368 | 3300005355 | Bacteria | 8789 |
| 42 | Ga0070671_100586598 | 3300005355 | Bacteria | 963 |
| 43 | Ga0070671_100966068 | 3300005355 | Bacteria | 746 |
| 44 | Ga0070674_100021811 | 3300005356 | Bacteria | 4120 |
| 45 | Ga0070673_100048432 | 3300005364 | Bacteria | 3313 |
| 46 | Ga0070673_100666042 | 3300005364 | Bacteria | 954 |
| 47 | Ga0070659_100764877 | 3300005366 | Bacteria | 838 |
| 48 | Ga0070667_100162418 | 3300005367 | Bacteria | 1968 |
| 49 | Ga0070667_100347763 | 3300005367 | Bacteria | 1342 |
| 50 | Ga0070667_101534515 | 3300005367 | Bacteria | 626 |
| 51 | Ga0070714_100373220 | 3300005435 | Bacteria | 1343 |
| 52 | Ga0070713_100013870 | 3300005436 | Bacteria | 5965 |
| 53 | Ga0070713_102300131 | 3300005436 | Bacteria | 522 |
| 54 | Ga0070663_100013811 | 3300005455 | Bacteria | 5166 |
| 55 | Ga0070663_100774970 | 3300005455 | Bacteria | 821 |
| 56 | Ga0070678_100017156 | 3300005456 | Bacteria | 4653 |
| 57 | Ga0070662_100003196 | 3300005457 | Bacteria | 10186 |
| 58 | Ga0070662_100065025 | 3300005457 | Bacteria | 2672 |
| 59 | Ga0070662_100337797 | 3300005457 | Bacteria | 1232 |
| 60 | Ga0070662_100983171 | 3300005457 | Bacteria | 722 |
| 61 | Ga0070662_101202293 | 3300005457 | Bacteria | 652 |
| 62 | Ga0070681_10036291 | 3300005458 | Bacteria | 4949 |
| 63 | Ga0068867_100000897 | 3300005459 | Bacteria | 20193 |
| 64 | Ga0070679_100001755 | 3300005530 | Bacteria | 19530 |
| 65 | Ga0070679_101216332 | 3300005530 | Bacteria | 699 |
| 66 | Ga0070684_100274881 | 3300005535 | Bacteria | 1543 |
| 67 | Ga0068853_100064071 | 3300005539 | Bacteria | 3186 |
| 68 | Ga0068853_100274659 | 3300005539 | Bacteria | 1552 |
| 69 | Ga0068853_100339070 | 3300005539 | Bacteria | 1396 |
| 70 | Ga0070672_100098605 | 3300005543 | Bacteria | 2367 |
| 71 | Ga0070672_100422164 | 3300005543 | Bacteria | 1145 |
| 72 | Ga0070672_101833208 | 3300005543 | Bacteria | 545 |
| 73 | Ga0070686_100159425 | 3300005544 | Bacteria | 1588 |
| 74 | Ga0070665_100007253 | 3300005548 | Bacteria | 11265 |
| 75 | Ga0070665_100210562 | 3300005548 | Bacteria | 1945 |
| 76 | Ga0070665_101658925 | 3300005548 | Bacteria | 647 |
| 77 | Ga0070665_102296040 | 3300005548 | Bacteria | 542 |
| 78 | Ga0068855_100025477 | 3300005563 | Bacteria | 7076 |
| 79 | Ga0068855_101068001 | 3300005563 | Bacteria | 845 |
| 80 | Ga0070664_100115606 | 3300005564 | Bacteria | 2345 |
| 81 | Ga0070664_100891721 | 3300005564 | Bacteria | 834 |
| 82 | Ga0068857_100053816 | 3300005577 | Bacteria | 3570 |
| 83 | Ga0068854_100036550 | 3300005578 | Bacteria | 3444 |
| 84 | Ga0068854_100107086 | 3300005578 | Bacteria | 2104 |
| 85 | Ga0068856_100323757 | 3300005614 | Bacteria | 1559 |
| 86 | Ga0068856_100806367 | 3300005614 | Bacteria | 958 |
| 87 | Ga0068852_100638041 | 3300005616 | Bacteria | 1072 |
| 88 | Ga0068859_100167621 | 3300005617 | Bacteria | 2276 |
| 89 | Ga0068859_101227853 | 3300005617 | Unclassified | 826 |
| 90 | Ga0068864_100530316 | 3300005618 | Bacteria | 1136 |
| 91 | Ga0068851_10023068 | 3300005834 | Bacteria | 3038 |
| 92 | Ga0068851_10969458 | 3300005834 | Unclassified | 535 |
| 93 | Ga0068870_10572511 | 3300005840 | Bacteria | 763 |
| 94 | Ga0068870_11120826 | 3300005840 | Bacteria | 566 |
| 95 | Ga0068863_100248239 | 3300005841 | Bacteria | 1719 |
| 96 | Ga0068858_101687113 | 3300005842 | Bacteria | 626 |
| 97 | Ga0068858_101752292 | 3300005842 | Bacteria | 613 |
| 98 | Ga0068860_100015105 | 3300005843 | Bacteria | 7547 |
| 99 | Ga0068862_100003115 | 3300005844 | Bacteria | 14451 |
| 100 | Ga0068862_100126062 | 3300005844 | Bacteria | 2260 |
| 101 | Ga0070717_10002279 | 3300006028 | Bacteria | 13455 |
| 102 | Ga0075364_10224366 | 3300006051 | Bacteria | 1276 |
| 103 | Ga0070716_100026158 | 3300006173 | Bacteria | 3122 |
| 104 | Ga0070712_101434016 | 3300006175 | Bacteria | 603 |
| 105 | Ga0075366_10063578 | 3300006195 | Bacteria | 2194 |
| 106 | Ga0097621_100056166 | 3300006237 | Bacteria | 3216 |
| 107 | Ga0068871_100033052 | 3300006358 | Bacteria | 4092 |
| 108 | Ga0068871_100108272 | 3300006358 | Bacteria | 2335 |
| 109 | Ga0068865_100130939 | 3300006881 | Bacteria | 1879 |
| 110 | Ga0068865_101683465 | 3300006881 | Bacteria | 571 |
| 111 | Ga0097620_100167605 | 3300006931 | Bacteria | 2276 |
| 112 | Ga0097620_101227901 | 3300006931 | Unclassified | 826 |
| 113 | Ga0105240_10186087 | 3300009093 | Bacteria | 2446 |
| 114 | Ga0105240_10249915 | 3300009093 | Bacteria | 2052 |
| 115 | Ga0105241_10431722 | 3300009174 | Bacteria | 1162 |
| 116 | Ga0105248_10065912 | 3300009177 | Bacteria | 4066 |
| 117 | Ga0105248_10082989 | 3300009177 | Bacteria | 3605 |
| 118 | Ga0105237_10527517 | 3300009545 | Unclassified | 1187 |
| 119 | Ga0105238_10048577 | 3300009551 | Bacteria | 4276 |
| 120 | Ga0105249_11559426 | 3300009553 | Bacteria | 733 |
| 121 | Ga0105239_12160656 | 3300010375 | Bacteria | 647 |
| 122 | Ga0157373_10078112 | 3300013100 | Bacteria | 2334 |
| 123 | Ga0157370_10005529 | 3300013104 | Bacteria | 14169 |
| 124 | Ga0157370_10544396 | 3300013104 | Bacteria | 1064 |
| 125 | Ga0157370_10906538 | 3300013104 | Bacteria | 800 |
| 126 | Ga0157369_10105660 | 3300013105 | Bacteria | 2997 |
| 127 | Ga0157369_10190367 | 3300013105 | Bacteria | 2156 |
| 128 | Ga0157369_11867889 | 3300013105 | Bacteria | 610 |
| 129 | Ga0157374_10036755 | 3300013296 | Bacteria | 4489 |
| 130 | Ga0157378_10151548 | 3300013297 | Bacteria | 2161 |
| 131 | Ga0157378_11253464 | 3300013297 | Bacteria | 782 |
| 132 | Ga0157378_11763324 | 3300013297 | Bacteria | 667 |
| 133 | Ga0157372_11065836 | 3300013307 | Bacteria | 935 |
| 134 | Ga0157375_10381048 | 3300013308 | Bacteria | 1577 |
| 135 | Ga0163163_12553711 | 3300014325 | Unclassified | 569 |
| 136 | Ga0157380_12354055 | 3300014326 | Bacteria | 597 |
| 137 | Ga0157377_10183792 | 3300014745 | Bacteria | 1317 |
| 138 | Ga0157379_10486330 | 3300014968 | Bacteria | 1143 |
