F422155

General Info

Members Datasets Scaffolds Average Seq Length
361 183 361 115

Family's Representative Sequence

Representative Sequence 3300005834|Ga0068851_10642584|Ga0068851_106425841
Length 139
Sequence MSSRLPGAANFERVKYLESVWSEAIKMIVQHNMTTTQFELHGYEVVQTLGMVRGIIVRSRSIFGTIGASLQTLVGGNITLLTNLCEKTRQEALDLMLQHAGQLGANAVVGVRYDATEIMQGVTEVLAYGTGVIVQPKRS

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
106 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.51
Metatranscriptomes 2.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 1.39
Rhizosphere 96.4
Stem 0
Stem Tuber 0
Unclassified 1.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11910837 3300004799 Bacteria 1201
2 Ga0070683_100004933 3300005329 Bacteria 11064
3 Ga0070683_100066024 3300005329 Bacteria 3370
4 Ga0070683_100074876 3300005329 Bacteria 3162
5 Ga0070683_101270330 3300005329 Unclassified 708
6 Ga0070683_102183533 3300005329 Unclassified 531
7 Ga0070670_101495763 3300005331 Unclassified 620
8 Ga0070677_10735820 3300005333 Unclassified 558
9 Ga0070680_100114500 3300005336 Bacteria 2247
10 Ga0070682_101936124 3300005337 Bacteria 517
11 Ga0068868_100419945 3300005338 Unclassified 1158
12 Ga0070661_101001524 3300005344 Bacteria 693
13 Ga0070709_10214840 3300005434 Bacteria 1368
14 Ga0070709_10292403 3300005434 Bacteria 1187
15 Ga0070709_10295575 3300005434 Bacteria 1181
16 Ga0070709_10672004 3300005434 Bacteria 804
17 Ga0070709_10719759 3300005434 Unclassified 778
18 Ga0070714_100074721 3300005435 Bacteria 2939
19 Ga0070714_100458578 3300005435 Bacteria 1211
20 Ga0070714_101465332 3300005435 Bacteria 667
21 Ga0070713_100021344 3300005436 Unclassified 4978
22 Ga0070713_100519080 3300005436 Bacteria 1125
23 Ga0070713_100855279 3300005436 Unclassified 873
24 Ga0070713_101159518 3300005436 Bacteria 747
25 Ga0070713_101296852 3300005436 Archaea 706
26 Ga0070710_10006263 3300005437 Bacteria 5702
27 Ga0070701_10000082 3300005438 Bacteria 26358
28 Ga0070711_100036186 3300005439 Bacteria 3307
29 Ga0070711_100067339 3300005439 Bacteria 2512
30 Ga0070711_100812775 3300005439 Unclassified 793
31 Ga0070694_100002150 3300005444 Bacteria 11690
32 Ga0070681_10093347 3300005458 Bacteria 2958
33 Ga0070681_10629708 3300005458 Bacteria 987
34 Ga0070681_10844176 3300005458 Bacteria 834
35 Ga0070681_11035961 3300005458 Unclassified 741
36 Ga0070706_100771869 3300005467 Unclassified 890
37 Ga0070707_100220854 3300005468 Bacteria 1846
38 Ga0070698_100433708 3300005471 Bacteria 1249
39 Ga0070699_101137887 3300005518 Bacteria 716
40 Ga0070679_100000580 3300005530 Bacteria 31046
41 Ga0070679_100070547 3300005530 Bacteria 3485
42 Ga0070679_100351058 3300005530 Bacteria 1423
43 Ga0070679_101458337 3300005530 Unclassified 631
44 Ga0070684_100009289 3300005535 Bacteria 7742
45 Ga0070684_100068696 3300005535 Bacteria 3115
46 Ga0070684_100254449 3300005535 Bacteria 1605
47 Ga0070684_100481552 3300005535 Bacteria 1149
48 Ga0070697_101018749 3300005536 Bacteria 736
49 Ga0068853_100203890 3300005539 Unclassified 1800
50 Ga0068853_101187687 3300005539 Unclassified 736
51 Ga0070695_100025424 3300005545 Bacteria 3656
52 Ga0070695_100485290 3300005545 Bacteria 953
53 Ga0070696_101062012 3300005546 Bacteria 679
54 Ga0070693_100111373 3300005547 Unclassified 1684
55 Ga0070693_100236446 3300005547 Bacteria 1204
56 Ga0070693_100252015 3300005547 Unclassified 1170
57 Ga0070665_100409017 3300005548 Bacteria 1365
58 Ga0070665_100898336 3300005548 Bacteria 898
59 Ga0070665_101460308 3300005548 Unclassified 693
60 Ga0068855_100142611 3300005563 Bacteria 2729
61 Ga0070664_100331700 3300005564 Unclassified 1380
62 Ga0068857_100094637 3300005577 Bacteria 2676
63 Ga0068857_100799478 3300005577 Bacteria 901
64 Ga0068856_100100812 3300005614 Bacteria 2880
65 Ga0068856_101939101 3300005614 Bacteria 600
66 Ga0068856_102239262 3300005614 Bacteria 555
67 Ga0068852_100044421 3300005616 Bacteria 3773
68 Ga0068852_101397918 3300005616 Bacteria 722
69 Ga0068852_101493791 3300005616 Unclassified 698
70 Ga0068851_10310437 3300005834 Unclassified 909
71 Ga0068851_10642584 3300005834 Bacteria 649
72 Ga0068863_101076761 3300005841 Unclassified 808
73 Ga0068858_100113897 3300005842 Bacteria 2526
74 Ga0068860_101625102 3300005843 Unclassified 668
75 Ga0070717_10042631 3300006028 Bacteria 3702
76 Ga0070717_10051720 3300006028 Bacteria 3382
77 Ga0070717_10223871 3300006028 Bacteria 1654
78 Ga0070717_10439073 3300006028 Archaea 1175
79 Ga0070717_10549791 3300006028 Bacteria 1045
80 Ga0070717_10663111 3300006028 Bacteria 947
81 Ga0070717_11153535 3300006028 Bacteria 705
82 Ga0070715_10075235 3300006163 Unclassified 1519
83 Ga0070715_10190390 3300006163 Viruses 1035
84 Ga0070715_10761536 3300006163 Bacteria 584
85 Ga0070716_100260898 3300006173 Bacteria 1185
86 Ga0070716_100351406 3300006173 Bacteria 1043
87 Ga0070716_100704671 3300006173 Bacteria 772
88 Ga0070712_100045180 3300006175 Bacteria 3040
89 Ga0070712_100227493 3300006175 Bacteria 1479
90 Ga0070712_100242797 3300006175 Bacteria 1435
91 Ga0075366_10464445 3300006195 Unclassified 781
92 Ga0068871_101633909 3300006358 Unclassified 610
93 Ga0068871_101765561 3300006358 Unclassified 587
94 Ga0075433_10623983 3300006852 Unclassified 946
95 Ga0075433_11156529 3300006852 Bacteria 672
