F422149

General Info

Members Datasets Scaffolds Average Seq Length
361 139 361 69

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100034589|Ga0068859_1000345893
Length 84
Sequence MTALAATIEPSSIEEVVMSVAKVTEISATSAKSFEDAIQNGLTRAAKTLRNVRGAWIKEQHVGCGEGRVTEYRVNMMVTFVLDD

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
129 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
130 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
135 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
136 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
137 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
138 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.37
Nodule 0
Rhizoplane 0
Rhizosphere 93.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10400130 3300005288 Unclassified 591
2 Ga0065704_10275804 3300005289 Unclassified 933
3 Ga0065712_10006784 3300005290 Bacteria 4485
4 Ga0065712_10042455 3300005290 Unclassified 1065
5 Ga0065712_10183216 3300005290 Unclassified 1182
6 Ga0065712_10615866 3300005290 Bacteria 583
7 Ga0065715_10099734 3300005293 Unclassified 3378
8 Ga0065715_10303153 3300005293 Bacteria 1036
9 Ga0065715_10481937 3300005293 Bacteria 796
10 Ga0065715_10574931 3300005293 Unclassified 724
11 Ga0065715_11083875 3300005293 Unclassified 524
12 Ga0065707_10277434 3300005295 Bacteria 1056
13 Ga0065707_10725372 3300005295 Unclassified 629
14 Ga0070676_10214362 3300005328 Bacteria 1269
15 Ga0070676_10630118 3300005328 Bacteria 776
16 Ga0070676_10961478 3300005328 Bacteria 639
17 Ga0070690_100058321 3300005330 Bacteria 2479
18 Ga0070690_100376450 3300005330 Unclassified 1037
19 Ga0070690_100604201 3300005330 Bacteria 833
20 Ga0070690_101580002 3300005330 Unclassified 531
21 Ga0070670_100014322 3300005331 Bacteria 6804
22 Ga0070670_100287375 3300005331 Bacteria 1436
23 Ga0070670_100297726 3300005331 Bacteria 1411
24 Ga0070670_100526864 3300005331 Bacteria 1053
25 Ga0070677_10074671 3300005333 Bacteria 1435
26 Ga0070677_10535390 3300005333 Bacteria 640
27 Ga0070677_10580176 3300005333 Unclassified 618
28 Ga0068869_100228764 3300005334 Bacteria 1477
29 Ga0068869_100308629 3300005334 Bacteria 1280
30 Ga0068869_100524745 3300005334 Unclassified 992
31 Ga0068869_100670497 3300005334 Bacteria 882
32 Ga0068869_101041736 3300005334 Unclassified 714
33 Ga0070680_100251573 3300005336 Bacteria 1494
34 Ga0070680_101464117 3300005336 Unclassified 591
35 Ga0070682_100000232 3300005337 Bacteria 40448
36 Ga0068868_100164920 3300005338 Bacteria 1832
37 Ga0068868_100513659 3300005338 Unclassified 1051
38 Ga0070689_100057031 3300005340 Bacteria 3030
39 Ga0070689_100084343 3300005340 Bacteria 2497
40 Ga0070689_100101749 3300005340 Bacteria 2275
41 Ga0070689_100471452 3300005340 Bacteria 1071
42 Ga0070689_101005846 3300005340 Bacteria 742
43 Ga0070689_101015906 3300005340 Unclassified 738
44 Ga0070689_101586516 3300005340 Bacteria 594
45 Ga0070689_101595585 3300005340 Bacteria 592
46 Ga0070691_10200476 3300005341 Bacteria 1048
47 Ga0070691_10292312 3300005341 Unclassified 887
48 Ga0070691_10813026 3300005341 Bacteria 570
49 Ga0070692_10162316 3300005345 Bacteria 1281
50 Ga0070668_100597854 3300005347 Bacteria 965
51 Ga0070668_100829502 3300005347 Bacteria 823
52 Ga0070668_101724619 3300005347 Unclassified 575
53 Ga0070669_100017909 3300005353 Bacteria 5058
54 Ga0070669_100059069 3300005353 Bacteria 2816
55 Ga0070669_100223673 3300005353 Bacteria 1489
56 Ga0070669_100293004 3300005353 Bacteria 1307
57 Ga0070669_101767440 3300005353 Bacteria 539
58 Ga0070675_100010726 3300005354 Bacteria 7167
59 Ga0070675_100059385 3300005354 Bacteria 3155
60 Ga0070675_100085358 3300005354 Bacteria 2637
61 Ga0070675_100197539 3300005354 Bacteria 1745
62 Ga0070675_101547318 3300005354 Unclassified 612
63 Ga0070671_100740015 3300005355 Unclassified 854
64 Ga0070674_100312596 3300005356 Bacteria 1257
65 Ga0070674_100382590 3300005356 Bacteria 1145
66 Ga0070674_102012069 3300005356 Bacteria 526
67 Ga0070674_102035374 3300005356 Unclassified 523
68 Ga0070673_100293753 3300005364 Bacteria 1429
69 Ga0070673_100368349 3300005364 Bacteria 1279
70 Ga0070673_100454015 3300005364 Bacteria 1153
71 Ga0070673_101055534 3300005364 Unclassified 758
72 Ga0070673_101107797 3300005364 Unclassified 740
73 Ga0070673_101152107 3300005364 Unclassified 725
74 Ga0070673_101263776 3300005364 Unclassified 693
75 Ga0070673_101397226 3300005364 Unclassified 659
76 Ga0070688_100003160 3300005365 Bacteria 8432
77 Ga0070688_100628288 3300005365 Unclassified 825
78 Ga0070688_100899849 3300005365 Unclassified 698
79 Ga0070659_101721286 3300005366 Unclassified 561
80 Ga0070667_100234076 3300005367 Bacteria 1638
81 Ga0070667_100282984 3300005367 Bacteria 1489
82 Ga0070667_102042885 3300005367 Bacteria 540
83 Ga0070703_10272082 3300005406 Bacteria 695
84 Ga0070703_10535868 3300005406 Bacteria 532
85 Ga0070701_10022332 3300005438 Bacteria 3032
86 Ga0070701_10057126 3300005438 Unclassified 2044
87 Ga0070701_10842356 3300005438 Bacteria 629
88 Ga0070705_100600253 3300005440 Bacteria 851
89 Ga0070700_100184044 3300005441 Bacteria 1456
90 Ga0070700_100299717 3300005441 Unclassified 1173