| 139 | Ga0206353_10212220 | 3300020082 | Bacteria | 785 |
| 140 | Ga0206353_11509116 | 3300020082 | Bacteria | 1427 |
| 141 | Ga0213874_10279875 | 3300021377 | Bacteria | 623 |
| 142 | Ga0213876_10068666 | 3300021384 | Bacteria | 1872 |
| 143 | Ga0207697_10008967 | 3300025315 | Bacteria | 4343 |
| 144 | Ga0207642_10368982 | 3300025899 | Bacteria | 851 |
| 145 | Ga0207680_10167743 | 3300025903 | Bacteria | 1477 |
| 146 | Ga0207680_10385142 | 3300025903 | Bacteria | 989 |
| 147 | Ga0207680_11004481 | 3300025903 | Bacteria | 597 |
| 148 | Ga0207680_11085321 | 3300025903 | Bacteria | 572 |
| 149 | Ga0207647_10004422 | 3300025904 | Bacteria | 10420 |
| 150 | Ga0207647_10011065 | 3300025904 | Bacteria | 6343 |
| 151 | Ga0207647_10044807 | 3300025904 | Bacteria | 2762 |
| 152 | Ga0207647_10120413 | 3300025904 | Bacteria | 1548 |
| 153 | Ga0207647_10251941 | 3300025904 | Bacteria | 1012 |
| 154 | Ga0207647_10481448 | 3300025904 | Bacteria | 693 |
| 155 | Ga0207699_10439442 | 3300025906 | Bacteria | 934 |
| 156 | Ga0207645_10120726 | 3300025907 | Bacteria | 1701 |
| 157 | Ga0207643_10325009 | 3300025908 | Bacteria | 961 |
| 158 | Ga0207705_10000067 | 3300025909 | Bacteria | 136004 |
| 159 | Ga0207705_10013233 | 3300025909 | Bacteria | 5955 |
| 160 | Ga0207705_10119253 | 3300025909 | Bacteria | 1956 |
| 161 | Ga0207705_10396737 | 3300025909 | Unclassified | 1067 |
| 162 | Ga0207705_10731112 | 3300025909 | Bacteria | 769 |
| 163 | Ga0207705_10889245 | 3300025909 | Bacteria | 690 |
| 164 | Ga0207705_11499752 | 3300025909 | Bacteria | 510 |
| 165 | Ga0207695_10028926 | 3300025913 | Bacteria | 6134 |
| 166 | Ga0207695_10119591 | 3300025913 | Bacteria | 2604 |
| 167 | Ga0207671_10115809 | 3300025914 | Bacteria | 2044 |
| 168 | Ga0207660_10001267 | 3300025917 | Bacteria | 16955 |
| 169 | Ga0207660_10025542 | 3300025917 | Bacteria | 4011 |
| 170 | Ga0207657_10002451 | 3300025919 | Bacteria | 20037 |
| 171 | Ga0207657_10013245 | 3300025919 | Bacteria | 8093 |
| 172 | Ga0207649_10024127 | 3300025920 | Bacteria | 3531 |
| 173 | Ga0207649_10754173 | 3300025920 | Bacteria | 757 |
| 174 | Ga0207649_10909765 | 3300025920 | Bacteria | 690 |
| 175 | Ga0207652_10001335 | 3300025921 | Bacteria | 21928 |
| 176 | Ga0207652_11240863 | 3300025921 | Bacteria | 648 |
| 177 | Ga0207681_10447623 | 3300025923 | Bacteria | 1050 |
| 178 | Ga0207681_10588468 | 3300025923 | Bacteria | 918 |
| 179 | Ga0207681_10736999 | 3300025923 | Bacteria | 821 |
| 180 | Ga0207694_10086106 | 3300025924 | Bacteria | 2474 |
| 181 | Ga0207650_10055058 | 3300025925 | Bacteria | 2952 |
| 182 | Ga0207650_10105826 | 3300025925 | Bacteria | 2172 |
| 183 | Ga0207700_10024719 | 3300025928 | Bacteria | 4161 |
| 184 | Ga0207664_10044150 | 3300025929 | Bacteria | 3489 |
| 185 | Ga0207664_10611098 | 3300025929 | Unclassified | 979 |
| 186 | Ga0207644_10000627 | 3300025931 | Bacteria | 22496 |
| 187 | Ga0207644_10034982 | 3300025931 | Bacteria | 3517 |
| 188 | Ga0207644_10149074 | 3300025931 | Bacteria | 1809 |
| 189 | Ga0207644_10651715 | 3300025931 | Bacteria | 877 |
| 190 | Ga0207690_10303706 | 3300025932 | Bacteria | 1250 |
| 191 | Ga0207690_11038650 | 3300025932 | Bacteria | 682 |
| 192 | Ga0207706_10022573 | 3300025933 | Bacteria | 5647 |
| 193 | Ga0207706_10060687 | 3300025933 | Bacteria | 3330 |
| 194 | Ga0207706_10145017 | 3300025933 | Bacteria | 2089 |
| 195 | Ga0207706_10694248 | 3300025933 | Bacteria | 870 |
| 196 | Ga0207706_11088416 | 3300025933 | Bacteria | 668 |
| 197 | Ga0207706_11160793 | 3300025933 | Unclassified | 643 |
| 198 | Ga0207669_10038418 | 3300025937 | Bacteria | 2756 |
| 199 | Ga0207669_10065427 | 3300025937 | Bacteria | 2255 |
| 200 | Ga0207669_11231881 | 3300025937 | Bacteria | 634 |
| 201 | Ga0207704_10201833 | 3300025938 | Bacteria | 1456 |
| 202 | Ga0207665_10041381 | 3300025939 | Bacteria | 3077 |
| 203 | Ga0207691_10064998 | 3300025940 | Bacteria | 3303 |
| 204 | Ga0207691_10376948 | 3300025940 | Bacteria | 1212 |
| 205 | Ga0207711_10063847 | 3300025941 | Bacteria | 3180 |
| 206 | Ga0207711_10156018 | 3300025941 | Bacteria | 2063 |
| 207 | Ga0207711_10170484 | 3300025941 | Bacteria | 1975 |
| 208 | Ga0207689_10038581 | 3300025942 | Bacteria | 3955 |
| 209 | Ga0207661_10016378 | 3300025944 | Bacteria | 5467 |
| 210 | Ga0207661_10243855 | 3300025944 | Bacteria | 1595 |
| 211 | Ga0207661_11596376 | 3300025944 | Bacteria | 597 |
| 212 | Ga0207679_10113565 | 3300025945 | Bacteria | 2143 |
| 213 | Ga0207679_10380863 | 3300025945 | Bacteria | 1237 |
| 214 | Ga0207667_10001743 | 3300025949 | Bacteria | 27391 |
| 215 | Ga0207667_10039879 | 3300025949 | Bacteria | 5001 |
| 216 | Ga0207667_11083091 | 3300025949 | Bacteria | 785 |
| 217 | Ga0207651_10077964 | 3300025960 | Bacteria | 2374 |
| 218 | Ga0207651_10789189 | 3300025960 | Bacteria | 841 |
| 219 | Ga0207651_11197058 | 3300025960 | Bacteria | 682 |
| 220 | Ga0207668_10000050 | 3300025972 | Bacteria | 98767 |
| 221 | Ga0207668_11450130 | 3300025972 | Bacteria | 619 |
| 222 | Ga0207640_10067703 | 3300025981 | Bacteria | 2391 |
| 223 | Ga0207640_10086865 | 3300025981 | Bacteria | 2155 |
| 224 | Ga0207640_10154398 | 3300025981 | Bacteria | 1690 |
| 225 | Ga0207640_11212695 | 3300025981 | Bacteria | 671 |
| 226 | Ga0207658_10019610 | 3300025986 | Bacteria | 4677 |
| 227 | Ga0207658_10205478 | 3300025986 | Bacteria | 1647 |
| 228 | Ga0207677_10175723 | 3300026023 | Bacteria | 1679 |
| 229 | Ga0207677_10641554 | 3300026023 | Bacteria | 936 |
| 230 | Ga0207677_11408486 | 3300026023 | Bacteria | 642 |
| 231 | Ga0207703_10025427 | 3300026035 | Bacteria | 4656 |
| 232 | Ga0207639_10123636 | 3300026041 | Bacteria | 2130 |
| 233 | Ga0207639_10143689 | 3300026041 | Bacteria | 1991 |
| 234 | Ga0207678_10062016 | 3300026067 | Bacteria | 3215 |
| 235 | Ga0207678_10174378 | 3300026067 | Bacteria | 1836 |