96 Ga0075434_100392898 3300006871 Bacteria 1408
97 Ga0075434_101184347 3300006871 Unclassified 776
98 Ga0075434_101523808 3300006871 Bacteria 678
99 Ga0075436_100317868 3300006914 Bacteria 1118
100 Ga0099795_10186672 3300007788 Unclassified 868
101 Ga0099795_10237481 3300007788 Bacteria 781
102 Ga0105240_10000697 3300009093 Bacteria 61754
103 Ga0105240_10360053 3300009093 Unclassified 1648
104 Ga0105245_10031525 3300009098 Unclassified 4692
105 Ga0105245_10051325 3300009098 Bacteria 3697
106 Ga0105245_10206449 3300009098 Bacteria 1889
107 Ga0105245_10478620 3300009098 Bacteria 1258
108 Ga0105245_11435562 3300009098 Unclassified 740
109 Ga0114129_10084873 3300009147 Bacteria 4395
110 Ga0114129_10148134 3300009147 Bacteria 3214
111 Ga0114129_10166483 3300009147 Bacteria 3008
112 Ga0105241_10715058 3300009174 Unclassified 916
113 Ga0105248_10106337 3300009177 Bacteria 3164
114 Ga0105248_10299686 3300009177 Bacteria 1810
115 Ga0105248_10415296 3300009177 Bacteria 1515
116 Ga0105248_10822565 3300009177 Unclassified 1048
117 Ga0105237_10299409 3300009545 Bacteria 1611
118 Ga0105237_11522001 3300009545 Bacteria 676
119 Ga0105238_10113955 3300009551 Bacteria 2683
120 Ga0105238_11182959 3300009551 Bacteria 789
121 Ga0105238_11428208 3300009551 Bacteria 719
122 Ga0105238_12595386 3300009551 Unclassified 543
123 Ga0105239_10904153 3300010375 Bacteria 1013
124 Ga0105239_11107586 3300010375 Bacteria 912
125 Ga0105239_13348868 3300010375 Bacteria 521
126 Ga0157370_10324425 3300013104 Bacteria 1420
127 Ga0157369_10277147 3300013105 Unclassified 1747
128 Ga0157369_10284646 3300013105 Bacteria 1721
129 Ga0157369_10374478 3300013105 Bacteria 1478
130 Ga0157369_10435975 3300013105 Unclassified 1358
131 Ga0157369_10771863 3300013105 Unclassified 988
132 Ga0157374_11249189 3300013296 Bacteria 764
133 Ga0157374_11496830 3300013296 Unclassified 698
134 Ga0157378_10100094 3300013297 Bacteria 2645
135 Ga0157378_10134900 3300013297 Unclassified 2288
136 Ga0163162_10787647 3300013306 Bacteria 1069
137 Ga0163162_11379043 3300013306 Unclassified 802
138 Ga0157372_10182227 3300013307 Unclassified 2431
139 Ga0157372_10282714 3300013307 Bacteria 1929
140 Ga0157372_10676183 3300013307 Bacteria 1202
141 Ga0157372_11298037 3300013307 Bacteria 840
142 Ga0157372_11303099 3300013307 Bacteria 838
143 Ga0157375_12493996 3300013308 Unclassified 617
144 Ga0163163_11420696 3300014325 Unclassified 755
145 Ga0157376_10672643 3300014969 Unclassified 1038
146 Ga0157376_11345050 3300014969 Unclassified 745
147 Ga0157376_12762335 3300014969 Bacteria 531
148 Ga0206356_11627576 3300020070 Bacteria 1456
149 Ga0206352_10275877 3300020078 Bacteria 1154
150 Ga0206353_11372059 3300020082 Bacteria 509
151 Ga0213876_10123326 3300021384 Bacteria 1376
152 Ga0213875_10044374 3300021388 Bacteria 2088
153 Ga0207692_10023680 3300025898 Bacteria 2843
154 Ga0207692_10783831 3300025898 Bacteria 622
155 Ga0207685_10193105 3300025905 Unclassified 952
156 Ga0207685_10452301 3300025905 Unclassified 668
157 Ga0207699_10087469 3300025906 Unclassified 1948
158 Ga0207699_10333610 3300025906 Bacteria 1067
159 Ga0207699_10418702 3300025906 Unclassified 956
160 Ga0207684_10467983 3300025910 Bacteria 1082
161 Ga0207707_10030057 3300025912 Bacteria 4750
162 Ga0207707_10462013 3300025912 Unclassified 1085
163 Ga0207695_10004424 3300025913 Bacteria 19190
164 Ga0207695_10037249 3300025913 Bacteria 5248
165 Ga0207695_10651735 3300025913 Unclassified 934
166 Ga0207695_10671891 3300025913 Unclassified 917
167 Ga0207671_11209983 3300025914 Unclassified 591
168 Ga0207693_10046010 3300025915 Bacteria 3428
169 Ga0207693_10411418 3300025915 Unclassified 1057
170 Ga0207693_10427253 3300025915 Bacteria 1036
171 Ga0207663_10867000 3300025916 Unclassified 721
172 Ga0207663_11099109 3300025916 Unclassified 639
173 Ga0207660_10222894 3300025917 Bacteria 1480
174 Ga0207649_10758094 3300025920 Bacteria 756
175 Ga0207646_10185856 3300025922 Bacteria 1877
176 Ga0207694_10158750 3300025924 Bacteria 1825
177 Ga0207694_10213708 3300025924 Bacteria 1572
178 Ga0207694_11307167 3300025924 Bacteria 613
179 Ga0207687_10009603 3300025927 Bacteria 6325
180 Ga0207687_10424050 3300025927 Unclassified 1098
181 Ga0207700_10114851 3300025928 Archaea 2173
182 Ga0207700_10397206 3300025928 Bacteria 1208
183 Ga0207700_10413608 3300025928 Bacteria 1183
184 Ga0207700_10920047 3300025928 Bacteria 783
185 Ga0207700_11558686 3300025928 Unclassified 585
186 Ga0207664_10182544 3300025929 Bacteria 1802
187 Ga0207664_10206122 3300025929 Bacteria 1699
188 Ga0207665_10169932 3300025939 Unclassified 1574
189 Ga0207665_10858533 3300025939 Unclassified 719
190 Ga0207665_11050298 3300025939 Unclassified 649
191 Ga0207661_10818310 3300025944 Bacteria 857
192 Ga0207661_11736389 3300025944 Bacteria 569
193 Ga0207679_10982059 3300025945 Bacteria 774
194 Ga0207667_10070117 3300025949 Bacteria 3649
195 Ga0207667_10384510 3300025949 Bacteria 1430
196 Ga0207712_10359614 3300025961 Bacteria 1212
197 Ga0207640_10405688 3300025981 Bacteria 1111
198 Ga0207640_12097429 3300025981 Bacteria 513
199 Ga0207677_10558097 3300026023 Bacteria 999
200 Ga0207639_11063576 3300026041 Unclassified 758
201 Ga0207639_11073981 3300026041 Unclassified 755
202 Ga0207639_11159044 3300026041 Unclassified 725