91 Ga0070700_101040832 3300005441 Unclassified 675
92 Ga0070694_100040225 3300005444 Bacteria 3116
93 Ga0070694_100189915 3300005444 Bacteria 1525
94 Ga0070694_100279469 3300005444 Bacteria 1272
95 Ga0070694_100940318 3300005444 Unclassified 715
96 Ga0070694_101686481 3300005444 Unclassified 539
97 Ga0070678_100323521 3300005456 Bacteria 1317
98 Ga0070678_101981201 3300005456 Unclassified 551
99 Ga0070662_100496114 3300005457 Bacteria 1018
100 Ga0068867_100119471 3300005459 Bacteria 2035
101 Ga0070685_10115523 3300005466 Bacteria 1660
102 Ga0070685_10913636 3300005466 Unclassified 654
103 Ga0070685_11518915 3300005466 Unclassified 516
104 Ga0070706_100073400 3300005467 Unclassified 3167
105 Ga0070706_101140295 3300005467 Bacteria 717
106 Ga0070707_100183479 3300005468 Bacteria 2040
107 Ga0070707_102004498 3300005468 Unclassified 546
108 Ga0070698_100031898 3300005471 Bacteria 5461
109 Ga0070698_100329411 3300005471 Bacteria 1458
110 Ga0070699_100038712 3300005518 Bacteria 4129
111 Ga0070699_101056757 3300005518 Unclassified 745
112 Ga0070699_102122608 3300005518 Unclassified 513
113 Ga0070697_100082789 3300005536 Unclassified 2646
114 Ga0070697_101482912 3300005536 Unclassified 606
115 Ga0070672_100141029 3300005543 Unclassified 1988
116 Ga0070672_100443413 3300005543 Unclassified 1117
117 Ga0070672_101355828 3300005543 Unclassified 636
118 Ga0070672_101644747 3300005543 Bacteria 576
119 Ga0070672_101665991 3300005543 Bacteria 573
120 Ga0070686_100748070 3300005544 Bacteria 784
121 Ga0070686_101170509 3300005544 Bacteria 638
122 Ga0070695_100015887 3300005545 Bacteria 4550
123 Ga0070695_100118050 3300005545 Bacteria 1811
124 Ga0070695_100236982 3300005545 Bacteria 1322
125 Ga0070695_100450294 3300005545 Unclassified 986
126 Ga0070695_100512825 3300005545 Bacteria 929
127 Ga0070695_100780276 3300005545 Unclassified 764
128 Ga0070695_100948614 3300005545 Bacteria 697
129 Ga0070695_101818895 3300005545 Unclassified 511
130 Ga0070696_100061299 3300005546 Unclassified 2631
131 Ga0070696_100464401 3300005546 Unclassified 1001
132 Ga0070693_100236031 3300005547 Bacteria 1205
133 Ga0070693_101343229 3300005547 Unclassified 554
134 Ga0070665_100219693 3300005548 Bacteria 1901
135 Ga0070665_100483554 3300005548 Bacteria 1249
136 Ga0070665_100558406 3300005548 Bacteria 1157
137 Ga0070704_100019326 3300005549 Unclassified 4376
138 Ga0070704_100033052 3300005549 Bacteria 3495
139 Ga0070704_100242431 3300005549 Bacteria 1476
140 Ga0070704_100256547 3300005549 Bacteria 1438
141 Ga0070704_100287991 3300005549 Unclassified 1364
142 Ga0070704_100532768 3300005549 Unclassified 1024
143 Ga0070704_102081732 3300005549 Unclassified 527
144 Ga0070664_100439112 3300005564 Bacteria 1197
145 Ga0068857_100166682 3300005577 Unclassified 2001
146 Ga0068857_100217003 3300005577 Bacteria 1747
147 Ga0068857_100382644 3300005577 Bacteria 1307
148 Ga0068857_100716877 3300005577 Bacteria 951
149 Ga0068854_100332577 3300005578 Bacteria 1238
150 Ga0068854_101469196 3300005578 Unclassified 618
151 Ga0070702_100810007 3300005615 Unclassified 725
152 Ga0070702_101394692 3300005615 Bacteria 573
153 Ga0068852_100369797 3300005616 Bacteria 1404
154 Ga0068852_102567484 3300005616 Unclassified 529
155 Ga0068859_100034589 3300005617 Bacteria 5071
156 Ga0068859_100053657 3300005617 Unclassified 4055
157 Ga0068859_100391528 3300005617 Bacteria 1485
158 Ga0068859_100822637 3300005617 Bacteria 1016
159 Ga0068859_100903880 3300005617 Bacteria 967
160 Ga0068859_101343796 3300005617 Bacteria 788
161 Ga0068859_101803450 3300005617 Unclassified 676
162 Ga0068859_101884700 3300005617 Bacteria 660
163 Ga0068864_100071100 3300005618 Bacteria 3029
164 Ga0068864_100073074 3300005618 Bacteria 2990
165 Ga0068864_101606533 3300005618 Bacteria 654
166 Ga0068864_102102043 3300005618 Bacteria 571
167 Ga0068866_10632514 3300005718 Bacteria 726
168 Ga0068866_10666716 3300005718 Bacteria 710
169 Ga0068861_100013875 3300005719 Bacteria 5647
170 Ga0068861_100681189 3300005719 Unclassified 953
171 Ga0068861_100682384 3300005719 Bacteria 952
172 Ga0068861_100808731 3300005719 Unclassified 880
173 Ga0068861_100867612 3300005719 Bacteria 852
174 Ga0068861_101016985 3300005719 Bacteria 792
175 Ga0068861_102111623 3300005719 Unclassified 563
176 Ga0068861_102214282 3300005719 Bacteria 551
177 Ga0068870_10022563 3300005840 Bacteria 3094
178 Ga0068870_10626549 3300005840 Unclassified 734
179 Ga0068863_100053555 3300005841 Bacteria 3825
180 Ga0068858_100279384 3300005842 Bacteria 1590
181 Ga0068858_100596962 3300005842 Bacteria 1071
182 Ga0068858_101267887 3300005842 Unclassified 725
183 Ga0068860_100385486 3300005843 Bacteria 1384
184 Ga0068860_100631657 3300005843 Bacteria 1078
185 Ga0068860_101911091 3300005843 Unclassified 615
186 Ga0068860_102081536 3300005843 Unclassified 589
187 Ga0068862_100036725 3300005844 Unclassified 4152
188 Ga0068862_100211355 3300005844 Bacteria 1753
189 Ga0068862_100251731 3300005844 Bacteria 1610
190 Ga0068862_100286625 3300005844 Bacteria 1511
191 Ga0068862_100645378 3300005844 Bacteria 1021
192 Ga0068862_100738057 3300005844 Bacteria 957
193 Ga0068862_101018098 3300005844 Bacteria 820