| 236 | Ga0207702_10095155 | 3300026078 | Bacteria | 2616 |
| 237 | Ga0207702_10276818 | 3300026078 | Bacteria | 1585 |
| 238 | Ga0207702_11619637 | 3300026078 | Bacteria | 641 |
| 239 | Ga0207641_10491640 | 3300026088 | Bacteria | 1190 |
| 240 | Ga0207648_10000477 | 3300026089 | Bacteria | 44735 |
| 241 | Ga0207648_10091749 | 3300026089 | Bacteria | 2655 |
| 242 | Ga0207674_10000086 | 3300026116 | Bacteria | 100722 |
| 243 | Ga0207674_10018771 | 3300026116 | Bacteria | 7504 |
| 244 | Ga0207674_11298859 | 3300026116 | Bacteria | 697 |
| 245 | Ga0207683_10002346 | 3300026121 | Bacteria | 16588 |
| 246 | Ga0207698_10004572 | 3300026142 | Bacteria | 8447 |
| 247 | Ga0207698_10162665 | 3300026142 | Bacteria | 1954 |
| 248 | Ga0207698_10731762 | 3300026142 | Bacteria | 987 |
| 249 | Ga0268266_10005693 | 3300028379 | Bacteria | 11551 |
| 250 | Ga0268266_10173419 | 3300028379 | Bacteria | 1959 |
| 251 | Ga0268266_11231979 | 3300028379 | Bacteria | 723 |
| 252 | Ga0268266_11496949 | 3300028379 | Bacteria | 650 |
| 253 | Ga0268265_10002247 | 3300028380 | Bacteria | 14813 |
| 254 | Ga0268265_10124509 | 3300028380 | Bacteria | 2130 |
| 255 | Ga0268264_10005610 | 3300028381 | Bacteria | 10631 |
| 256 | Ga0307517_10284482 | 3300028786 | Bacteria | 940 |
| 257 | Ga0307408_100256546 | 3300031548 | Bacteria | 1445 |
| 258 | Ga0307413_11693042 | 3300031824 | Unclassified | 564 |
| 259 | Ga0307410_10643639 | 3300031852 | Bacteria | 888 |
| 260 | Ga0307407_10059829 | 3300031903 | Bacteria | 2220 |
| 261 | Ga0307412_10125312 | 3300031911 | Bacteria | 1857 |
| 262 | Ga0307409_100025664 | 3300031995 | Bacteria | 4138 |
| 263 | Ga0307414_10081623 | 3300032004 | Bacteria | 2368 |
| 264 | Ga0307414_10212870 | 3300032004 | Bacteria | 1581 |
| 265 | Ga0307411_10008917 | 3300032005 | Bacteria | 5233 |
| 266 | Ga0307411_10304474 | 3300032005 | Bacteria | 1279 |
| 267 | Ga0373931_0272841 | 3300035691 | Bacteria | 1036 |
| 268 | Ga0395899_0001168 | 3300037312 | Bacteria | 23178 |
| 269 | Ga0395899_0010312 | 3300037312 | Bacteria | 7164 |
| 270 | Ga0395899_0412480 | 3300037312 | Bacteria | 891 |
| 271 | Ga0395899_0541548 | 3300037312 | Bacteria | 749 |
| 272 | Ga0395899_0624037 | 3300037312 | Bacteria | 684 |
| 273 | Ga0395900_0004550 | 3300037418 | Bacteria | 14660 |
| 274 | Ga0395900_0011630 | 3300037418 | Bacteria | 9006 |
| 275 | Ga0395900_0051135 | 3300037418 | Bacteria | 4257 |
| 276 | Ga0395900_0059823 | 3300037418 | Bacteria | 3921 |
| 277 | Ga0395900_0079451 | 3300037418 | Bacteria | 3371 |
| 278 | Ga0395900_0151945 | 3300037418 | Bacteria | 2365 |
| 279 | Ga0395900_0152070 | 3300037418 | Bacteria | 2364 |
| 280 | Ga0395900_0284130 | 3300037418 | Bacteria | 1645 |
| 281 | Ga0395900_0299577 | 3300037418 | Bacteria | 1594 |
| 282 | Ga0395900_0317199 | 3300037418 | Bacteria | 1540 |
| 283 | Ga0395900_0857625 | 3300037418 | Bacteria | 833 |
| 284 | Ga0395900_1258548 | 3300037418 | Bacteria | 654 |
| 285 | Ga0395900_1422021 | 3300037418 | Bacteria | 606 |
| 286 | Ga0395898_0005145 | 3300037466 | Bacteria | 14151 |
| 287 | Ga0395898_0006548 | 3300037466 | Bacteria | 12428 |
| 288 | Ga0395898_0038814 | 3300037466 | Bacteria | 4716 |
| 289 | Ga0395898_0137749 | 3300037466 | Bacteria | 2337 |
| 290 | Ga0395898_0170978 | 3300037466 | Bacteria | 2077 |
| 291 | Ga0395898_1082156 | 3300037466 | Bacteria | 735 |
| 292 | Ga0395905_0000226 | 3300037471 | Bacteria | 85938 |
| 293 | Ga0395905_0001115 | 3300037471 | Bacteria | 33668 |
| 294 | Ga0395905_0004289 | 3300037471 | Bacteria | 14867 |
| 295 | Ga0395905_0011487 | 3300037471 | Bacteria | 8557 |
| 296 | Ga0395905_0023002 | 3300037471 | Bacteria | 5891 |
| 297 | Ga0395905_0030577 | 3300037471 | Bacteria | 5072 |
| 298 | Ga0395905_0032716 | 3300037471 | Bacteria | 4888 |
| 299 | Ga0395905_0041136 | 3300037471 | Bacteria | 4336 |
| 300 | Ga0395905_0051397 | 3300037471 | Bacteria | 3860 |
| 301 | Ga0395905_0065097 | 3300037471 | Bacteria | 3412 |
| 302 | Ga0395905_0072920 | 3300037471 | Bacteria | 3218 |
| 303 | Ga0395905_0142485 | 3300037471 | Bacteria | 2254 |
| 304 | Ga0395905_0193584 | 3300037471 | Bacteria | 1907 |
| 305 | Ga0395905_0197355 | 3300037471 | Bacteria | 1887 |
| 306 | Ga0395905_0223626 | 3300037471 | Bacteria | 1761 |
| 307 | Ga0395905_0763157 | 3300037471 | Bacteria | 870 |
| 308 | Ga0395901_0000086 | 3300038443 | Bacteria | 125359 |
| 309 | Ga0395901_0007304 | 3300038443 | Bacteria | 11151 |
| 310 | Ga0395901_0009294 | 3300038443 | Bacteria | 9964 |
| 311 | Ga0395901_0024288 | 3300038443 | Bacteria | 6220 |
| 312 | Ga0395901_0025514 | 3300038443 | Bacteria | 6068 |
| 313 | Ga0395901_0051422 | 3300038443 | Bacteria | 4284 |
| 314 | Ga0395901_0115314 | 3300038443 | Bacteria | 2822 |
| 315 | Ga0395901_0166274 | 3300038443 | Bacteria | 2316 |
| 316 | Ga0395901_0237657 | 3300038443 | Bacteria | 1901 |
| 317 | Ga0395901_0376591 | 3300038443 | Bacteria | 1461 |
| 318 | Ga0395901_0453636 | 3300038443 | Bacteria | 1311 |
| 319 | Ga0395901_0979997 | 3300038443 | Bacteria | 822 |
| 320 | Ga0395901_1556858 | 3300038443 | Bacteria | 615 |
| 321 | Ga0395901_2097824 | 3300038443 | Bacteria | 510 |
| 322 | Ga0436365_0011760 | 3300039437 | Bacteria | 6122 |
| 323 | Ga0436363_1494179 | 3300039450 | Bacteria | 708 |
| 324 | Ga0436362_0020775 | 3300039453 | Bacteria | 711 |
| 325 | Ga0450898_034301 | 3300042134 | Bacteria | 942 |
| 326 | Ga0439464_0129489 | 3300042439 | Bacteria | 781 |
| 327 | Ga0466966_0715502 | 3300044684 | Bacteria | 603 |
| 328 | Ga0466968_0222432 | 3300044735 | Bacteria | 889 |
| 329 | Ga0466957_0452244 | 3300044842 | Bacteria | 885 |
| 330 | Ga0466959_0118039 | 3300045049 | Bacteria | 1888 |
| 331 | Ga0466958_0015404 | 3300045836 | Bacteria | 4382 |
| 332 | Ga0495629_0061928 | 3300046459 | Bacteria | 2615 |
| 333 | Ga0495580_0162998 | 3300046472 | Bacteria | 1543 |
| 334 | Ga0495663_0007957 | 3300046525 | Bacteria | 2931 |