203 Ga0207702_10030811 3300026078 Bacteria 4468
204 Ga0207676_11322558 3300026095 Unclassified 716
205 Ga0268266_10294502 3300028379 Bacteria 1512
206 Ga0268266_10308942 3300028379 Bacteria 1477
207 Ga0265319_1035425 3300028563 Bacteria 1712
208 Ga0265338_10011363 3300028800 Bacteria 10293
209 Ga0265338_10024636 3300028800 Bacteria 6140
210 Ga0265338_11070014 3300028800 Unclassified 544
211 Ga0265325_10042836 3300031241 Bacteria 2364
212 Ga0265340_10136962 3300031247 Bacteria 1121
213 Ga0265316_10100731 3300031344 Bacteria 2196
214 Ga0265316_10132351 3300031344 Bacteria 1878
215 Ga0265313_10061709 3300031595 Bacteria 1753
216 Ga0265314_10331626 3300031711 Bacteria 843
217 Ga0265314_10548105 3300031711 Unclassified 602
218 Ga0265342_10031506 3300031712 Bacteria 3278
219 Ga0373934_0047072 3300035086 Unclassified 1706
220 Ga0373934_0279520 3300035086 Bacteria 691
221 Ga0373923_0099205 3300035111 Bacteria 1282
222 Ga0373923_0182340 3300035111 Bacteria 965
223 Ga0373936_0010693 3300035113 Bacteria 3465
224 Ga0373953_0054368 3300035117 Bacteria 1624
225 Ga0373953_0154399 3300035117 Unclassified 985
226 Ga0373954_0012425 3300035118 Bacteria 3786
227 Ga0373954_0045861 3300035118 Unclassified 2042
228 Ga0373954_0331035 3300035118 Unclassified 752
229 Ga0373956_0064326 3300035119 Bacteria 1665
230 Ga0373956_0592354 3300035119 Bacteria 529
231 Ga0373957_0018239 3300035120 Unclassified 2455
232 Ga0373957_0191197 3300035120 Bacteria 851
233 Ga0373943_0012877 3300035170 Bacteria 3771
234 Ga0373943_0074855 3300035170 Unclassified 1723
235 Ga0373943_0109845 3300035170 Bacteria 1453
236 Ga0373946_0615215 3300035171 Bacteria 564
237 Ga0373955_0324102 3300035172 Bacteria 931
238 Ga0373924_0224159 3300035410 Unclassified 831
239 Ga0373935_0064813 3300035692 Bacteria 2343
240 Ga0373935_0084112 3300035692 Unclassified 2072
241 Ga0373935_0108749 3300035692 Bacteria 1838
242 Ga0373927_0014126 3300035695 Bacteria 5295
243 Ga0373927_0069518 3300035695 Bacteria 2279
244 Ga0373927_0270240 3300035695 Bacteria 1118
245 Ga0373933_0159513 3300035724 Bacteria 1431
246 Ga0373933_0309856 3300035724 Bacteria 1023
247 Ga0373947_0258900 3300035725 Bacteria 1152
248 Ga0373947_0558288 3300035725 Unclassified 780
249 Ga0373947_0758371 3300035725 Bacteria 662
250 Ga0373947_0924361 3300035725 Unclassified 595
251 Ga0373937_0077468 3300036401 Unclassified 3072
252 Ga0373937_0085143 3300036401 Bacteria 2925
253 Ga0373937_0335107 3300036401 Bacteria 1432
254 Ga0373937_0352939 3300036401 Bacteria 1393
255 Ga0373937_0722485 3300036401 Unclassified 943
256 Ga0373937_1005761 3300036401 Unclassified 782
257 Ga0373937_1385120 3300036401 Bacteria 651
258 Ga0373937_1788369 3300036401 Unclassified 561
259 Ga0316584_0293193 3300036712 Bacteria 1180
260 Ga0373925_0010068 3300037068 Bacteria 6868
261 Ga0373925_0106800 3300037068 Bacteria 2159
262 Ga0373925_0226290 3300037068 Bacteria 1494
263 Ga0373925_0250845 3300037068 Bacteria 1419
264 Ga0373925_0291984 3300037068 Unclassified 1315
265 Ga0373925_0642208 3300037068 Unclassified 874
266 Ga0373925_0768879 3300037068 Unclassified 794
267 Ga0436364_0461532 3300037853 Bacteria 592
268 Ga0436364_1416704 3300037853 Bacteria 2085
269 Ga0436365_0804578 3300039437 Bacteria 2597
270 Ga0436365_1046061 3300039437 Bacteria 1478
271 Ga0436363_0476209 3300039450 Unclassified 534
272 Ga0436362_0314453 3300039453 Unclassified 628
273 Ga0451577_0094841 3300042876 Bacteria 2664
274 Ga0451577_0382897 3300042876 Bacteria 1277
275 Ga0451577_0503361 3300042876 Bacteria 1100
276 Ga0453684_0409944 3300044712 Bacteria 1516
277 Ga0453684_0944215 3300044712 Bacteria 921
278 Ga0466957_0046421 3300044842 Bacteria 2637
279 Ga0466957_0085156 3300044842 Unclassified 1974
280 Ga0451576_0112335 3300045051 Bacteria 2836
281 Ga0466958_0129196 3300045836 Unclassified 1586
282 Ga0495603_0320538 3300046455 Unclassified 890
283 Ga0495651_0024335 3300046462 Bacteria 4712
284 Ga0495580_0012839 3300046472 Bacteria 6418
285 Ga0495580_0017664 3300046472 Bacteria 5328
286 Ga0495580_0068442 3300046472 Bacteria 2483
287 Ga0495580_0087501 3300046472 Bacteria 2170
288 Ga0495580_0451420 3300046472 Bacteria 862
289 Ga0495580_0505166 3300046472 Unclassified 807
290 Ga0495580_0588078 3300046472 Unclassified 736
291 Ga0495582_0152808 3300046473 Bacteria 1311
292 Ga0495639_0268521 3300046475 Unclassified 846
293 Ga0495639_0613553 3300046475 Bacteria 560
294 Ga0495664_0009323 3300046477 Bacteria 5489
295 Ga0495618_0576709 3300046514 Bacteria 671
296 Ga0495628_0118252 3300046516 Bacteria 2035
297 Ga0495628_0157897 3300046516 Bacteria 1724
298 Ga0495666_0193701 3300046526 Bacteria 936
299 Ga0495652_0094592 3300046529 Bacteria 2437
300 Ga0495665_0100183 3300046531 Bacteria 1520
301 Ga0495665_0656417 3300046531 Unclassified 522
302 Ga0495640_0027117 3300046533 Unclassified 4135
303 Ga0495587_0060664 3300046536 Bacteria 2217
304 Ga0495587_0190040 3300046536 Bacteria 1163
305 Ga0495587_0287445 3300046536 Bacteria 921
306 Ga0495645_0100521 3300046543 Unclassified 2057
307 Ga0495645_0317385 3300046543 Bacteria 1013
308 Ga0495667_0098342 3300046559 Unclassified 1895
309 Ga0495667_0412502 3300046559 Bacteria 850
310 Ga0495635_0113570 3300046663 Bacteria 1849
311 Ga0495635_0483562 3300046663 Unclassified 816