194 Ga0068862_101412294 3300005844 Unclassified 700
195 Ga0068862_101889167 3300005844 Bacteria 607
196 Ga0075365_10460732 3300006038 Bacteria 898
197 Ga0075368_10033395 3300006042 Bacteria 2001
198 Ga0075368_10255089 3300006042 Unclassified 750
199 Ga0075364_10163360 3300006051 Unclassified 1504
200 Ga0075364_10685209 3300006051 Bacteria 700
201 Ga0075364_10973815 3300006051 Bacteria 577
202 Ga0075432_10090363 3300006058 Unclassified 1120
203 Ga0075432_10116446 3300006058 Bacteria 1000
204 Ga0075432_10382113 3300006058 Unclassified 604
205 Ga0075367_10021322 3300006178 Bacteria 3619
206 Ga0075367_10024108 3300006178 Bacteria 3430
207 Ga0075367_10057846 3300006178 Bacteria 2306
208 Ga0075367_10863036 3300006178 Bacteria 577
209 Ga0075366_10002322 3300006195 Bacteria 9720
210 Ga0075366_10067805 3300006195 Bacteria 2123
211 Ga0075366_10152847 3300006195 Bacteria 1398
212 Ga0075366_10378919 3300006195 Bacteria 870
213 Ga0097621_102202956 3300006237 Unclassified 527
214 Ga0075370_10111901 3300006353 Bacteria 1586
215 Ga0068871_102144273 3300006358 Unclassified 532
216 Ga0075428_100002143 3300006844 Bacteria 21312
217 Ga0075428_100083330 3300006844 Bacteria 3489
218 Ga0075428_100822473 3300006844 Bacteria 987
219 Ga0075428_101679268 3300006844 Unclassified 663
220 Ga0075428_102152653 3300006844 Unclassified 576
221 Ga0075430_100096201 3300006846 Bacteria 2475
222 Ga0075430_100269290 3300006846 Bacteria 1410
223 Ga0075430_100588093 3300006846 Bacteria 918
224 Ga0075431_100673897 3300006847 Bacteria 1013
225 Ga0075431_101189756 3300006847 Unclassified 725
226 Ga0075433_10068576 3300006852 Unclassified 3114
227 Ga0075433_10287625 3300006852 Bacteria 1456
228 Ga0075434_100000215 3300006871 Bacteria 39548
229 Ga0075434_100265419 3300006871 Bacteria 1736
230 Ga0075429_100034456 3300006880 Bacteria 4400
231 Ga0075429_100036980 3300006880 Unclassified 4249
232 Ga0075429_100052091 3300006880 Bacteria 3561
233 Ga0075429_100179425 3300006880 Bacteria 1856
234 Ga0068865_100458372 3300006881 Bacteria 1055
235 Ga0068865_100535072 3300006881 Unclassified 982
236 Ga0068865_102046310 3300006881 Unclassified 520
237 Ga0097620_100034589 3300006931 Bacteria 5071
238 Ga0097620_100053658 3300006931 Unclassified 4055
239 Ga0097620_100391550 3300006931 Bacteria 1485
240 Ga0097620_100822514 3300006931 Bacteria 1016
241 Ga0097620_100903857 3300006931 Bacteria 967
242 Ga0097620_101343639 3300006931 Bacteria 788
243 Ga0097620_101803458 3300006931 Unclassified 676
244 Ga0097620_101884832 3300006931 Bacteria 660
245 Ga0105240_11082636 3300009093 Unclassified 854
246 Ga0105240_12041000 3300009093 Unclassified 596
247 Ga0111539_10000362 3300009094 Bacteria 55860
248 Ga0111539_10007855 3300009094 Bacteria 13622
249 Ga0111539_10010687 3300009094 Bacteria 11560
250 Ga0111539_10034240 3300009094 Bacteria 6162
251 Ga0111539_10480182 3300009094 Bacteria 1448
252 Ga0111539_11717295 3300009094 Bacteria 728
253 Ga0105245_10286904 3300009098 Bacteria 1611
254 Ga0105245_11823470 3300009098 Unclassified 661
255 Ga0114129_10009076 3300009147 Bacteria 14171
256 Ga0114129_10155157 3300009147 Bacteria 3131
257 Ga0114129_12256626 3300009147 Bacteria 654
258 Ga0105243_10574789 3300009148 Bacteria 1081
259 Ga0105243_10840297 3300009148 Unclassified 908
260 Ga0105243_10849714 3300009148 Bacteria 904
261 Ga0105243_11319256 3300009148 Bacteria 739
262 Ga0105243_11656886 3300009148 Bacteria 668
263 Ga0105243_12517262 3300009148 Unclassified 554
264 Ga0105242_10323895 3300009176 Bacteria 1414
265 Ga0105242_10899016 3300009176 Unclassified 885
266 Ga0105242_12181014 3300009176 Bacteria 599
267 Ga0105242_12289380 3300009176 Unclassified 586
268 Ga0105242_12780440 3300009176 Bacteria 540
269 Ga0105248_10094831 3300009177 Bacteria 3360
270 Ga0105248_10969416 3300009177 Bacteria 960
271 Ga0105249_10542137 3300009553 Bacteria 1213
272 Ga0105249_11052867 3300009553 Bacteria 883
273 Ga0105239_11121033 3300010375 Bacteria 906
274 Ga0105239_11225487 3300010375 Unclassified 865
275 Ga0105246_11570604 3300011119 Unclassified 621
276 Ga0157374_10380845 3300013296 Bacteria 1405
277 Ga0157378_10072180 3300013297 Bacteria 3102
278 Ga0157378_10562442 3300013297 Bacteria 1147
279 Ga0157378_11657271 3300013297 Bacteria 686
280 Ga0163162_10504382 3300013306 Bacteria 1340
281 Ga0163162_11290043 3300013306 Bacteria 830
282 Ga0163162_11567865 3300013306 Unclassified 751
283 Ga0163162_11589563 3300013306 Bacteria 746
284 Ga0163162_11834914 3300013306 Bacteria 693
285 Ga0157372_10001865 3300013307 Bacteria 22866
286 Ga0157375_10023353 3300013308 Bacteria 5706
287 Ga0157375_10283948 3300013308 Bacteria 1818
288 Ga0157375_12734853 3300013308 Unclassified 590
289 Ga0157375_12876040 3300013308 Unclassified 575
290 Ga0163163_10902584 3300014325 Bacteria 947
291 Ga0163163_11413026 3300014325 Unclassified 757
292 Ga0163163_12575906 3300014325 Bacteria 566
293 Ga0157380_10022794 3300014326 Bacteria 4721
294 Ga0157380_10037696 3300014326 Bacteria 3747
295 Ga0157380_10045911 3300014326 Bacteria 3430
296 Ga0157380_10110199 3300014326 Bacteria 2311
297 Ga0157380_10145198 3300014326 Bacteria 2044
298 Ga0157380_10184768 3300014326 Bacteria 1835