| 335 | Ga0495642_0238825 | 3300046528 | Bacteria | 794 |
| 336 | Ga0495647_0012706 | 3300046681 | Bacteria | 2905 |
| 337 | Ga0495669_0002680 | 3300046684 | Bacteria | 7288 |
| 338 | Ga0495669_0011271 | 3300046684 | Bacteria | 3794 |
| 339 | Ga0495669_0348452 | 3300046684 | Bacteria | 716 |
| 340 | Ga0495669_0462859 | 3300046684 | Bacteria | 616 |
| 341 | Ga0495671_0230912 | 3300046692 | Unclassified | 895 |
| 342 | Ga0495683_0436933 | 3300047323 | Bacteria | 539 |
| 343 | Ga0495677_0020309 | 3300047445 | Bacteria | 2408 |
| 344 | Ga0495677_0433824 | 3300047445 | Unclassified | 520 |
| 345 | Ga0496101_0976678 | 3300048904 | Bacteria | 666 |
| 346 | Ga0496102_1457916 | 3300048905 | Bacteria | 603 |
| 347 | Ga0496102_1527584 | 3300048905 | Bacteria | 586 |
| 348 | Ga0496108_0285311 | 3300048911 | Bacteria | 1437 |
| 349 | Ga0496109_0254412 | 3300048912 | Bacteria | 1654 |
| 350 | Ga0496110_0063358 | 3300048913 | Bacteria | 3267 |
| 351 | Ga0496110_0695402 | 3300048913 | Bacteria | 918 |
| 352 | Ga0496111_0544129 | 3300048914 | Bacteria | 853 |
| 353 | Ga0496112_0011015 | 3300048915 | Bacteria | 8241 |
| 354 | Ga0496112_0025583 | 3300048915 | Bacteria | 5668 |
| 355 | Ga0496112_0287746 | 3300048915 | Bacteria | 1590 |
| 356 | Ga0496113_0870771 | 3300048916 | Bacteria | 713 |
| 357 | Ga0501047_0390694 | 3300049581 | Bacteria | 1225 |
| 358 | Ga0501071_0113917 | 3300049587 | Bacteria | 2000 |
| 359 | nmdc:mga00v17_570464_c1 | 3300050491 | Bacteria | 731 |
| 360 | nmdc:mga0sz30_215231_c1 | 3300050516 | Bacteria | 854 |
| 361 | Ga0495655_0058822 | 3300053083 | Bacteria | 1042 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037418 | Ga0395900_0317199 | Ga0395900_0317199_181_453 | 72 |
| 2 | 3300038443 | Ga0395901_0000086 | Ga0395901_0000086_35161_35433 | 72 |
| 3 | 3300005343 | Ga0070687_100955257 | Ga0070687_1009552571 | 80 |
| 4 | 3300005353 | Ga0070669_100625587 | Ga0070669_1006255872 | 80 |
| 5 | 3300031824 | Ga0307413_11693042 | Ga0307413_116930421 | 80 |
| 6 | 3300013297 | Ga0157378_11763324 | Ga0157378_117633242 | 81 |
| 7 | 3300032004 | Ga0307414_10212870 | Ga0307414_102128702 | 81 |
| 8 | 3300032005 | Ga0307411_10304474 | Ga0307411_103044742 | 81 |
| 9 | 3300001979 | JGI24740J21852_10010885 | JGI24740J21852_100108852 | 82 |
| 10 | 3300001979 | JGI24740J21852_10011998 | JGI24740J21852_100119982 | 82 |
| 11 | 3300002067 | JGI24735J21928_10012890 | JGI24735J21928_100128904 | 82 |
| 12 | 3300002067 | JGI24735J21928_10138584 | JGI24735J21928_101385841 | 82 |
| 13 | 3300002075 | JGI24738J21930_10091136 | JGI24738J21930_100911362 | 82 |
| 14 | 3300005327 | Ga0070658_10045000 | Ga0070658_100450004 | 82 |
| 15 | 3300005327 | Ga0070658_10055221 | Ga0070658_100552214 | 82 |
| 16 | 3300005327 | Ga0070658_10095823 | Ga0070658_100958231 | 82 |
| 17 | 3300005327 | Ga0070658_10302082 | Ga0070658_103020823 | 82 |
| 18 | 3300005327 | Ga0070658_10410637 | Ga0070658_104106373 | 82 |
| 19 | 3300005327 | Ga0070658_11351473 | Ga0070658_113514731 | 82 |
| 20 | 3300005329 | Ga0070683_100054260 | Ga0070683_1000542602 | 82 |
| 21 | 3300005329 | Ga0070683_100136801 | Ga0070683_1001368012 | 82 |
| 22 | 3300005330 | Ga0070690_100231818 | Ga0070690_1002318182 | 82 |
| 23 | 3300005331 | Ga0070670_100089266 | Ga0070670_1000892662 | 82 |
| 24 | 3300005334 | Ga0068869_100097744 | Ga0068869_1000977442 | 82 |
| 25 | 3300005335 | Ga0070666_10151123 | Ga0070666_101511232 | 82 |
| 26 | 3300005335 | Ga0070666_11223821 | Ga0070666_112238212 | 82 |
| 27 | 3300005336 | Ga0070680_100043155 | Ga0070680_1000431552 | 82 |
| 28 | 3300005336 | Ga0070680_100079044 | Ga0070680_1000790442 | 82 |
| 29 | 3300005337 | Ga0070682_100026226 | Ga0070682_1000262262 | 82 |
| 30 | 3300005337 | Ga0070682_101498734 | Ga0070682_1014987342 | 82 |
| 31 | 3300005338 | Ga0068868_100590844 | Ga0068868_1005908442 | 82 |
| 32 | 3300005338 | Ga0068868_101247934 | Ga0068868_1012479341 | 82 |
| 33 | 3300005339 | Ga0070660_100000156 | Ga0070660_10000015634 | 82 |
| 34 | 3300005339 | Ga0070660_100047686 | Ga0070660_1000476863 | 82 |
| 35 | 3300005339 | Ga0070660_101599499 | Ga0070660_1015994992 | 82 |
| 36 | 3300005341 | Ga0070691_10541880 | Ga0070691_105418801 | 82 |
| 37 | 3300005344 | Ga0070661_100030483 | Ga0070661_1000304833 | 82 |
| 38 | 3300005344 | Ga0070661_100064643 | Ga0070661_1000646432 | 82 |
| 39 | 3300005345 | Ga0070692_10059567 | Ga0070692_100595672 | 82 |
| 40 | 3300005347 | Ga0070668_100003974 | Ga0070668_1000039747 | 82 |
| 41 | 3300005347 | Ga0070668_101047720 | Ga0070668_1010477202 | 82 |
| 42 | 3300005353 | Ga0070669_100249845 | Ga0070669_1002498452 | 82 |
| 43 | 3300005353 | Ga0070669_100937880 | Ga0070669_1009378802 | 82 |
| 44 | 3300005353 | Ga0070669_101429064 | Ga0070669_1014290642 | 82 |
| 45 | 3300005354 | Ga0070675_101179939 | Ga0070675_1011799392 | 82 |
| 46 | 3300005355 | Ga0070671_100000051 | Ga0070671_10000005166 | 82 |
| 47 | 3300005355 | Ga0070671_100007368 | Ga0070671_1000073687 | 82 |
| 48 | 3300005355 | Ga0070671_100586598 | Ga0070671_1005865982 | 82 |
| 49 | 3300005355 | Ga0070671_100966068 | Ga0070671_1009660682 | 82 |
| 50 | 3300005356 | Ga0070674_100021811 | Ga0070674_1000218112 | 82 |
| 51 | 3300005364 | Ga0070673_100048432 | Ga0070673_1000484322 | 82 |
| 52 | 3300005364 | Ga0070673_100666042 | Ga0070673_1006660421 | 82 |
| 53 | 3300005366 | Ga0070659_100764877 | Ga0070659_1007648772 | 82 |
| 54 | 3300005367 | Ga0070667_100162418 | Ga0070667_1001624182 | 82 |
| 55 | 3300005367 | Ga0070667_100347763 | Ga0070667_1003477632 | 82 |
| 56 | 3300005367 | Ga0070667_101534515 | Ga0070667_1015345151 | 82 |
| 57 | 3300005435 | Ga0070714_100373220 | Ga0070714_1003732202 | 82 |
| 58 | 3300005436 | Ga0070713_100013870 | Ga0070713_1000138704 | 82 |
| 59 | 3300005436 | Ga0070713_102300131 | Ga0070713_1023001311 | 82 |