312 Ga0495657_0615568 3300046675 Unclassified 628
313 Ga0495599_0078902 3300046678 Bacteria 2056
314 Ga0495623_0106506 3300046679 Bacteria 1703
315 Ga0495658_0081794 3300046683 Bacteria 1897
316 Ga0495669_0245176 3300046684 Unclassified 860
317 Ga0495613_0062270 3300046689 Unclassified 2731
318 Ga0495613_1034328 3300046689 Bacteria 526
319 Ga0495624_0284148 3300046690 Unclassified 999
320 Ga0495624_0644482 3300046690 Unclassified 630
321 Ga0495600_0436205 3300046809 Bacteria 811
322 Ga0495581_0509706 3300047315 Bacteria 699
323 Ga0495581_0739433 3300047315 Unclassified 566
324 Ga0495604_0059700 3300047317 Unclassified 2923
325 Ga0495604_0074542 3300047317 Unclassified 2557
326 Ga0495674_0027116 3300047319 Bacteria 5239
327 Ga0495674_0201973 3300047319 Bacteria 1649
328 Ga0495674_0333774 3300047319 Bacteria 1233
329 Ga0495675_0014065 3300047444 Bacteria 5058
330 Ga0495684_0006245 3300047471 Bacteria 9261
331 Ga0495684_0036311 3300047471 Unclassified 3779
332 Ga0495684_1086558 3300047471 Unclassified 502
333 Ga0495593_0221658 3300047673 Bacteria 949
334 Ga0495602_0035323 3300048088 Bacteria 4662
335 Ga0496100_0071261 3300048903 Bacteria 2320
336 Ga0496103_0097560 3300048906 Bacteria 1858
337 Ga0496112_0059681 3300048915 Bacteria 3759
338 Ga0496112_0622071 3300048915 Unclassified 1011
339 Ga0496115_1170401 3300048918 Unclassified 579
340 Ga0501032_0166431 3300049569 Unclassified 1447
341 Ga0501033_0016526 3300049570 Bacteria 5588
342 Ga0501037_0450398 3300049573 Bacteria 878
343 Ga0501046_0186910 3300049580 Bacteria 1547
344 Ga0501047_0137928 3300049581 Unclassified 2319
345 Ga0501044_0552860 3300049823 Bacteria 1048
346 nmdc:mga05p37_233301_c1 3300050507 Bacteria 2216
347 nmdc:mga05p37_263232_c1 3300050507 Unclassified 2063
348 nmdc:mga06r32_59354_c1 3300050510 Bacteria 3678
349 nmdc:mga0n895_273225_c1 3300050512 Bacteria 1714
350 nmdc:mga0n895_366193_c1 3300050512 Bacteria 1459
351 nmdc:mga0n895_79163_c1 3300050512 Bacteria 3273
352 nmdc:mga08x19_25858_c1 3300050514 Bacteria 3660
353 nmdc:mga0a205_200517_c1 3300050515 Bacteria 724
354 nmdc:mga0a205_296765_c1 3300050515 Bacteria 1490
355 Ga0495612_0078489 3300053078 Bacteria 1385
356 Ga0495619_0798980 3300053085 Bacteria 638
357 Ga0587090_009355 3300059510 Unclassified 1334
358 Ga0587094_084568 3300059513 Unclassified 592
359 Ga0587079_026517 3300059647 Unclassified 1084
360 Ga0587079_208644 3300059647 Bacteria 537
361 Ga0587111_0017690 3300060346 Archaea 1331

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10464445 Ga0075366_104644452 109
2 3300005329 Ga0070683_100066024 Ga0070683_1000660243 111
3 3300005331 Ga0070670_101495763 Ga0070670_1014957631 111
4 3300005333 Ga0070677_10735820 Ga0070677_107358201 111
5 3300005434 Ga0070709_10672004 Ga0070709_106720042 111
6 3300005438 Ga0070701_10000082 Ga0070701_1000008223 111
7 3300005439 Ga0070711_100067339 Ga0070711_1000673392 111
8 3300005458 Ga0070681_10629708 Ga0070681_106297082 111
9 3300005471 Ga0070698_100433708 Ga0070698_1004337082 111
10 3300005535 Ga0070684_100009289 Ga0070684_1000092893 111
11 3300005548 Ga0070665_101460308 Ga0070665_1014603082 111
12 3300005564 Ga0070664_100331700 Ga0070664_1003317002 111
13 3300005616 Ga0068852_101493791 Ga0068852_1014937912 111
14 3300005841 Ga0068863_101076761 Ga0068863_1010767612 111
15 3300005843 Ga0068860_101625102 Ga0068860_1016251022 111
16 3300006028 Ga0070717_10439073 Ga0070717_104390731 111
17 3300006358 Ga0068871_101765561 Ga0068871_1017655612 111
18 3300006852 Ga0075433_11156529 Ga0075433_111565291 111
19 3300006871 Ga0075434_100392898 Ga0075434_1003928982 111
20 3300009093 Ga0105240_10000697 Ga0105240_1000069713 111
21 3300009098 Ga0105245_10051325 Ga0105245_100513255 111
22 3300009098 Ga0105245_10206449 Ga0105245_102064492 111
23 3300009098 Ga0105245_10478620 Ga0105245_104786202 111
24 3300009098 Ga0105245_11435562 Ga0105245_114355622 111
25 3300009177 Ga0105248_10106337 Ga0105248_101063373 111
26 3300009177 Ga0105248_10299686 Ga0105248_102996862 111
27 3300009177 Ga0105248_10415296 Ga0105248_104152962 111
28 3300009177 Ga0105248_10822565 Ga0105248_108225652 111
29 3300009545 Ga0105237_11522001 Ga0105237_115220011 111
30 3300013105 Ga0157369_10374478 Ga0157369_103744782 111
31 3300013297 Ga0157378_10100094 Ga0157378_101000944 111
32 3300013306 Ga0163162_10787647 Ga0163162_107876472 111
33 3300013307 Ga0157372_10182227 Ga0157372_101822272 111
34 3300013307 Ga0157372_10676183 Ga0157372_106761832 111
35 3300013307 Ga0157372_11303099 Ga0157372_113030992 111
36 3300013308 Ga0157375_12493996 Ga0157375_124939961 111
37 3300014325 Ga0163163_11420696 Ga0163163_114206962 111
38 3300014969 Ga0157376_11345050 Ga0157376_113450501 111
39 3300025981 Ga0207640_12097429 Ga0207640_120974291 111
40 3300026095 Ga0207676_11322558 Ga0207676_113225581 111
41 3300035119 Ga0373956_0592354 Ga0373956_0592354_131_478 111
42 3300035170 Ga0373943_0074855 Ga0373943_0074855_278_631 111
43 3300035170 Ga0373943_0109845 Ga0373943_0109845_404_751 111
44 3300035692 Ga0373935_0084112 Ga0373935_0084112_1260_1613 111
45 3300035695 Ga0373927_0270240 Ga0373927_0270240_724_1083 111
46 3300035724 Ga0373933_0309856 Ga0373933_0309856_189_536 111
47 3300035725 Ga0373947_0758371 Ga0373947_0758371_225_572 111
48 3300036401 Ga0373937_1385120 Ga0373937_1385120_14_361 111