299 Ga0157380_11037521 3300014326 Unclassified 856
300 Ga0157380_11082056 3300014326 Unclassified 840
301 Ga0157380_11371500 3300014326 Bacteria 756
302 Ga0157380_11827176 3300014326 Bacteria 667
303 Ga0157380_12051164 3300014326 Bacteria 634
304 Ga0157380_12458841 3300014326 Unclassified 586
305 Ga0157380_13553936 3300014326 Unclassified 500
306 Ga0157377_10703164 3300014745 Unclassified 734
307 Ga0157377_10956221 3300014745 Bacteria 645
308 Ga0157379_10638902 3300014968 Bacteria 996
309 Ga0157379_11240310 3300014968 Unclassified 718
310 Ga0157379_11351346 3300014968 Unclassified 689
311 Ga0157376_12852257 3300014969 Unclassified 523
312 Ga0207688_10766602 3300025901 Bacteria 611
313 Ga0207645_10490851 3300025907 Bacteria 831
314 Ga0207684_10097136 3300025910 Bacteria 2515
315 Ga0207654_10731477 3300025911 Unclassified 712
316 Ga0207695_10813691 3300025913 Unclassified 814
317 Ga0207646_10116054 3300025922 Bacteria 2405
318 Ga0207681_10013119 3300025923 Bacteria 5122
319 Ga0207650_10001136 3300025925 Bacteria 19569
320 Ga0207659_10331627 3300025926 Bacteria 1258
321 Ga0207644_10750736 3300025931 Unclassified 815
322 Ga0207670_10133380 3300025936 Bacteria 1823
323 Ga0207670_10342143 3300025936 Bacteria 1182
324 Ga0207670_11307945 3300025936 Unclassified 615
325 Ga0207689_10176509 3300025942 Bacteria 1762
326 Ga0207651_10447392 3300025960 Bacteria 1108
327 Ga0207668_11483991 3300025972 Bacteria 612
328 Ga0207677_11273794 3300026023 Unclassified 675
329 Ga0207703_10457294 3300026035 Unclassified 1193
330 Ga0207708_10163438 3300026075 Archaea 1759
331 Ga0207641_10124047 3300026088 Bacteria 2309
332 Ga0207676_10924889 3300026095 Bacteria 856
333 Ga0207674_10140032 3300026116 Unclassified 2379
334 Ga0207675_100201346 3300026118 Bacteria 1912
335 Ga0207675_100887957 3300026118 Unclassified 907
336 Ga0209813_10267023 3300027866 Bacteria 655
337 Ga0268266_10015950 3300028379 Bacteria 6428
338 Ga0307405_10954563 3300031731 Bacteria 729
339 Ga0307413_11179393 3300031824 Bacteria 665
340 Ga0307410_10590900 3300031852 Unclassified 925
341 Ga0307416_100292384 3300032002 Bacteria 1614
342 Ga0307416_100785523 3300032002 Bacteria 1047
343 Ga0307416_101092879 3300032002 Unclassified 902
344 Ga0307414_10212372 3300032004 Bacteria 1583
345 Ga0307411_11705338 3300032005 Unclassified 583
346 Ga0307415_100380524 3300032126 Bacteria 1198
347 Ga0307415_102346786 3300032126 Unclassified 524
348 Ga0439433_0130110 3300041999 Bacteria 639
349 Ga0495663_0000091 3300046525 Bacteria 39770
350 Ga0495598_0001317 3300046537 Bacteria 4865
351 Ga0495621_0000135 3300046539 Bacteria 15563
352 Ga0495668_0132796 3300046616 Bacteria 1362
353 Ga0501045_0078484 3300049824 Bacteria 2434
354 nmdc:mga00v17_111442_c1 3300050491 Bacteria 1736
355 nmdc:mga0k408_461670_c1 3300050493 Bacteria 754
356 nmdc:mga0k408_57931_c1 3300050493 Bacteria 2250
357 nmdc:mga06z11_43838_c1 3300050494 Unclassified 2253
358 nmdc:mga06z11_88971_c1 3300050494 Bacteria 1673
359 nmdc:mga04h51_101953_c1 3300050495 Bacteria 1047
360 nmdc:mga07m45_110014_c1 3300050496 Bacteria 1586
361 Ga0501084_1242467 3300054114 Unclassified 625

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005288 Ga0065714_10400130 Ga0065714_104001302 67
2 3300005289 Ga0065704_10275804 Ga0065704_102758042 67
3 3300005290 Ga0065712_10006784 Ga0065712_100067843 67
4 3300005290 Ga0065712_10042455 Ga0065712_100424552 67
5 3300005290 Ga0065712_10183216 Ga0065712_101832163 67
6 3300005290 Ga0065712_10615866 Ga0065712_106158661 67
7 3300005293 Ga0065715_10099734 Ga0065715_100997344 67
8 3300005293 Ga0065715_10303153 Ga0065715_103031533 67
9 3300005293 Ga0065715_10481937 Ga0065715_104819372 67
10 3300005293 Ga0065715_10574931 Ga0065715_105749311 67
11 3300005293 Ga0065715_11083875 Ga0065715_110838751 67
12 3300005295 Ga0065707_10277434 Ga0065707_102774342 67
13 3300005295 Ga0065707_10725372 Ga0065707_107253721 67
14 3300005328 Ga0070676_10214362 Ga0070676_102143622 67
15 3300005328 Ga0070676_10630118 Ga0070676_106301182 67
16 3300005328 Ga0070676_10961478 Ga0070676_109614782 67
17 3300005330 Ga0070690_100058321 Ga0070690_1000583214 67
18 3300005330 Ga0070690_100376450 Ga0070690_1003764502 67
19 3300005330 Ga0070690_100604201 Ga0070690_1006042012 67
20 3300005330 Ga0070690_101580002 Ga0070690_1015800021 67
21 3300005331 Ga0070670_100014322 Ga0070670_1000143225 67
22 3300005331 Ga0070670_100287375 Ga0070670_1002873752 67
23 3300005331 Ga0070670_100297726 Ga0070670_1002977262 67
24 3300005331 Ga0070670_100526864 Ga0070670_1005268642 67
25 3300005333 Ga0070677_10074671 Ga0070677_100746712 67
26 3300005333 Ga0070677_10535390 Ga0070677_105353901 67
27 3300005333 Ga0070677_10580176 Ga0070677_105801762 67
28 3300005334 Ga0068869_100228764 Ga0068869_1002287641 67
29 3300005334 Ga0068869_100308629 Ga0068869_1003086292 67
30 3300005334 Ga0068869_100524745 Ga0068869_1005247452 67
31 3300005334 Ga0068869_100670497 Ga0068869_1006704972 67
32 3300005334 Ga0068869_101041736 Ga0068869_1010417362 67
33 3300005336 Ga0070680_100251573 Ga0070680_1002515733 67
34 3300005336 Ga0070680_101464117 Ga0070680_1014641171 67
35 3300005337 Ga0070682_100000232 Ga0070682_10000023210 67