| 60 | 3300005455 | Ga0070663_100013811 | Ga0070663_1000138115 | 82 |
| 61 | 3300005455 | Ga0070663_100774970 | Ga0070663_1007749702 | 82 |
| 62 | 3300005456 | Ga0070678_100017156 | Ga0070678_1000171565 | 82 |
| 63 | 3300005457 | Ga0070662_100003196 | Ga0070662_1000031966 | 82 |
| 64 | 3300005457 | Ga0070662_100065025 | Ga0070662_1000650252 | 82 |
| 65 | 3300005457 | Ga0070662_100337797 | Ga0070662_1003377973 | 82 |
| 66 | 3300005457 | Ga0070662_100983171 | Ga0070662_1009831712 | 82 |
| 67 | 3300005457 | Ga0070662_101202293 | Ga0070662_1012022931 | 82 |
| 68 | 3300005458 | Ga0070681_10036291 | Ga0070681_100362912 | 82 |
| 69 | 3300005459 | Ga0068867_100000897 | Ga0068867_1000008978 | 82 |
| 70 | 3300005530 | Ga0070679_100001755 | Ga0070679_10000175515 | 82 |
| 71 | 3300005530 | Ga0070679_101216332 | Ga0070679_1012163321 | 82 |
| 72 | 3300005535 | Ga0070684_100274881 | Ga0070684_1002748814 | 82 |
| 73 | 3300005539 | Ga0068853_100064071 | Ga0068853_1000640711 | 82 |
| 74 | 3300005539 | Ga0068853_100274659 | Ga0068853_1002746592 | 82 |
| 75 | 3300005539 | Ga0068853_100339070 | Ga0068853_1003390702 | 82 |
| 76 | 3300005543 | Ga0070672_100098605 | Ga0070672_1000986053 | 82 |
| 77 | 3300005543 | Ga0070672_100422164 | Ga0070672_1004221642 | 82 |
| 78 | 3300005543 | Ga0070672_101833208 | Ga0070672_1018332082 | 82 |
| 79 | 3300005544 | Ga0070686_100159425 | Ga0070686_1001594251 | 82 |
| 80 | 3300005548 | Ga0070665_100007253 | Ga0070665_1000072539 | 82 |
| 81 | 3300005548 | Ga0070665_100210562 | Ga0070665_1002105623 | 82 |
| 82 | 3300005548 | Ga0070665_101658925 | Ga0070665_1016589252 | 82 |
| 83 | 3300005548 | Ga0070665_102296040 | Ga0070665_1022960402 | 82 |
| 84 | 3300005563 | Ga0068855_100025477 | Ga0068855_1000254775 | 82 |
| 85 | 3300005563 | Ga0068855_101068001 | Ga0068855_1010680012 | 82 |
| 86 | 3300005564 | Ga0070664_100115606 | Ga0070664_1001156062 | 82 |
| 87 | 3300005564 | Ga0070664_100891721 | Ga0070664_1008917212 | 82 |
| 88 | 3300005577 | Ga0068857_100053816 | Ga0068857_1000538164 | 82 |
| 89 | 3300005578 | Ga0068854_100036550 | Ga0068854_1000365502 | 82 |
| 90 | 3300005578 | Ga0068854_100107086 | Ga0068854_1001070861 | 82 |
| 91 | 3300005614 | Ga0068856_100323757 | Ga0068856_1003237572 | 82 |
| 92 | 3300005614 | Ga0068856_100806367 | Ga0068856_1008063672 | 82 |
| 93 | 3300005616 | Ga0068852_100638041 | Ga0068852_1006380412 | 82 |
| 94 | 3300005617 | Ga0068859_100167621 | Ga0068859_1001676212 | 82 |
| 95 | 3300005617 | Ga0068859_101227853 | Ga0068859_1012278532 | 82 |
| 96 | 3300005618 | Ga0068864_100530316 | Ga0068864_1005303162 | 82 |
| 97 | 3300005834 | Ga0068851_10023068 | Ga0068851_100230684 | 82 |
| 98 | 3300005834 | Ga0068851_10969458 | Ga0068851_109694582 | 82 |
| 99 | 3300005840 | Ga0068870_10572511 | Ga0068870_105725112 | 82 |
| 100 | 3300005840 | Ga0068870_11120826 | Ga0068870_111208262 | 82 |
| 101 | 3300005841 | Ga0068863_100248239 | Ga0068863_1002482393 | 82 |
| 102 | 3300005842 | Ga0068858_101687113 | Ga0068858_1016871132 | 82 |
| 103 | 3300005842 | Ga0068858_101752292 | Ga0068858_1017522922 | 82 |
| 104 | 3300005843 | Ga0068860_100015105 | Ga0068860_1000151054 | 82 |
| 105 | 3300005844 | Ga0068862_100003115 | Ga0068862_10000311516 | 82 |
| 106 | 3300005844 | Ga0068862_100126062 | Ga0068862_1001260622 | 82 |
| 107 | 3300006028 | Ga0070717_10002279 | Ga0070717_1000227910 | 82 |
| 108 | 3300006051 | Ga0075364_10224366 | Ga0075364_102243662 | 82 |
| 109 | 3300006173 | Ga0070716_100026158 | Ga0070716_1000261584 | 82 |
| 110 | 3300006175 | Ga0070712_101434016 | Ga0070712_1014340162 | 82 |
| 111 | 3300006195 | Ga0075366_10063578 | Ga0075366_100635782 | 82 |
| 112 | 3300006237 | Ga0097621_100056166 | Ga0097621_1000561663 | 82 |
| 113 | 3300006358 | Ga0068871_100033052 | Ga0068871_1000330525 | 82 |
| 114 | 3300006358 | Ga0068871_100108272 | Ga0068871_1001082722 | 82 |
| 115 | 3300006881 | Ga0068865_100130939 | Ga0068865_1001309393 | 82 |
| 116 | 3300006881 | Ga0068865_101683465 | Ga0068865_1016834652 | 82 |
| 117 | 3300006931 | Ga0097620_100167605 | Ga0097620_1001676052 | 82 |
| 118 | 3300006931 | Ga0097620_101227901 | Ga0097620_1012279012 | 82 |
| 119 | 3300009093 | Ga0105240_10186087 | Ga0105240_101860872 | 82 |
| 120 | 3300009093 | Ga0105240_10249915 | Ga0105240_102499154 | 82 |
| 121 | 3300009174 | Ga0105241_10431722 | Ga0105241_104317222 | 82 |
| 122 | 3300009177 | Ga0105248_10065912 | Ga0105248_100659125 | 82 |
| 123 | 3300009177 | Ga0105248_10082989 | Ga0105248_100829892 | 82 |
| 124 | 3300009545 | Ga0105237_10527517 | Ga0105237_105275172 | 82 |
| 125 | 3300009551 | Ga0105238_10048577 | Ga0105238_100485772 | 82 |
| 126 | 3300009553 | Ga0105249_11559426 | Ga0105249_115594262 | 82 |
| 127 | 3300010375 | Ga0105239_12160656 | Ga0105239_121606562 | 82 |
| 128 | 3300013100 | Ga0157373_10078112 | Ga0157373_100781121 | 82 |
| 129 | 3300013104 | Ga0157370_10005529 | Ga0157370_100055298 | 82 |
| 130 | 3300013104 | Ga0157370_10544396 | Ga0157370_105443961 | 82 |
| 131 | 3300013104 | Ga0157370_10906538 | Ga0157370_109065382 | 82 |
| 132 | 3300013105 | Ga0157369_10105660 | Ga0157369_101056605 | 82 |
| 133 | 3300013105 | Ga0157369_10190367 | Ga0157369_101903674 | 82 |
| 134 | 3300013105 | Ga0157369_11867889 | Ga0157369_118678892 | 82 |
| 135 | 3300013296 | Ga0157374_10036755 | Ga0157374_100367552 | 82 |
| 136 | 3300013297 | Ga0157378_10151548 | Ga0157378_101515484 | 82 |
| 137 | 3300013297 | Ga0157378_11253464 | Ga0157378_112534642 | 82 |
| 138 | 3300013307 | Ga0157372_11065836 | Ga0157372_110658362 | 82 |
| 139 | 3300013308 | Ga0157375_10381048 | Ga0157375_103810482 | 82 |
| 140 | 3300014325 | Ga0163163_12553711 | Ga0163163_125537112 | 82 |
| 141 | 3300014326 | Ga0157380_12354055 | Ga0157380_123540552 | 82 |
| 142 | 3300014745 | Ga0157377_10183792 | Ga0157377_101837923 | 82 |
| 143 | 3300014968 | Ga0157379_10486330 | Ga0157379_104863302 | 82 |