49 3300037068 Ga0373925_0010068 Ga0373925_0010068_4366_4713 111
50 3300037068 Ga0373925_0106800 Ga0373925_0106800_516_875 111
51 3300037068 Ga0373925_0768879 Ga0373925_0768879_337_690 111
52 3300039450 Ga0436363_0476209 Ga0436363_0476209_22_360 111
53 3300039453 Ga0436362_0314453 Ga0436362_0314453_51_398 111
54 3300042876 Ga0451577_0503361 Ga0451577_0503361_357_695 111
55 3300044842 Ga0466957_0046421 Ga0466957_0046421_1573_1914 111
56 3300044842 Ga0466957_0085156 Ga0466957_0085156_604_945 111
57 3300045836 Ga0466958_0129196 Ga0466958_0129196_1217_1558 111
58 3300046472 Ga0495580_0087501 Ga0495580_0087501_1119_1466 111
59 3300046472 Ga0495580_0451420 Ga0495580_0451420_192_551 111
60 3300046472 Ga0495580_0588078 Ga0495580_0588078_135_488 111
61 3300046473 Ga0495582_0152808 Ga0495582_0152808_346_693 111
62 3300046475 Ga0495639_0268521 Ga0495639_0268521_236_589 111
63 3300046475 Ga0495639_0613553 Ga0495639_0613553_173_532 111
64 3300046526 Ga0495666_0193701 Ga0495666_0193701_431_778 111
65 3300046531 Ga0495665_0100183 Ga0495665_0100183_782_1129 111
66 3300046683 Ga0495658_0081794 Ga0495658_0081794_547_894 111
67 3300046689 Ga0495613_1034328 Ga0495613_1034328_129_476 111
68 3300046690 Ga0495624_0284148 Ga0495624_0284148_526_879 111
69 3300047315 Ga0495581_0509706 Ga0495581_0509706_314_661 111
70 3300047319 Ga0495674_0333774 Ga0495674_0333774_661_1008 111
71 3300047673 Ga0495593_0221658 Ga0495593_0221658_555_902 111
72 3300049570 Ga0501033_0016526 Ga0501033_0016526_4517_4855 111
73 3300050512 nmdc:mga0n895_273225_c1 nmdc:mga0n895_273225_c1_333_677 111
74 3300050514 nmdc:mga08x19_25858_c1 nmdc:mga08x19_25858_c1_38_379 111
75 3300050515 nmdc:mga0a205_200517_c1 nmdc:mga0a205_200517_c1_82_426 111
76 3300053078 Ga0495612_0078489 Ga0495612_0078489_491_838 111
77 3300053085 Ga0495619_0798980 Ga0495619_0798980_16_363 111
78 3300005329 Ga0070683_101270330 Ga0070683_1012703302 112
79 3300005337 Ga0070682_101936124 Ga0070682_1019361241 112
80 3300005338 Ga0068868_100419945 Ga0068868_1004199452 112
81 3300005434 Ga0070709_10295575 Ga0070709_102955753 112
82 3300005434 Ga0070709_10719759 Ga0070709_107197591 112
83 3300005436 Ga0070713_100855279 Ga0070713_1008552791 112
84 3300005444 Ga0070694_100002150 Ga0070694_1000021508 112
85 3300005468 Ga0070707_100220854 Ga0070707_1002208543 112
86 3300005518 Ga0070699_101137887 Ga0070699_1011378872 112
87 3300005536 Ga0070697_101018749 Ga0070697_1010187491 112
88 3300005545 Ga0070695_100025424 Ga0070695_1000254241 112
89 3300005546 Ga0070696_101062012 Ga0070696_1010620122 112
90 3300005842 Ga0068858_100113897 Ga0068858_1001138973 112
91 3300006028 Ga0070717_10051720 Ga0070717_100517203 112
92 3300006163 Ga0070715_10190390 Ga0070715_101903902 112
93 3300006163 Ga0070715_10761536 Ga0070715_107615361 112
94 3300006175 Ga0070712_100045180 Ga0070712_1000451803 112
95 3300006358 Ga0068871_101633909 Ga0068871_1016339091 112
96 3300006852 Ga0075433_10623983 Ga0075433_106239832 112
97 3300006871 Ga0075434_101184347 Ga0075434_1011843472 112
98 3300006871 Ga0075434_101523808 Ga0075434_1015238082 112
99 3300007788 Ga0099795_10186672 Ga0099795_101866722 112
100 3300009147 Ga0114129_10084873 Ga0114129_100848731 112
101 3300009147 Ga0114129_10166483 Ga0114129_101664836 112
102 3300009545 Ga0105237_10299409 Ga0105237_102994094 112
103 3300009551 Ga0105238_11182959 Ga0105238_111829592 112
104 3300010375 Ga0105239_10904153 Ga0105239_109041532 112
105 3300013105 Ga0157369_10284646 Ga0157369_102846463 112
106 3300013306 Ga0163162_11379043 Ga0163162_113790432 112
107 3300013307 Ga0157372_11298037 Ga0157372_112980371 112
108 3300014969 Ga0157376_10672643 Ga0157376_106726432 112
109 3300014969 Ga0157376_12762335 Ga0157376_127623352 112
110 3300025905 Ga0207685_10452301 Ga0207685_104523011 112
111 3300025906 Ga0207699_10087469 Ga0207699_100874693 112
112 3300025910 Ga0207684_10467983 Ga0207684_104679832 112
113 3300025914 Ga0207671_11209983 Ga0207671_112099832 112
114 3300025915 Ga0207693_10046010 Ga0207693_100460104 112
115 3300025920 Ga0207649_10758094 Ga0207649_107580942 112
116 3300025922 Ga0207646_10185856 Ga0207646_101858563 112
117 3300025924 Ga0207694_10213708 Ga0207694_102137082 112
118 3300025961 Ga0207712_10359614 Ga0207712_103596142 112
119 3300028379 Ga0268266_10294502 Ga0268266_102945022 112
120 3300028563 Ga0265319_1035425 Ga0265319_10354253 112
121 3300028800 Ga0265338_10011363 Ga0265338_100113634 112
122 3300028800 Ga0265338_10024636 Ga0265338_100246364 112
123 3300028800 Ga0265338_11070014 Ga0265338_110700141 112
124 3300031241 Ga0265325_10042836 Ga0265325_100428362 112
125 3300031247 Ga0265340_10136962 Ga0265340_101369622 112
126 3300031344 Ga0265316_10100731 Ga0265316_101007313 112
127 3300031344 Ga0265316_10132351 Ga0265316_101323514 112
128 3300031595 Ga0265313_10061709 Ga0265313_100617092 112
129 3300031711 Ga0265314_10331626 Ga0265314_103316261 112
130 3300031711 Ga0265314_10548105 Ga0265314_105481051 112
131 3300031712 Ga0265342_10031506 Ga0265342_100315065 112
132 3300035086 Ga0373934_0047072 Ga0373934_0047072_192_554 112
133 3300035086 Ga0373934_0279520 Ga0373934_0279520_237_575 112
134 3300035111 Ga0373923_0099205 Ga0373923_0099205_297_659 112
135 3300035111 Ga0373923_0182340 Ga0373923_0182340_325_678 112