36 3300005338 Ga0068868_100164920 Ga0068868_1001649201 67
37 3300005338 Ga0068868_100513659 Ga0068868_1005136591 67
38 3300005340 Ga0070689_100057031 Ga0070689_1000570311 67
39 3300005340 Ga0070689_100084343 Ga0070689_1000843433 67
40 3300005340 Ga0070689_100101749 Ga0070689_1001017494 67
41 3300005340 Ga0070689_100471452 Ga0070689_1004714522 67
42 3300005340 Ga0070689_101005846 Ga0070689_1010058462 67
43 3300005340 Ga0070689_101015906 Ga0070689_1010159062 67
44 3300005340 Ga0070689_101586516 Ga0070689_1015865162 67
45 3300005340 Ga0070689_101595585 Ga0070689_1015955852 67
46 3300005341 Ga0070691_10200476 Ga0070691_102004762 67
47 3300005341 Ga0070691_10292312 Ga0070691_102923123 67
48 3300005341 Ga0070691_10813026 Ga0070691_108130262 67
49 3300005345 Ga0070692_10162316 Ga0070692_101623162 67
50 3300005347 Ga0070668_100597854 Ga0070668_1005978543 67
51 3300005347 Ga0070668_100829502 Ga0070668_1008295022 67
52 3300005347 Ga0070668_101724619 Ga0070668_1017246191 67
53 3300005353 Ga0070669_100017909 Ga0070669_1000179094 67
54 3300005353 Ga0070669_100059069 Ga0070669_1000590691 67
55 3300005353 Ga0070669_100223673 Ga0070669_1002236733 67
56 3300005353 Ga0070669_100293004 Ga0070669_1002930042 67
57 3300005353 Ga0070669_101767440 Ga0070669_1017674401 67
58 3300005354 Ga0070675_100010726 Ga0070675_1000107265 67
59 3300005354 Ga0070675_100059385 Ga0070675_1000593854 67
60 3300005354 Ga0070675_100085358 Ga0070675_1000853582 67
61 3300005354 Ga0070675_100197539 Ga0070675_1001975392 67
62 3300005354 Ga0070675_101547318 Ga0070675_1015473182 67
63 3300005355 Ga0070671_100740015 Ga0070671_1007400152 67
64 3300005356 Ga0070674_100312596 Ga0070674_1003125962 67
65 3300005356 Ga0070674_100382590 Ga0070674_1003825901 67
66 3300005356 Ga0070674_102012069 Ga0070674_1020120691 67
67 3300005356 Ga0070674_102035374 Ga0070674_1020353742 67
68 3300005364 Ga0070673_100293753 Ga0070673_1002937532 67
69 3300005364 Ga0070673_100368349 Ga0070673_1003683491 67
70 3300005364 Ga0070673_100454015 Ga0070673_1004540152 67
71 3300005364 Ga0070673_101055534 Ga0070673_1010555341 67
72 3300005364 Ga0070673_101107797 Ga0070673_1011077972 67
73 3300005364 Ga0070673_101152107 Ga0070673_1011521072 67
74 3300005364 Ga0070673_101263776 Ga0070673_1012637762 67
75 3300005364 Ga0070673_101397226 Ga0070673_1013972261 67
76 3300005365 Ga0070688_100003160 Ga0070688_1000031604 67
77 3300005365 Ga0070688_100628288 Ga0070688_1006282881 67
78 3300005365 Ga0070688_100899849 Ga0070688_1008998491 67
79 3300005366 Ga0070659_101721286 Ga0070659_1017212861 67
80 3300005367 Ga0070667_100234076 Ga0070667_1002340763 67
81 3300005367 Ga0070667_100282984 Ga0070667_1002829843 67
82 3300005367 Ga0070667_102042885 Ga0070667_1020428852 67
83 3300005406 Ga0070703_10272082 Ga0070703_102720822 67
84 3300005406 Ga0070703_10535868 Ga0070703_105358682 67
85 3300005438 Ga0070701_10022332 Ga0070701_100223322 67
86 3300005438 Ga0070701_10057126 Ga0070701_100571263 67
87 3300005438 Ga0070701_10842356 Ga0070701_108423562 67
88 3300005440 Ga0070705_100600253 Ga0070705_1006002532 67
89 3300005441 Ga0070700_100184044 Ga0070700_1001840442 67
90 3300005441 Ga0070700_100299717 Ga0070700_1002997173 67
91 3300005441 Ga0070700_101040832 Ga0070700_1010408322 67
92 3300005444 Ga0070694_100040225 Ga0070694_1000402252 67
93 3300005444 Ga0070694_100189915 Ga0070694_1001899153 67
94 3300005444 Ga0070694_100279469 Ga0070694_1002794692 67
95 3300005444 Ga0070694_100940318 Ga0070694_1009403181 67
96 3300005444 Ga0070694_101686481 Ga0070694_1016864811 67
97 3300005456 Ga0070678_100323521 Ga0070678_1003235212 67
98 3300005456 Ga0070678_101981201 Ga0070678_1019812012 67
99 3300005457 Ga0070662_100496114 Ga0070662_1004961142 67
100 3300005459 Ga0068867_100119471 Ga0068867_1001194715 67
101 3300005466 Ga0070685_10115523 Ga0070685_101155232 67
102 3300005466 Ga0070685_10913636 Ga0070685_109136362 67
103 3300005466 Ga0070685_11518915 Ga0070685_115189151 67
104 3300005467 Ga0070706_100073400 Ga0070706_1000734003 67
105 3300005467 Ga0070706_101140295 Ga0070706_1011402952 67
106 3300005468 Ga0070707_100183479 Ga0070707_1001834792 67
107 3300005468 Ga0070707_102004498 Ga0070707_1020044982 67
108 3300005471 Ga0070698_100031898 Ga0070698_1000318982 67
109 3300005471 Ga0070698_100329411 Ga0070698_1003294112 67
110 3300005518 Ga0070699_100038712 Ga0070699_1000387122 67
111 3300005518 Ga0070699_101056757 Ga0070699_1010567571 67
112 3300005518 Ga0070699_102122608 Ga0070699_1021226082 67
113 3300005536 Ga0070697_100082789 Ga0070697_1000827896 67
114 3300005536 Ga0070697_101482912 Ga0070697_1014829122 67
115 3300005543 Ga0070672_100141029 Ga0070672_1001410294 67
116 3300005543 Ga0070672_100443413 Ga0070672_1004434132 67
117 3300005543 Ga0070672_101355828 Ga0070672_1013558282 67
118 3300005543 Ga0070672_101644747 Ga0070672_1016447472 67
119 3300005543 Ga0070672_101665991 Ga0070672_1016659912 67
120 3300005544 Ga0070686_100748070 Ga0070686_1007480701 67
121 3300005544 Ga0070686_101170509 Ga0070686_1011705091 67
122 3300005545 Ga0070695_100015887 Ga0070695_1000158874 67
123 3300005545 Ga0070695_100118050 Ga0070695_1001180502 67