| 144 | 3300020082 | Ga0206353_10212220 | Ga0206353_102122202 | 82 |
| 145 | 3300020082 | Ga0206353_11509116 | Ga0206353_115091161 | 82 |
| 146 | 3300021377 | Ga0213874_10279875 | Ga0213874_102798752 | 82 |
| 147 | 3300021384 | Ga0213876_10068666 | Ga0213876_100686663 | 82 |
| 148 | 3300025315 | Ga0207697_10008967 | Ga0207697_100089675 | 82 |
| 149 | 3300025899 | Ga0207642_10368982 | Ga0207642_103689822 | 82 |
| 150 | 3300025903 | Ga0207680_10167743 | Ga0207680_101677431 | 82 |
| 151 | 3300025903 | Ga0207680_10385142 | Ga0207680_103851422 | 82 |
| 152 | 3300025903 | Ga0207680_11004481 | Ga0207680_110044812 | 82 |
| 153 | 3300025903 | Ga0207680_11085321 | Ga0207680_110853212 | 82 |
| 154 | 3300025904 | Ga0207647_10004422 | Ga0207647_100044227 | 82 |
| 155 | 3300025904 | Ga0207647_10011065 | Ga0207647_100110652 | 82 |
| 156 | 3300025904 | Ga0207647_10044807 | Ga0207647_100448072 | 82 |
| 157 | 3300025904 | Ga0207647_10120413 | Ga0207647_101204133 | 82 |
| 158 | 3300025904 | Ga0207647_10251941 | Ga0207647_102519412 | 82 |
| 159 | 3300025904 | Ga0207647_10481448 | Ga0207647_104814482 | 82 |
| 160 | 3300025906 | Ga0207699_10439442 | Ga0207699_104394422 | 82 |
| 161 | 3300025907 | Ga0207645_10120726 | Ga0207645_101207262 | 82 |
| 162 | 3300025908 | Ga0207643_10325009 | Ga0207643_103250092 | 82 |
| 163 | 3300025909 | Ga0207705_10000067 | Ga0207705_10000067121 | 82 |
| 164 | 3300025909 | Ga0207705_10013233 | Ga0207705_100132331 | 82 |
| 165 | 3300025909 | Ga0207705_10119253 | Ga0207705_101192533 | 82 |
| 166 | 3300025909 | Ga0207705_10396737 | Ga0207705_103967372 | 82 |
| 167 | 3300025909 | Ga0207705_10731112 | Ga0207705_107311122 | 82 |
| 168 | 3300025909 | Ga0207705_10889245 | Ga0207705_108892452 | 82 |
| 169 | 3300025909 | Ga0207705_11499752 | Ga0207705_114997521 | 82 |
| 170 | 3300025913 | Ga0207695_10028926 | Ga0207695_100289264 | 82 |
| 171 | 3300025913 | Ga0207695_10119591 | Ga0207695_101195912 | 82 |
| 172 | 3300025914 | Ga0207671_10115809 | Ga0207671_101158092 | 82 |
| 173 | 3300025917 | Ga0207660_10001267 | Ga0207660_100012672 | 82 |
| 174 | 3300025917 | Ga0207660_10025542 | Ga0207660_100255423 | 82 |
| 175 | 3300025919 | Ga0207657_10002451 | Ga0207657_1000245115 | 82 |
| 176 | 3300025919 | Ga0207657_10013245 | Ga0207657_100132452 | 82 |
| 177 | 3300025920 | Ga0207649_10024127 | Ga0207649_100241273 | 82 |
| 178 | 3300025920 | Ga0207649_10754173 | Ga0207649_107541732 | 82 |
| 179 | 3300025920 | Ga0207649_10909765 | Ga0207649_109097652 | 82 |
| 180 | 3300025921 | Ga0207652_10001335 | Ga0207652_100013359 | 82 |
| 181 | 3300025921 | Ga0207652_11240863 | Ga0207652_112408631 | 82 |
| 182 | 3300025923 | Ga0207681_10447623 | Ga0207681_104476232 | 82 |
| 183 | 3300025923 | Ga0207681_10588468 | Ga0207681_105884682 | 82 |
| 184 | 3300025923 | Ga0207681_10736999 | Ga0207681_107369991 | 82 |
| 185 | 3300025924 | Ga0207694_10086106 | Ga0207694_100861064 | 82 |
| 186 | 3300025925 | Ga0207650_10055058 | Ga0207650_100550582 | 82 |
| 187 | 3300025925 | Ga0207650_10105826 | Ga0207650_101058262 | 82 |
| 188 | 3300025928 | Ga0207700_10024719 | Ga0207700_100247192 | 82 |
| 189 | 3300025929 | Ga0207664_10044150 | Ga0207664_100441504 | 82 |
| 190 | 3300025929 | Ga0207664_10611098 | Ga0207664_106110982 | 82 |
| 191 | 3300025931 | Ga0207644_10000627 | Ga0207644_1000062714 | 82 |
| 192 | 3300025931 | Ga0207644_10034982 | Ga0207644_100349822 | 82 |
| 193 | 3300025931 | Ga0207644_10149074 | Ga0207644_101490742 | 82 |
| 194 | 3300025931 | Ga0207644_10651715 | Ga0207644_106517152 | 82 |
| 195 | 3300025932 | Ga0207690_10303706 | Ga0207690_103037062 | 82 |
| 196 | 3300025932 | Ga0207690_11038650 | Ga0207690_110386502 | 82 |
| 197 | 3300025933 | Ga0207706_10022573 | Ga0207706_100225734 | 82 |
| 198 | 3300025933 | Ga0207706_10060687 | Ga0207706_100606874 | 82 |
| 199 | 3300025933 | Ga0207706_10145017 | Ga0207706_101450172 | 82 |
| 200 | 3300025933 | Ga0207706_10694248 | Ga0207706_106942481 | 82 |
| 201 | 3300025933 | Ga0207706_11088416 | Ga0207706_110884162 | 82 |
| 202 | 3300025933 | Ga0207706_11160793 | Ga0207706_111607931 | 82 |
| 203 | 3300025937 | Ga0207669_10038418 | Ga0207669_100384182 | 82 |
| 204 | 3300025937 | Ga0207669_10065427 | Ga0207669_100654272 | 82 |
| 205 | 3300025937 | Ga0207669_11231881 | Ga0207669_112318812 | 82 |
| 206 | 3300025938 | Ga0207704_10201833 | Ga0207704_102018332 | 82 |
| 207 | 3300025939 | Ga0207665_10041381 | Ga0207665_100413812 | 82 |
| 208 | 3300025940 | Ga0207691_10064998 | Ga0207691_100649984 | 82 |
| 209 | 3300025940 | Ga0207691_10376948 | Ga0207691_103769482 | 82 |
| 210 | 3300025941 | Ga0207711_10063847 | Ga0207711_100638472 | 82 |
| 211 | 3300025941 | Ga0207711_10156018 | Ga0207711_101560183 | 82 |
| 212 | 3300025941 | Ga0207711_10170484 | Ga0207711_101704843 | 82 |
| 213 | 3300025942 | Ga0207689_10038581 | Ga0207689_100385812 | 82 |
| 214 | 3300025944 | Ga0207661_10016378 | Ga0207661_100163782 | 82 |
| 215 | 3300025944 | Ga0207661_10243855 | Ga0207661_102438552 | 82 |
| 216 | 3300025944 | Ga0207661_11596376 | Ga0207661_115963762 | 82 |
| 217 | 3300025945 | Ga0207679_10113565 | Ga0207679_101135652 | 82 |
| 218 | 3300025945 | Ga0207679_10380863 | Ga0207679_103808632 | 82 |
| 219 | 3300025949 | Ga0207667_10001743 | Ga0207667_100017435 | 82 |
| 220 | 3300025949 | Ga0207667_10039879 | Ga0207667_100398793 | 82 |
| 221 | 3300025949 | Ga0207667_11083091 | Ga0207667_110830911 | 82 |
| 222 | 3300025960 | Ga0207651_10077964 | Ga0207651_100779643 | 82 |
| 223 | 3300025960 | Ga0207651_10789189 | Ga0207651_107891892 | 82 |
| 224 | 3300025960 | Ga0207651_11197058 | Ga0207651_111970582 | 82 |
| 225 | 3300025972 | Ga0207668_10000050 | Ga0207668_1000005069 | 82 |
| 226 | 3300025972 | Ga0207668_11450130 | Ga0207668_114501302 | 82 |
| 227 | 3300025981 | Ga0207640_10067703 | Ga0207640_100677035 | 82 |