136 3300035117 Ga0373953_0054368 Ga0373953_0054368_268_621 112
137 3300035117 Ga0373953_0154399 Ga0373953_0154399_275_637 112
138 3300035118 Ga0373954_0012425 Ga0373954_0012425_340_693 112
139 3300035118 Ga0373954_0045861 Ga0373954_0045861_1367_1729 112
140 3300035118 Ga0373954_0331035 Ga0373954_0331035_391_729 112
141 3300035119 Ga0373956_0064326 Ga0373956_0064326_89_442 112
142 3300035120 Ga0373957_0018239 Ga0373957_0018239_1895_2257 112
143 3300035120 Ga0373957_0191197 Ga0373957_0191197_315_668 112
144 3300035171 Ga0373946_0615215 Ga0373946_0615215_65_403 112
145 3300035172 Ga0373955_0324102 Ga0373955_0324102_421_774 112
146 3300035410 Ga0373924_0224159 Ga0373924_0224159_25_378 112
147 3300035692 Ga0373935_0064813 Ga0373935_0064813_267_620 112
148 3300035695 Ga0373927_0014126 Ga0373927_0014126_2019_2372 112
149 3300035724 Ga0373933_0159513 Ga0373933_0159513_342_704 112
150 3300035725 Ga0373947_0258900 Ga0373947_0258900_307_660 112
151 3300035725 Ga0373947_0558288 Ga0373947_0558288_139_477 112
152 3300036401 Ga0373937_0077468 Ga0373937_0077468_922_1284 112
153 3300036401 Ga0373937_0352939 Ga0373937_0352939_773_1126 112
154 3300036401 Ga0373937_0722485 Ga0373937_0722485_537_887 112
155 3300036401 Ga0373937_1005761 Ga0373937_1005761_150_488 112
156 3300036401 Ga0373937_1788369 Ga0373937_1788369_161_535 112
157 3300036712 Ga0316584_0293193 Ga0316584_0293193_584_928 112
158 3300037068 Ga0373925_0226290 Ga0373925_0226290_997_1350 112
159 3300037068 Ga0373925_0250845 Ga0373925_0250845_771_1133 112
160 3300037068 Ga0373925_0291984 Ga0373925_0291984_908_1246 112
161 3300045051 Ga0451576_0112335 Ga0451576_0112335_442_780 112
162 3300046455 Ga0495603_0320538 Ga0495603_0320538_159_497 112
163 3300046462 Ga0495651_0024335 Ga0495651_0024335_2667_3005 112
164 3300046472 Ga0495580_0012839 Ga0495580_0012839_5070_5423 112
165 3300046472 Ga0495580_0017664 Ga0495580_0017664_485_823 112
166 3300046477 Ga0495664_0009323 Ga0495664_0009323_435_773 112
167 3300046514 Ga0495618_0576709 Ga0495618_0576709_45_383 112
168 3300046516 Ga0495628_0157897 Ga0495628_0157897_1008_1346 112
169 3300046529 Ga0495652_0094592 Ga0495652_0094592_416_754 112
170 3300046533 Ga0495640_0027117 Ga0495640_0027117_2207_2545 112
171 3300046536 Ga0495587_0060664 Ga0495587_0060664_412_750 112
172 3300046536 Ga0495587_0287445 Ga0495587_0287445_231_569 112
173 3300046543 Ga0495645_0100521 Ga0495645_0100521_523_861 112
174 3300046543 Ga0495645_0317385 Ga0495645_0317385_70_408 112
175 3300046559 Ga0495667_0098342 Ga0495667_0098342_1136_1474 112
176 3300046559 Ga0495667_0412502 Ga0495667_0412502_64_417 112
177 3300046663 Ga0495635_0113570 Ga0495635_0113570_331_669 112
178 3300046663 Ga0495635_0483562 Ga0495635_0483562_15_353 112
179 3300046675 Ga0495657_0615568 Ga0495657_0615568_123_485 112
180 3300046678 Ga0495599_0078902 Ga0495599_0078902_1580_1918 112
181 3300046679 Ga0495623_0106506 Ga0495623_0106506_204_542 112
182 3300046689 Ga0495613_0062270 Ga0495613_0062270_1114_1452 112
183 3300046690 Ga0495624_0644482 Ga0495624_0644482_12_374 112
184 3300046809 Ga0495600_0436205 Ga0495600_0436205_31_369 112
185 3300047315 Ga0495581_0739433 Ga0495581_0739433_66_404 112
186 3300047317 Ga0495604_0059700 Ga0495604_0059700_1362_1700 112
187 3300047317 Ga0495604_0074542 Ga0495604_0074542_1753_2091 112
188 3300047319 Ga0495674_0027116 Ga0495674_0027116_1854_2192 112
189 3300047319 Ga0495674_0201973 Ga0495674_0201973_697_1050 112
190 3300047444 Ga0495675_0014065 Ga0495675_0014065_723_1061 112
191 3300047471 Ga0495684_0006245 Ga0495684_0006245_4766_5104 112
192 3300047471 Ga0495684_0036311 Ga0495684_0036311_2894_3232 112
193 3300047471 Ga0495684_1086558 Ga0495684_1086558_25_378 112
194 3300048088 Ga0495602_0035323 Ga0495602_0035323_979_1317 112
195 3300050507 nmdc:mga05p37_233301_c1 nmdc:mga05p37_233301_c1_1293_1637 112
196 3300050507 nmdc:mga05p37_263232_c1 nmdc:mga05p37_263232_c1_243_587 112
197 3300050512 nmdc:mga0n895_366193_c1 nmdc:mga0n895_366193_c1_190_528 112
198 3300004799 Ga0058863_11910837 Ga0058863_119108372 113
199 3300005329 Ga0070683_100004933 Ga0070683_1000049336 113
200 3300005329 Ga0070683_100074876 Ga0070683_1000748761 113
201 3300005329 Ga0070683_102183533 Ga0070683_1021835332 113
202 3300005336 Ga0070680_100114500 Ga0070680_1001145004 113
203 3300005344 Ga0070661_101001524 Ga0070661_1010015242 113
204 3300005434 Ga0070709_10214840 Ga0070709_102148401 113
205 3300005434 Ga0070709_10292403 Ga0070709_102924032 113
206 3300005435 Ga0070714_100074721 Ga0070714_1000747212 113
207 3300005435 Ga0070714_100458578 Ga0070714_1004585781 113
208 3300005435 Ga0070714_101465332 Ga0070714_1014653321 113
209 3300005436 Ga0070713_100021344 Ga0070713_1000213441 113
210 3300005436 Ga0070713_100519080 Ga0070713_1005190801 113
211 3300005436 Ga0070713_101159518 Ga0070713_1011595181 113
212 3300005436 Ga0070713_101296852 Ga0070713_1012968522 113
213 3300005437 Ga0070710_10006263 Ga0070710_100062632 113
214 3300005439 Ga0070711_100036186 Ga0070711_1000361862 113
215 3300005439 Ga0070711_100812775 Ga0070711_1008127752 113
216 3300005458 Ga0070681_10093347 Ga0070681_100933474 113
217 3300005458 Ga0070681_10844176 Ga0070681_108441761 113
218 3300005458 Ga0070681_11035961 Ga0070681_110359611 113