124 3300005545 Ga0070695_100236982 Ga0070695_1002369822 67
125 3300005545 Ga0070695_100450294 Ga0070695_1004502942 67
126 3300005545 Ga0070695_100512825 Ga0070695_1005128252 67
127 3300005545 Ga0070695_100780276 Ga0070695_1007802762 67
128 3300005545 Ga0070695_100948614 Ga0070695_1009486141 67
129 3300005545 Ga0070695_101818895 Ga0070695_1018188951 67
130 3300005546 Ga0070696_100061299 Ga0070696_1000612992 67
131 3300005546 Ga0070696_100464401 Ga0070696_1004644012 67
132 3300005547 Ga0070693_100236031 Ga0070693_1002360312 67
133 3300005547 Ga0070693_101343229 Ga0070693_1013432292 67
134 3300005548 Ga0070665_100219693 Ga0070665_1002196933 67
135 3300005548 Ga0070665_100483554 Ga0070665_1004835542 67
136 3300005548 Ga0070665_100558406 Ga0070665_1005584061 67
137 3300005549 Ga0070704_100019326 Ga0070704_1000193263 67
138 3300005549 Ga0070704_100033052 Ga0070704_1000330522 67
139 3300005549 Ga0070704_100242431 Ga0070704_1002424314 67
140 3300005549 Ga0070704_100256547 Ga0070704_1002565472 67
141 3300005549 Ga0070704_100287991 Ga0070704_1002879912 67
142 3300005549 Ga0070704_100532768 Ga0070704_1005327681 67
143 3300005549 Ga0070704_102081732 Ga0070704_1020817321 67
144 3300005564 Ga0070664_100439112 Ga0070664_1004391122 67
145 3300005577 Ga0068857_100166682 Ga0068857_1001666824 67
146 3300005577 Ga0068857_100217003 Ga0068857_1002170032 67
147 3300005577 Ga0068857_100382644 Ga0068857_1003826442 67
148 3300005577 Ga0068857_100716877 Ga0068857_1007168771 67
149 3300005578 Ga0068854_100332577 Ga0068854_1003325772 67
150 3300005578 Ga0068854_101469196 Ga0068854_1014691962 67
151 3300005615 Ga0070702_100810007 Ga0070702_1008100072 67
152 3300005615 Ga0070702_101394692 Ga0070702_1013946921 67
153 3300005616 Ga0068852_100369797 Ga0068852_1003697973 67
154 3300005616 Ga0068852_102567484 Ga0068852_1025674842 67
155 3300005617 Ga0068859_100034589 Ga0068859_1000345893 67
156 3300005617 Ga0068859_100053657 Ga0068859_1000536574 67
157 3300005617 Ga0068859_100391528 Ga0068859_1003915282 67
158 3300005617 Ga0068859_100822637 Ga0068859_1008226371 67
159 3300005617 Ga0068859_100903880 Ga0068859_1009038802 67
160 3300005617 Ga0068859_101343796 Ga0068859_1013437962 67
161 3300005617 Ga0068859_101803450 Ga0068859_1018034502 67
162 3300005617 Ga0068859_101884700 Ga0068859_1018847002 67
163 3300005618 Ga0068864_100071100 Ga0068864_1000711005 67
164 3300005618 Ga0068864_100073074 Ga0068864_1000730745 67
165 3300005618 Ga0068864_101606533 Ga0068864_1016065332 67
166 3300005618 Ga0068864_102102043 Ga0068864_1021020431 67
167 3300005718 Ga0068866_10632514 Ga0068866_106325142 67
168 3300005718 Ga0068866_10666716 Ga0068866_106667161 67
169 3300005719 Ga0068861_100013875 Ga0068861_1000138752 67
170 3300005719 Ga0068861_100681189 Ga0068861_1006811892 67
171 3300005719 Ga0068861_100682384 Ga0068861_1006823843 67
172 3300005719 Ga0068861_100808731 Ga0068861_1008087312 67
173 3300005719 Ga0068861_100867612 Ga0068861_1008676122 67
174 3300005719 Ga0068861_101016985 Ga0068861_1010169852 67
175 3300005719 Ga0068861_102111623 Ga0068861_1021116232 67
176 3300005719 Ga0068861_102214282 Ga0068861_1022142822 67
177 3300005840 Ga0068870_10022563 Ga0068870_100225633 67
178 3300005840 Ga0068870_10626549 Ga0068870_106265492 67
179 3300005841 Ga0068863_100053555 Ga0068863_1000535555 67
180 3300005842 Ga0068858_100279384 Ga0068858_1002793842 67
181 3300005842 Ga0068858_100596962 Ga0068858_1005969622 67
182 3300005842 Ga0068858_101267887 Ga0068858_1012678872 67
183 3300005843 Ga0068860_100385486 Ga0068860_1003854864 67
184 3300005843 Ga0068860_100631657 Ga0068860_1006316571 67
185 3300005843 Ga0068860_101911091 Ga0068860_1019110911 67
186 3300005843 Ga0068860_102081536 Ga0068860_1020815361 67
187 3300005844 Ga0068862_100036725 Ga0068862_1000367252 67
188 3300005844 Ga0068862_100211355 Ga0068862_1002113552 67
189 3300005844 Ga0068862_100251731 Ga0068862_1002517312 67
190 3300005844 Ga0068862_100286625 Ga0068862_1002866253 67
191 3300005844 Ga0068862_100645378 Ga0068862_1006453782 67
192 3300005844 Ga0068862_100738057 Ga0068862_1007380572 67
193 3300005844 Ga0068862_101018098 Ga0068862_1010180982 67
194 3300005844 Ga0068862_101412294 Ga0068862_1014122942 67
195 3300005844 Ga0068862_101889167 Ga0068862_1018891672 67
196 3300006038 Ga0075365_10460732 Ga0075365_104607322 67
197 3300006042 Ga0075368_10033395 Ga0075368_100333952 67
198 3300006042 Ga0075368_10255089 Ga0075368_102550892 67
199 3300006051 Ga0075364_10163360 Ga0075364_101633602 67
200 3300006051 Ga0075364_10685209 Ga0075364_106852092 67
201 3300006051 Ga0075364_10973815 Ga0075364_109738152 67
202 3300006058 Ga0075432_10090363 Ga0075432_100903633 67
203 3300006058 Ga0075432_10116446 Ga0075432_101164462 67
204 3300006058 Ga0075432_10382113 Ga0075432_103821132 67
205 3300006178 Ga0075367_10021322 Ga0075367_100213223 67
206 3300006178 Ga0075367_10024108 Ga0075367_100241084 67
207 3300006178 Ga0075367_10057846 Ga0075367_100578463 67
208 3300006178 Ga0075367_10863036 Ga0075367_108630362 67
209 3300006195 Ga0075366_10002322 Ga0075366_1000232211 67
210 3300006195 Ga0075366_10067805 Ga0075366_100678054 67
211 3300006195 Ga0075366_10152847 Ga0075366_101528473 67