| 228 | 3300025981 | Ga0207640_10086865 | Ga0207640_100868652 | 82 |
| 229 | 3300025981 | Ga0207640_10154398 | Ga0207640_101543981 | 82 |
| 230 | 3300025981 | Ga0207640_11212695 | Ga0207640_112126952 | 82 |
| 231 | 3300025986 | Ga0207658_10019610 | Ga0207658_100196105 | 82 |
| 232 | 3300025986 | Ga0207658_10205478 | Ga0207658_102054781 | 82 |
| 233 | 3300026023 | Ga0207677_10175723 | Ga0207677_101757233 | 82 |
| 234 | 3300026023 | Ga0207677_10641554 | Ga0207677_106415542 | 82 |
| 235 | 3300026023 | Ga0207677_11408486 | Ga0207677_114084862 | 82 |
| 236 | 3300026035 | Ga0207703_10025427 | Ga0207703_100254272 | 82 |
| 237 | 3300026041 | Ga0207639_10123636 | Ga0207639_101236362 | 82 |
| 238 | 3300026041 | Ga0207639_10143689 | Ga0207639_101436894 | 82 |
| 239 | 3300026067 | Ga0207678_10062016 | Ga0207678_100620162 | 82 |
| 240 | 3300026067 | Ga0207678_10174378 | Ga0207678_101743782 | 82 |
| 241 | 3300026078 | Ga0207702_10095155 | Ga0207702_100951552 | 82 |
| 242 | 3300026078 | Ga0207702_10276818 | Ga0207702_102768182 | 82 |
| 243 | 3300026078 | Ga0207702_11619637 | Ga0207702_116196372 | 82 |
| 244 | 3300026088 | Ga0207641_10491640 | Ga0207641_104916403 | 82 |
| 245 | 3300026089 | Ga0207648_10000477 | Ga0207648_100004777 | 82 |
| 246 | 3300026089 | Ga0207648_10091749 | Ga0207648_100917492 | 82 |
| 247 | 3300026116 | Ga0207674_10000086 | Ga0207674_1000008620 | 82 |
| 248 | 3300026116 | Ga0207674_10018771 | Ga0207674_100187712 | 82 |
| 249 | 3300026116 | Ga0207674_11298859 | Ga0207674_112988591 | 82 |
| 250 | 3300026121 | Ga0207683_10002346 | Ga0207683_100023468 | 82 |
| 251 | 3300026142 | Ga0207698_10004572 | Ga0207698_100045726 | 82 |
| 252 | 3300026142 | Ga0207698_10162665 | Ga0207698_101626652 | 82 |
| 253 | 3300026142 | Ga0207698_10731762 | Ga0207698_107317621 | 82 |
| 254 | 3300028379 | Ga0268266_10005693 | Ga0268266_1000569310 | 82 |
| 255 | 3300028379 | Ga0268266_10173419 | Ga0268266_101734193 | 82 |
| 256 | 3300028379 | Ga0268266_11231979 | Ga0268266_112319792 | 82 |
| 257 | 3300028379 | Ga0268266_11496949 | Ga0268266_114969492 | 82 |
| 258 | 3300028380 | Ga0268265_10002247 | Ga0268265_1000224716 | 82 |
| 259 | 3300028380 | Ga0268265_10124509 | Ga0268265_101245092 | 82 |
| 260 | 3300028381 | Ga0268264_10005610 | Ga0268264_100056102 | 82 |
| 261 | 3300028786 | Ga0307517_10284482 | Ga0307517_102844822 | 82 |
| 262 | 3300031548 | Ga0307408_100256546 | Ga0307408_1002565462 | 82 |
| 263 | 3300031852 | Ga0307410_10643639 | Ga0307410_106436392 | 82 |
| 264 | 3300031903 | Ga0307407_10059829 | Ga0307407_100598292 | 82 |
| 265 | 3300031911 | Ga0307412_10125312 | Ga0307412_101253121 | 82 |
| 266 | 3300031995 | Ga0307409_100025664 | Ga0307409_1000256643 | 82 |
| 267 | 3300032004 | Ga0307414_10081623 | Ga0307414_100816232 | 82 |
| 268 | 3300032005 | Ga0307411_10008917 | Ga0307411_100089173 | 82 |
| 269 | 3300035691 | Ga0373931_0272841 | Ga0373931_0272841_211_483 | 82 |
| 270 | 3300037312 | Ga0395899_0001168 | Ga0395899_0001168_18606_18878 | 82 |
| 271 | 3300037312 | Ga0395899_0010312 | Ga0395899_0010312_1295_1567 | 82 |
| 272 | 3300037312 | Ga0395899_0412480 | Ga0395899_0412480_187_459 | 82 |
| 273 | 3300037312 | Ga0395899_0541548 | Ga0395899_0541548_409_681 | 82 |
| 274 | 3300037312 | Ga0395899_0624037 | Ga0395899_0624037_296_568 | 82 |
| 275 | 3300037418 | Ga0395900_0004550 | Ga0395900_0004550_11348_11620 | 82 |
| 276 | 3300037418 | Ga0395900_0011630 | Ga0395900_0011630_2803_3051 | 82 |
| 277 | 3300037418 | Ga0395900_0051135 | Ga0395900_0051135_501_773 | 82 |
| 278 | 3300037418 | Ga0395900_0059823 | Ga0395900_0059823_3384_3656 | 82 |
| 279 | 3300037418 | Ga0395900_0079451 | Ga0395900_0079451_2615_2887 | 82 |
| 280 | 3300037418 | Ga0395900_0151945 | Ga0395900_0151945_347_619 | 82 |
| 281 | 3300037418 | Ga0395900_0152070 | Ga0395900_0152070_1718_1990 | 82 |
| 282 | 3300037418 | Ga0395900_0284130 | Ga0395900_0284130_884_1156 | 82 |
| 283 | 3300037418 | Ga0395900_0299577 | Ga0395900_0299577_607_879 | 82 |
| 284 | 3300037418 | Ga0395900_0857625 | Ga0395900_0857625_341_613 | 82 |
| 285 | 3300037418 | Ga0395900_1258548 | Ga0395900_1258548_91_363 | 82 |
| 286 | 3300037418 | Ga0395900_1422021 | Ga0395900_1422021_230_502 | 82 |
| 287 | 3300037466 | Ga0395898_0005145 | Ga0395898_0005145_11648_11920 | 82 |
| 288 | 3300037466 | Ga0395898_0006548 | Ga0395898_0006548_9312_9584 | 82 |
| 289 | 3300037466 | Ga0395898_0038814 | Ga0395898_0038814_3699_3947 | 82 |
| 290 | 3300037466 | Ga0395898_0137749 | Ga0395898_0137749_1229_1501 | 82 |
| 291 | 3300037466 | Ga0395898_0170978 | Ga0395898_0170978_1169_1441 | 82 |
| 292 | 3300037466 | Ga0395898_1082156 | Ga0395898_1082156_317_589 | 82 |
| 293 | 3300037471 | Ga0395905_0000226 | Ga0395905_0000226_4207_4479 | 82 |
| 294 | 3300037471 | Ga0395905_0001115 | Ga0395905_0001115_22051_22323 | 82 |
| 295 | 3300037471 | Ga0395905_0004289 | Ga0395905_0004289_6752_7024 | 82 |
| 296 | 3300037471 | Ga0395905_0011487 | Ga0395905_0011487_1299_1571 | 82 |
| 297 | 3300037471 | Ga0395905_0023002 | Ga0395905_0023002_3010_3267 | 82 |
| 298 | 3300037471 | Ga0395905_0030577 | Ga0395905_0030577_730_1002 | 82 |
| 299 | 3300037471 | Ga0395905_0032716 | Ga0395905_0032716_3871_4119 | 82 |
| 300 | 3300037471 | Ga0395905_0041136 | Ga0395905_0041136_1086_1358 | 82 |
| 301 | 3300037471 | Ga0395905_0051397 | Ga0395905_0051397_2832_3104 | 82 |
| 302 | 3300037471 | Ga0395905_0065097 | Ga0395905_0065097_196_468 | 82 |
| 303 | 3300037471 | Ga0395905_0072920 | Ga0395905_0072920_2718_2990 | 82 |
| 304 | 3300037471 | Ga0395905_0142485 | Ga0395905_0142485_1796_2068 | 82 |
| 305 | 3300037471 | Ga0395905_0193584 | Ga0395905_0193584_794_1066 | 82 |
| 306 | 3300037471 | Ga0395905_0197355 | Ga0395905_0197355_223_495 | 82 |
| 307 | 3300037471 | Ga0395905_0223626 | Ga0395905_0223626_69_341 | 82 |
| 308 | 3300037471 | Ga0395905_0763157 | Ga0395905_0763157_74_346 | 82 |