219 3300005467 Ga0070706_100771869 Ga0070706_1007718691 113
220 3300005530 Ga0070679_100000580 Ga0070679_1000005806 113
221 3300005530 Ga0070679_100070547 Ga0070679_1000705473 113
222 3300005530 Ga0070679_100351058 Ga0070679_1003510583 113
223 3300005530 Ga0070679_101458337 Ga0070679_1014583371 113
224 3300005535 Ga0070684_100068696 Ga0070684_1000686962 113
225 3300005535 Ga0070684_100254449 Ga0070684_1002544493 113
226 3300005535 Ga0070684_100481552 Ga0070684_1004815523 113
227 3300005539 Ga0068853_100203890 Ga0068853_1002038902 113
228 3300005539 Ga0068853_101187687 Ga0068853_1011876871 113
229 3300005545 Ga0070695_100485290 Ga0070695_1004852902 113
230 3300005547 Ga0070693_100111373 Ga0070693_1001113731 113
231 3300005547 Ga0070693_100236446 Ga0070693_1002364461 113
232 3300005547 Ga0070693_100252015 Ga0070693_1002520152 113
233 3300005548 Ga0070665_100409017 Ga0070665_1004090172 113
234 3300005548 Ga0070665_100898336 Ga0070665_1008983361 113
235 3300005563 Ga0068855_100142611 Ga0068855_1001426115 113
236 3300005577 Ga0068857_100094637 Ga0068857_1000946374 113
237 3300005577 Ga0068857_100799478 Ga0068857_1007994782 113
238 3300005614 Ga0068856_100100812 Ga0068856_1001008124 113
239 3300005614 Ga0068856_101939101 Ga0068856_1019391011 113
240 3300005614 Ga0068856_102239262 Ga0068856_1022392621 113
241 3300005616 Ga0068852_100044421 Ga0068852_1000444213 113
242 3300005616 Ga0068852_101397918 Ga0068852_1013979182 113
243 3300005834 Ga0068851_10310437 Ga0068851_103104371 113
244 3300005834 Ga0068851_10642584 Ga0068851_106425841 113
245 3300006028 Ga0070717_10042631 Ga0070717_100426313 113
246 3300006028 Ga0070717_10223871 Ga0070717_102238713 113
247 3300006028 Ga0070717_10549791 Ga0070717_105497912 113
248 3300006028 Ga0070717_10663111 Ga0070717_106631111 113
249 3300006028 Ga0070717_11153535 Ga0070717_111535352 113
250 3300006163 Ga0070715_10075235 Ga0070715_100752352 113
251 3300006173 Ga0070716_100260898 Ga0070716_1002608982 113
252 3300006173 Ga0070716_100351406 Ga0070716_1003514063 113
253 3300006173 Ga0070716_100704671 Ga0070716_1007046712 113
254 3300006175 Ga0070712_100227493 Ga0070712_1002274932 113
255 3300006175 Ga0070712_100242797 Ga0070712_1002427972 113
256 3300006914 Ga0075436_100317868 Ga0075436_1003178682 113
257 3300007788 Ga0099795_10237481 Ga0099795_102374812 113
258 3300009093 Ga0105240_10360053 Ga0105240_103600533 113
259 3300009098 Ga0105245_10031525 Ga0105245_100315253 113
260 3300009147 Ga0114129_10148134 Ga0114129_101481343 113
261 3300009174 Ga0105241_10715058 Ga0105241_107150581 113
262 3300009551 Ga0105238_10113955 Ga0105238_101139552 113
263 3300009551 Ga0105238_11428208 Ga0105238_114282082 113
264 3300009551 Ga0105238_12595386 Ga0105238_125953861 113
265 3300010375 Ga0105239_11107586 Ga0105239_111075862 113
266 3300010375 Ga0105239_13348868 Ga0105239_133488681 113
267 3300013104 Ga0157370_10324425 Ga0157370_103244253 113
268 3300013105 Ga0157369_10277147 Ga0157369_102771473 113
269 3300013105 Ga0157369_10435975 Ga0157369_104359752 113
270 3300013105 Ga0157369_10771863 Ga0157369_107718632 113
271 3300013296 Ga0157374_11249189 Ga0157374_112491892 113
272 3300013296 Ga0157374_11496830 Ga0157374_114968302 113
273 3300013297 Ga0157378_10134900 Ga0157378_101349004 113
274 3300013307 Ga0157372_10282714 Ga0157372_102827143 113
275 3300020070 Ga0206356_11627576 Ga0206356_116275761 113
276 3300020078 Ga0206352_10275877 Ga0206352_102758772 113
277 3300020082 Ga0206353_11372059 Ga0206353_113720591 113
278 3300021384 Ga0213876_10123326 Ga0213876_101233262 113
279 3300021388 Ga0213875_10044374 Ga0213875_100443743 113
280 3300025898 Ga0207692_10023680 Ga0207692_100236802 113
281 3300025898 Ga0207692_10783831 Ga0207692_107838311 113
282 3300025905 Ga0207685_10193105 Ga0207685_101931051 113
283 3300025906 Ga0207699_10333610 Ga0207699_103336102 113
284 3300025906 Ga0207699_10418702 Ga0207699_104187022 113
285 3300025912 Ga0207707_10030057 Ga0207707_100300572 113
286 3300025912 Ga0207707_10462013 Ga0207707_104620132 113
287 3300025913 Ga0207695_10004424 Ga0207695_100044245 113
288 3300025913 Ga0207695_10037249 Ga0207695_100372493 113
289 3300025913 Ga0207695_10651735 Ga0207695_106517352 113
290 3300025913 Ga0207695_10671891 Ga0207695_106718911 113
291 3300025915 Ga0207693_10411418 Ga0207693_104114182 113
292 3300025915 Ga0207693_10427253 Ga0207693_104272532 113
293 3300025916 Ga0207663_10867000 Ga0207663_108670001 113
294 3300025916 Ga0207663_11099109 Ga0207663_110991092 113
295 3300025917 Ga0207660_10222894 Ga0207660_102228942 113
296 3300025924 Ga0207694_10158750 Ga0207694_101587502 113
297 3300025924 Ga0207694_11307167 Ga0207694_113071671 113
298 3300025927 Ga0207687_10009603 Ga0207687_100096034 113
299 3300025927 Ga0207687_10424050 Ga0207687_104240501 113
300 3300025928 Ga0207700_10114851 Ga0207700_101148512 113
301 3300025928 Ga0207700_10397206 Ga0207700_103972062 113
302 3300025928 Ga0207700_10413608 Ga0207700_104136082 113
303 3300025928 Ga0207700_10920047 Ga0207700_109200472 113
304 3300025928 Ga0207700_11558686 Ga0207700_115586861 113
305 3300025929 Ga0207664_10182544 Ga0207664_101825444 113
306 3300025929 Ga0207664_10206122 Ga0207664_102061222 113
307 3300025939 Ga0207665_10169932 Ga0207665_101699324 113
308 3300025939 Ga0207665_10858533 Ga0207665_108585332 113
309 3300025939 Ga0207665_11050298 Ga0207665_110502982 113
310 3300025944 Ga0207661_10818310 Ga0207661_108183102 113
311 3300025944 Ga0207661_11736389 Ga0207661_117363891 113
312 3300025945 Ga0207679_10982059 Ga0207679_109820591 113
313 3300025949 Ga0207667_10070117 Ga0207667_100701173 113
314 3300025949 Ga0207667_10384510 Ga0207667_103845102 113
315 3300025981 Ga0207640_10405688 Ga0207640_104056882 113
316 3300026023 Ga0207677_10558097 Ga0207677_105580971 113
317 3300026041 Ga0207639_11063576 Ga0207639_110635762 113
318 3300026041 Ga0207639_11073981 Ga0207639_110739812 113
319 3300026041 Ga0207639_11159044 Ga0207639_111590442 113
320 3300026078 Ga0207702_10030811 Ga0207702_100308116 113
321 3300028379 Ga0268266_10308942 Ga0268266_103089421 113
322 3300035113 Ga0373936_0010693 Ga0373936_0010693_2047_2421 113
323 3300035170 Ga0373943_0012877 Ga0373943_0012877_546_920 113
324 3300035692 Ga0373935_0108749 Ga0373935_0108749_808_1152 113
325 3300035695 Ga0373927_0069518 Ga0373927_0069518_1583_1957 113
326 3300035725 Ga0373947_0924361 Ga0373947_0924361_172_546 113
327 3300036401 Ga0373937_0085143 Ga0373937_0085143_1927_2268 113
328 3300036401 Ga0373937_0335107 Ga0373937_0335107_871_1212 113
329 3300037068 Ga0373925_0642208 Ga0373925_0642208_456_830 113
330 3300037853 Ga0436364_0461532 Ga0436364_0461532_82_453 113
331 3300037853 Ga0436364_1416704 Ga0436364_1416704_1634_2005 113
332 3300039437 Ga0436365_0804578 Ga0436365_0804578_1830_2201 113
333 3300039437 Ga0436365_1046061 Ga0436365_1046061_776_1147 113
334 3300042876 Ga0451577_0094841 Ga0451577_0094841_120_467 113
335 3300042876 Ga0451577_0382897 Ga0451577_0382897_387_734 113
336 3300044712 Ga0453684_0409944 Ga0453684_0409944_616_963 113
337 3300044712 Ga0453684_0944215 Ga0453684_0944215_327_668 113
338 3300046472 Ga0495580_0068442 Ga0495580_0068442_993_1337 113
339 3300046472 Ga0495580_0505166 Ga0495580_0505166_440_787 113
340 3300046516 Ga0495628_0118252 Ga0495628_0118252_991_1332 113
341 3300046531 Ga0495665_0656417 Ga0495665_0656417_73_447 113
342 3300046536 Ga0495587_0190040 Ga0495587_0190040_220_600 113
343 3300046684 Ga0495669_0245176 Ga0495669_0245176_235_615 113
344 3300048903 Ga0496100_0071261 Ga0496100_0071261_1458_1799 113
345 3300048906 Ga0496103_0097560 Ga0496103_0097560_1436_1777 113
346 3300048915 Ga0496112_0059681 Ga0496112_0059681_1109_1450 113
347 3300048915 Ga0496112_0622071 Ga0496112_0622071_390_734 113
348 3300048918 Ga0496115_1170401 Ga0496115_1170401_133_474 113
349 3300049569 Ga0501032_0166431 Ga0501032_0166431_331_702 113
350 3300049573 Ga0501037_0450398 Ga0501037_0450398_352_723 113
351 3300049580 Ga0501046_0186910 Ga0501046_0186910_717_1088 113
352 3300049581 Ga0501047_0137928 Ga0501047_0137928_1857_2228 113
353 3300049823 Ga0501044_0552860 Ga0501044_0552860_492_863 113
354 3300050510 nmdc:mga06r32_59354_c1 nmdc:mga06r32_59354_c1_1375_1821 113
355 3300050512 nmdc:mga0n895_79163_c1 nmdc:mga0n895_79163_c1_2296_2643 113
356 3300050515 nmdc:mga0a205_296765_c1 nmdc:mga0a205_296765_c1_364_711 113
357 3300059510 Ga0587090_009355 Ga0587090_009355_943_1287 113
358 3300059513 Ga0587094_084568 Ga0587094_084568_79_423 113
359 3300059647 Ga0587079_026517 Ga0587079_026517_315_659 113
360 3300059647 Ga0587079_208644 Ga0587079_208644_52_396 113
361 3300060346 Ga0587111_0017690 Ga0587111_0017690_290_658 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01906

YbjQ_1

Putative heavy-metal-binding

32

134

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vr4-assembly1.cif.gz_B crystal structure of mcsg target apc22750 from bacillus cereus 0.9087 7 107
1vr4-assembly1.cif.gz_B crystal structure of mcsg target apc22750 from bacillus cereus 0.8768 7 107
1y2i-assembly1.cif.gz_C crystal structure of mcsg target apc27401 from shigella flexneri 0.8486 7 112
2gtc-assembly1.cif.gz_E crystal structure of the hypthetical protein from bacillus cereus (atcc 14579). northeast structural genomics target bcr11 0.8379 7 107
1y2i-assembly1.cif.gz_C crystal structure of mcsg target apc27401 from shigella flexneri 0.8196 7 112
ID Description Score Start End Superfamily
af_O06797_156_247_3.30.110.70 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Hypothetical protein apc22750. Chain B 0.8951 22 107 3.30.110.70
af_O06797_156_247_3.30.110.70 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Hypothetical protein apc22750. Chain B 0.8331 22 107 3.30.110.70
1y2iA00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Hypothetical protein apc22750. Chain B 0.8062 8 112 3.30.110.70
af_E7FGZ0_114_211_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8002 85 107 2.60.40.10
1y2iA00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Hypothetical protein apc22750. Chain B 0.7921 8 112 3.30.110.70
ID Description Score Start End GO Terms
AF-A0A4Q3JBN0-F1-model_v4 UPF0145 protein EOO75_15885 0.9594 1 111
AF-Q39A02-F1-model_v4 UPF0145 protein Bcep18194_B0595 0.9581 3 111
AF-G7VB49-F1-model_v4 UPF0145 protein P186_0918 0.955 8 113
AF-A0A7C7L1P1-F1-model_v4 UPF0145 protein EYP10_03325 0.955 7 113
AF-A0A1Y2GBI3-F1-model_v4 Putative heavy-metal-binding-domain-containing protein 0.9541 1 113

Feature Viewer

pLDDT pTM Quality
86.03 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map