212 3300006195 Ga0075366_10378919 Ga0075366_103789192 67
213 3300006237 Ga0097621_102202956 Ga0097621_1022029562 67
214 3300006353 Ga0075370_10111901 Ga0075370_101119012 67
215 3300006358 Ga0068871_102144273 Ga0068871_1021442731 67
216 3300006844 Ga0075428_100002143 Ga0075428_10000214319 67
217 3300006844 Ga0075428_100083330 Ga0075428_1000833305 67
218 3300006844 Ga0075428_100822473 Ga0075428_1008224732 67
219 3300006844 Ga0075428_101679268 Ga0075428_1016792682 67
220 3300006844 Ga0075428_102152653 Ga0075428_1021526532 67
221 3300006846 Ga0075430_100096201 Ga0075430_1000962012 67
222 3300006846 Ga0075430_100269290 Ga0075430_1002692903 67
223 3300006846 Ga0075430_100588093 Ga0075430_1005880932 67
224 3300006847 Ga0075431_100673897 Ga0075431_1006738972 67
225 3300006847 Ga0075431_101189756 Ga0075431_1011897561 67
226 3300006852 Ga0075433_10068576 Ga0075433_100685764 67
227 3300006852 Ga0075433_10287625 Ga0075433_102876253 67
228 3300006871 Ga0075434_100000215 Ga0075434_10000021517 67
229 3300006871 Ga0075434_100265419 Ga0075434_1002654192 67
230 3300006880 Ga0075429_100034456 Ga0075429_1000344565 67
231 3300006880 Ga0075429_100036980 Ga0075429_1000369802 67
232 3300006880 Ga0075429_100052091 Ga0075429_1000520913 67
233 3300006880 Ga0075429_100179425 Ga0075429_1001794252 67
234 3300006881 Ga0068865_100458372 Ga0068865_1004583722 67
235 3300006881 Ga0068865_100535072 Ga0068865_1005350722 67
236 3300006881 Ga0068865_102046310 Ga0068865_1020463101 67
237 3300006931 Ga0097620_100034589 Ga0097620_1000345896 67
238 3300006931 Ga0097620_100053658 Ga0097620_1000536584 67
239 3300006931 Ga0097620_100391550 Ga0097620_1003915502 67
240 3300006931 Ga0097620_100822514 Ga0097620_1008225141 67
241 3300006931 Ga0097620_100903857 Ga0097620_1009038572 67
242 3300006931 Ga0097620_101343639 Ga0097620_1013436392 67
243 3300006931 Ga0097620_101803458 Ga0097620_1018034581 67
244 3300006931 Ga0097620_101884832 Ga0097620_1018848322 67
245 3300009093 Ga0105240_11082636 Ga0105240_110826362 67
246 3300009093 Ga0105240_12041000 Ga0105240_120410002 67
247 3300009094 Ga0111539_10000362 Ga0111539_1000036242 67
248 3300009094 Ga0111539_10007855 Ga0111539_100078556 67
249 3300009094 Ga0111539_10010687 Ga0111539_100106876 67
250 3300009094 Ga0111539_10034240 Ga0111539_100342404 67
251 3300009094 Ga0111539_10480182 Ga0111539_104801823 67
252 3300009094 Ga0111539_11717295 Ga0111539_117172952 67
253 3300009098 Ga0105245_10286904 Ga0105245_102869042 67
254 3300009098 Ga0105245_11823470 Ga0105245_118234701 67
255 3300009147 Ga0114129_10009076 Ga0114129_100090766 67
256 3300009147 Ga0114129_10155157 Ga0114129_101551571 67
257 3300009147 Ga0114129_12256626 Ga0114129_122566262 67
258 3300009148 Ga0105243_10574789 Ga0105243_105747892 67
259 3300009148 Ga0105243_10840297 Ga0105243_108402972 67
260 3300009148 Ga0105243_10849714 Ga0105243_108497142 67
261 3300009148 Ga0105243_11319256 Ga0105243_113192562 67
262 3300009148 Ga0105243_11656886 Ga0105243_116568862 67
263 3300009148 Ga0105243_12517262 Ga0105243_125172621 67
264 3300009176 Ga0105242_10323895 Ga0105242_103238952 67
265 3300009176 Ga0105242_10899016 Ga0105242_108990163 67
266 3300009176 Ga0105242_12181014 Ga0105242_121810141 67
267 3300009176 Ga0105242_12289380 Ga0105242_122893801 67
268 3300009176 Ga0105242_12780440 Ga0105242_127804402 67
269 3300009177 Ga0105248_10094831 Ga0105248_100948314 67
270 3300009177 Ga0105248_10969416 Ga0105248_109694162 67
271 3300009553 Ga0105249_10542137 Ga0105249_105421372 67
272 3300009553 Ga0105249_11052867 Ga0105249_110528671 67
273 3300010375 Ga0105239_11121033 Ga0105239_111210332 67
274 3300010375 Ga0105239_11225487 Ga0105239_112254871 67
275 3300011119 Ga0105246_11570604 Ga0105246_115706042 67
276 3300013296 Ga0157374_10380845 Ga0157374_103808453 67
277 3300013297 Ga0157378_10072180 Ga0157378_100721802 67
278 3300013297 Ga0157378_10562442 Ga0157378_105624422 67
279 3300013297 Ga0157378_11657271 Ga0157378_116572712 67
280 3300013306 Ga0163162_10504382 Ga0163162_105043823 67
281 3300013306 Ga0163162_11290043 Ga0163162_112900432 67
282 3300013306 Ga0163162_11567865 Ga0163162_115678652 67
283 3300013306 Ga0163162_11589563 Ga0163162_115895632 67
284 3300013306 Ga0163162_11834914 Ga0163162_118349142 67
285 3300013307 Ga0157372_10001865 Ga0157372_1000186510 67
286 3300013308 Ga0157375_10023353 Ga0157375_100233534 67
287 3300013308 Ga0157375_10283948 Ga0157375_102839482 67
288 3300013308 Ga0157375_12734853 Ga0157375_127348532 67
289 3300013308 Ga0157375_12876040 Ga0157375_128760401 67
290 3300014325 Ga0163163_10902584 Ga0163163_109025842 67
291 3300014325 Ga0163163_11413026 Ga0163163_114130262 67
292 3300014325 Ga0163163_12575906 Ga0163163_125759062 67
293 3300014326 Ga0157380_10022794 Ga0157380_100227949 67
294 3300014326 Ga0157380_10037696 Ga0157380_100376963 67
295 3300014326 Ga0157380_10045911 Ga0157380_100459116 67
296 3300014326 Ga0157380_10110199 Ga0157380_101101992 67
297 3300014326 Ga0157380_10145198 Ga0157380_101451982 67
298 3300014326 Ga0157380_10184768 Ga0157380_101847681 67
299 3300014326 Ga0157380_11037521 Ga0157380_110375212 67
300 3300014326 Ga0157380_11082056 Ga0157380_110820561 67
301 3300014326 Ga0157380_11371500 Ga0157380_113715002 67
302 3300014326 Ga0157380_11827176 Ga0157380_118271761 67
303 3300014326 Ga0157380_12051164 Ga0157380_120511642 67
304 3300014326 Ga0157380_12458841 Ga0157380_124588412 67
305 3300014326 Ga0157380_13553936 Ga0157380_135539361 67
306 3300014745 Ga0157377_10703164 Ga0157377_107031641 67
307 3300014745 Ga0157377_10956221 Ga0157377_109562212 67
308 3300014968 Ga0157379_10638902 Ga0157379_106389022 67
309 3300014968 Ga0157379_11240310 Ga0157379_112403101 67
310 3300014968 Ga0157379_11351346 Ga0157379_113513462 67
311 3300014969 Ga0157376_12852257 Ga0157376_128522572 67
312 3300025901 Ga0207688_10766602 Ga0207688_107666022 67
313 3300025907 Ga0207645_10490851 Ga0207645_104908512 67
314 3300025910 Ga0207684_10097136 Ga0207684_100971362 67
315 3300025911 Ga0207654_10731477 Ga0207654_107314771 67
316 3300025913 Ga0207695_10813691 Ga0207695_108136912 67
317 3300025922 Ga0207646_10116054 Ga0207646_101160543 67
318 3300025923 Ga0207681_10013119 Ga0207681_100131192 67
319 3300025925 Ga0207650_10001136 Ga0207650_100011364 67
320 3300025926 Ga0207659_10331627 Ga0207659_103316272 67
321 3300025931 Ga0207644_10750736 Ga0207644_107507362 67
322 3300025936 Ga0207670_10133380 Ga0207670_101333801 67
323 3300025936 Ga0207670_10342143 Ga0207670_103421432 67
324 3300025936 Ga0207670_11307945 Ga0207670_113079451 67
325 3300025942 Ga0207689_10176509 Ga0207689_101765092 67
326 3300025960 Ga0207651_10447392 Ga0207651_104473922 67
327 3300025972 Ga0207668_11483991 Ga0207668_114839912 67
328 3300026023 Ga0207677_11273794 Ga0207677_112737941 67
329 3300026035 Ga0207703_10457294 Ga0207703_104572942 67
330 3300026075 Ga0207708_10163438 Ga0207708_101634382 67
331 3300026088 Ga0207641_10124047 Ga0207641_101240471 67
332 3300026095 Ga0207676_10924889 Ga0207676_109248891 67
333 3300026116 Ga0207674_10140032 Ga0207674_101400322 67
334 3300026118 Ga0207675_100201346 Ga0207675_1002013463 67
335 3300026118 Ga0207675_100887957 Ga0207675_1008879572 67
336 3300027866 Ga0209813_10267023 Ga0209813_102670232 67
337 3300028379 Ga0268266_10015950 Ga0268266_100159505 67
338 3300031731 Ga0307405_10954563 Ga0307405_109545632 67
339 3300031824 Ga0307413_11179393 Ga0307413_111793932 67
340 3300031852 Ga0307410_10590900 Ga0307410_105909001 67
341 3300032002 Ga0307416_100292384 Ga0307416_1002923842 67
342 3300032002 Ga0307416_100785523 Ga0307416_1007855232 67
343 3300032002 Ga0307416_101092879 Ga0307416_1010928792 67
344 3300032004 Ga0307414_10212372 Ga0307414_102123723 67
345 3300032005 Ga0307411_11705338 Ga0307411_117053381 67
346 3300032126 Ga0307415_100380524 Ga0307415_1003805241 67
347 3300032126 Ga0307415_102346786 Ga0307415_1023467861 67
348 3300041999 Ga0439433_0130110 Ga0439433_0130110_143_349 67
349 3300046525 Ga0495663_0000091 Ga0495663_0000091_5977_6201 67
350 3300046537 Ga0495598_0001317 Ga0495598_0001317_207_431 67
351 3300046539 Ga0495621_0000135 Ga0495621_0000135_4164_4388 67
352 3300046616 Ga0495668_0132796 Ga0495668_0132796_67_291 67
353 3300049824 Ga0501045_0078484 Ga0501045_0078484_667_882 67
354 3300050491 nmdc:mga00v17_111442_c1 nmdc:mga00v17_111442_c1_1191_1397 67
355 3300050493 nmdc:mga0k408_461670_c1 nmdc:mga0k408_461670_c1_384_590 67
356 3300050493 nmdc:mga0k408_57931_c1 nmdc:mga0k408_57931_c1_1521_1727 67
357 3300050494 nmdc:mga06z11_43838_c1 nmdc:mga06z11_43838_c1_10_216 67
358 3300050494 nmdc:mga06z11_88971_c1 nmdc:mga06z11_88971_c1_187_393 67
359 3300050495 nmdc:mga04h51_101953_c1 nmdc:mga04h51_101953_c1_250_456 67
360 3300050496 nmdc:mga07m45_110014_c1 nmdc:mga07m45_110014_c1_1108_1314 67
361 3300054114 Ga0501084_1242467 Ga0501084_1242467_365_580 67

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07311

Dodecin

Dodecin

20

83

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ri3-assembly1.cif.gz_A dodecin from streptomyces davaonensis 0.9549 2 67
6r1e-assembly1.cif.gz_A structure of dodecin from streptomyces coelicolor 0.9505 2 67
2vxa-assembly1.cif.gz_A h. halophila dodecin in complex with riboflavin 0.9469 1 66
2v19-assembly1.cif.gz_D crystal structure of the t. thermophilus dodecin r45a mutant 0.9415 1 67
3oqt-assembly1.cif.gz_C-2 crystal structure of rv1498a protein from mycobacterium tuberculosis 0.9379 3 67
ID Description Score Start End Superfamily
2vkfA00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.9157 3 66 3.30.1660.10
2vkfA00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.9021 3 66 3.30.1660.10
3oqtP00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8942 1 67 3.30.1660.10
af_G2TRR0_12_69_3.30.1660.10 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8859 7 61 3.30.1660.10
3oqtP00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8821 1 67 3.30.1660.10
ID Description Score Start End GO Terms
AF-A0A7K0JRP6-F1-model_v4 deleted 1.005 7 66
AF-A0A7W9DVU8-F1-model_v4 deleted 1.001 12 67
AF-A0A363TRW0-F1-model_v4 Dodecin domain-containing protein 0.991 3 67
AF-A0A259WZZ9-F1-model_v4 deleted 0.9891 3 66
AF-A0A0T6AJ01-F1-model_v4 Dodecin domain-containing protein 0.9887 2 67

Feature Viewer

pLDDT pTM Quality
94.5 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map