| 309 | 3300038443 | Ga0395901_0007304 | Ga0395901_0007304_10134_10382 | 82 |
| 310 | 3300038443 | Ga0395901_0009294 | Ga0395901_0009294_6506_6778 | 82 |
| 311 | 3300038443 | Ga0395901_0024288 | Ga0395901_0024288_1181_1453 | 82 |
| 312 | 3300038443 | Ga0395901_0025514 | Ga0395901_0025514_3185_3457 | 82 |
| 313 | 3300038443 | Ga0395901_0051422 | Ga0395901_0051422_3997_4269 | 82 |
| 314 | 3300038443 | Ga0395901_0115314 | Ga0395901_0115314_552_824 | 82 |
| 315 | 3300038443 | Ga0395901_0166274 | Ga0395901_0166274_1649_1921 | 82 |
| 316 | 3300038443 | Ga0395901_0237657 | Ga0395901_0237657_1444_1716 | 82 |
| 317 | 3300038443 | Ga0395901_0376591 | Ga0395901_0376591_440_712 | 82 |
| 318 | 3300038443 | Ga0395901_0453636 | Ga0395901_0453636_108_380 | 82 |
| 319 | 3300038443 | Ga0395901_0979997 | Ga0395901_0979997_267_539 | 82 |
| 320 | 3300038443 | Ga0395901_1556858 | Ga0395901_1556858_187_459 | 82 |
| 321 | 3300038443 | Ga0395901_2097824 | Ga0395901_2097824_40_312 | 82 |
| 322 | 3300039437 | Ga0436365_0011760 | Ga0436365_0011760_4240_4512 | 82 |
| 323 | 3300039450 | Ga0436363_1494179 | Ga0436363_1494179_153_425 | 82 |
| 324 | 3300039453 | Ga0436362_0020775 | Ga0436362_0020775_397_669 | 82 |
| 325 | 3300042134 | Ga0450898_034301 | Ga0450898_034301_336_608 | 82 |
| 326 | 3300042439 | Ga0439464_0129489 | Ga0439464_0129489_435_707 | 82 |
| 327 | 3300044684 | Ga0466966_0715502 | Ga0466966_0715502_110_382 | 82 |
| 328 | 3300044735 | Ga0466968_0222432 | Ga0466968_0222432_453_725 | 82 |
| 329 | 3300044842 | Ga0466957_0452244 | Ga0466957_0452244_514_786 | 82 |
| 330 | 3300045049 | Ga0466959_0118039 | Ga0466959_0118039_493_765 | 82 |
| 331 | 3300045836 | Ga0466958_0015404 | Ga0466958_0015404_3763_4014 | 82 |
| 332 | 3300046459 | Ga0495629_0061928 | Ga0495629_0061928_433_705 | 82 |
| 333 | 3300046472 | Ga0495580_0162998 | Ga0495580_0162998_573_845 | 82 |
| 334 | 3300046525 | Ga0495663_0007957 | Ga0495663_0007957_33_317 | 82 |
| 335 | 3300046528 | Ga0495642_0238825 | Ga0495642_0238825_85_357 | 82 |
| 336 | 3300046681 | Ga0495647_0012706 | Ga0495647_0012706_1313_1585 | 82 |
| 337 | 3300046684 | Ga0495669_0002680 | Ga0495669_0002680_6919_7203 | 82 |
| 338 | 3300046684 | Ga0495669_0011271 | Ga0495669_0011271_1856_2128 | 82 |
| 339 | 3300046684 | Ga0495669_0348452 | Ga0495669_0348452_143_394 | 82 |
| 340 | 3300046684 | Ga0495669_0462859 | Ga0495669_0462859_190_462 | 82 |
| 341 | 3300046692 | Ga0495671_0230912 | Ga0495671_0230912_591_863 | 82 |
| 342 | 3300047323 | Ga0495683_0436933 | Ga0495683_0436933_26_298 | 82 |
| 343 | 3300047445 | Ga0495677_0020309 | Ga0495677_0020309_2008_2292 | 82 |
| 344 | 3300047445 | Ga0495677_0433824 | Ga0495677_0433824_211_483 | 82 |
| 345 | 3300048904 | Ga0496101_0976678 | Ga0496101_0976678_92_364 | 82 |
| 346 | 3300048905 | Ga0496102_1457916 | Ga0496102_1457916_73_360 | 82 |
| 347 | 3300048905 | Ga0496102_1527584 | Ga0496102_1527584_118_390 | 82 |
| 348 | 3300048911 | Ga0496108_0285311 | Ga0496108_0285311_871_1143 | 82 |
| 349 | 3300048912 | Ga0496109_0254412 | Ga0496109_0254412_1127_1399 | 82 |
| 350 | 3300048913 | Ga0496110_0063358 | Ga0496110_0063358_1498_1770 | 82 |
| 351 | 3300048913 | Ga0496110_0695402 | Ga0496110_0695402_625_897 | 82 |
| 352 | 3300048914 | Ga0496111_0544129 | Ga0496111_0544129_68_340 | 82 |
| 353 | 3300048915 | Ga0496112_0011015 | Ga0496112_0011015_4896_5168 | 82 |
| 354 | 3300048915 | Ga0496112_0025583 | Ga0496112_0025583_1993_2265 | 82 |
| 355 | 3300048915 | Ga0496112_0287746 | Ga0496112_0287746_706_978 | 82 |
| 356 | 3300048916 | Ga0496113_0870771 | Ga0496113_0870771_361_633 | 82 |
| 357 | 3300049581 | Ga0501047_0390694 | Ga0501047_0390694_823_1125 | 82 |
| 358 | 3300049587 | Ga0501071_0113917 | Ga0501071_0113917_112_414 | 82 |
| 359 | 3300050491 | nmdc:mga00v17_570464_c1 | nmdc:mga00v17_570464_c1_385_657 | 82 |
| 360 | 3300050516 | nmdc:mga0sz30_215231_c1 | nmdc:mga0sz30_215231_c1_32_304 | 82 |
| 361 | 3300053083 | Ga0495655_0058822 | Ga0495655_0058822_416_688 | 82 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5z81-assembly1.cif.gz_C | trimeric structure of vibrio cholerae heat shock protein 15 at 2.3 angstrom resolution | 0.951 | 1 | 81 |
| 7asa-assembly1.cif.gz_1 | bacillus subtilis ribosome-associated quality control complex state b, multibody refinement focussed on rqch. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo | 0.9476 | 1 | 82 |
| 7ope-assembly1.cif.gz_1 | rqch dr variant bound to 50s-peptidyl-trna-rqcp rqc complex (rigid body refinement) | 0.9369 | 1 | 82 |
| 7aqc-assembly1.cif.gz_Y | structure of the bacterial rqc complex (decoding state) | 0.9327 | 1 | 82 |
| 1dm9-assembly1.cif.gz_A | heat shock protein 15 kd | 0.9319 | 1 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G0R5_1_87_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9508 | 1 | 82 | 3.10.290.10 |
| af_Q25804_3_135_1.10.1050.10 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S4 Delta 41; Chain A, domain 1;Ribosomal protein S4/S9, N-terminal domain | 0.9355 | 2 | 47 | 1.10.1050.10 |
| 1dm9A00 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9319 | 1 | 81 | 3.10.290.10 |
| af_Q9XPI8_145_195_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9285 | 2 | 48 | 3.10.290.10 |
| 3dh3A01 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9186 | 1 | 50 | 3.10.290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A437J9H9-F1-model_v4 | RNA-binding S4 domain-containing protein | 0.9945 | 2 | 82 |
GO:0003723
|
| AF-A0A1S1HCA5-F1-model_v4 | RNA-binding S4 domain-containing protein | 0.9943 | 1 | 81 |
GO:0003723
|
| AF-A0A4Y9EMD4-F1-model_v4 | RNA-binding S4 domain-containing protein | 0.9942 | 1 | 80 |
GO:0003723
|
| AF-A0A7Y5IAZ3-F1-model_v4 | deleted | 0.9932 | 1 | 81 |
|
| AF-A0A258V6S7-F1-model_v4 | RNA-binding protein | 0.9926 | 1 | 82 |
GO:0003723
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar