F422109

General Info

Members Datasets Scaffolds Average Seq Length
361 173 722 189

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10530522|Ga0070666_105305221
Length 224
Sequence MRGAAGTGTRKPEAPNPEARSPKPELAGSMQFDYGVRMTSRILIITGDGGESYETWFAVHRFQEAGYETRVAAPTQKRLNLVMHDFEPGWDTYKEQPGYIMESDLTFTDVVVREYDAVMCIGGRAPEYLRNDRRVLAILREFDALEKWIFTICHGVQLAAAAGLLKDKRVTCYEHVRSEVEACGGRYVASASVRDGRLVSAPTWREHPEFYREVFTCLQQPVVA

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
108 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
109 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
115 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.93
Nodule 0
Rhizoplane 4.16
Rhizosphere 88.37
Stem 0
Stem Tuber 0
Unclassified 15.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10530522 3300005335 Bacteria 855
2 Ga0065704_10198949 3300005289 Bacteria 1155
3 Ga0065712_10088995 3300005290 Bacteria 2492
4 Ga0065712_10097770 3300005290 Bacteria 2140
5 Ga0065715_10093700 3300005293 Bacteria 4595
6 Ga0065715_10146741 3300005293 Unclassified 1779
7 Ga0065715_10254848 3300005293 Bacteria 1155
8 Ga0065715_10584753 3300005293 Bacteria 718
9 Ga0070683_100000208 3300005329 Bacteria 39707
10 Ga0070683_100005064 3300005329 Bacteria 10945
11 Ga0070670_100022638 3300005331 Bacteria 5408
12 Ga0070670_100112805 3300005331 Bacteria 2343
13 Ga0068869_100052046 3300005334 Bacteria 2972
14 Ga0068869_100087139 3300005334 Unclassified 2342
15 Ga0070666_10207843 3300005335 Bacteria 1378
16 Ga0068868_100086230 3300005338 Bacteria 2524
17 Ga0070661_100066045 3300005344 Bacteria 2658
18 Ga0070669_100021173 3300005353 Bacteria 4647
19 Ga0070669_100292964 3300005353 Unclassified 1307
20 Ga0070669_100315508 3300005353 Unclassified 1261
21 Ga0070669_100447357 3300005353 Bacteria 1064
22 Ga0070675_100082588 3300005354 Bacteria 2681
23 Ga0070675_100105150 3300005354 Bacteria 2382
24 Ga0070674_100236206 3300005356 Bacteria 1429
25 Ga0070673_100225003 3300005364 Bacteria 1625
26 Ga0070673_101112738 3300005364 Unclassified 738
27 Ga0070688_100044396 3300005365 Bacteria 2743
28 Ga0070659_100033815 3300005366 Bacteria 3974
29 Ga0070659_100267655 3300005366 Bacteria 1419
30 Ga0070709_10622845 3300005434 Bacteria 833
31 Ga0070713_100013159 3300005436 Bacteria 6099
32 Ga0070694_100223285 3300005444 Bacteria 1414
33 Ga0070694_101109766 3300005444 Bacteria 660
34 Ga0070708_100300317 3300005445 Bacteria 1512
35 Ga0070663_100462121 3300005455 Bacteria 1048
36 Ga0070678_100474229 3300005456 Bacteria 1100
37 Ga0070662_100344340 3300005457 Bacteria 1220
38 Ga0070685_10087783 3300005466 Unclassified 1877
39 Ga0070685_10147648 3300005466 Bacteria 1487
40 Ga0070685_10249349 3300005466 Bacteria 1175
41 Ga0070679_100612229 3300005530 Bacteria 1032
42 Ga0070684_100002450 3300005535 Bacteria 13671
43 Ga0070684_100015861 3300005535 Bacteria 6148
44 Ga0068853_100905271 3300005539 Bacteria 847
45 Ga0070672_100182121 3300005543 Bacteria 1751
46 Ga0070686_100885894 3300005544 Bacteria 725
47 Ga0070686_101061513 3300005544 Bacteria 667
48 Ga0070696_100218275 3300005546 Bacteria 1430
49 Ga0070696_100484694 3300005546 Bacteria 981
50 Ga0070665_100928480 3300005548 Bacteria 883
51 Ga0070704_101002793 3300005549 Viruses 755
52 Ga0070664_100001232 3300005564 Bacteria 20476
53 Ga0070664_100336514 3300005564 Bacteria 1370
54 Ga0070664_100621885 3300005564 Unclassified 1002
55 Ga0070702_100269533 3300005615 Bacteria 1163
56 Ga0068852_100456689 3300005616 Unclassified 1265
57 Ga0068852_101655108 3300005616 Bacteria 662
58 Ga0068864_100351370 3300005618 Bacteria 1391
59 Ga0068864_101497519 3300005618 Bacteria 678
60 Ga0068863_100824150 3300005841 Unclassified 926
61 Ga0068862_100014205 3300005844 Bacteria 6604
62 Ga0068862_100190477 3300005844 Bacteria 1845
63 Ga0081455_10248361 3300005937 Bacteria 1303
64 Ga0075365_10010699 3300006038 Bacteria 5358
65 Ga0075365_10130339 3300006038 Bacteria 1740
66 Ga0075365_10156663 3300006038 Bacteria 1585
67 Ga0075368_10025629 3300006042 Bacteria 2262
68 Ga0075368_10201567 3300006042 Bacteria 842
69 Ga0075363_100130264 3300006048 Bacteria 1410
70 Ga0075364_10005886 3300006051 Bacteria 7162
71 Ga0075362_10000155 3300006177 Bacteria 18626
72 Ga0075367_10004359 3300006178 Bacteria 6898
73 Ga0075367_10037374 3300006178 Unclassified 2821
74 Ga0075367_10074042 3300006178 Unclassified 2053
75 Ga0075366_10002888 3300006195 Bacteria 8917
76 Ga0075366_10016598 3300006195 Unclassified 4234
77 Ga0075366_10026695 3300006195 Bacteria 3384
78 Ga0075370_10017218 3300006353 Bacteria 3902
79 Ga0075428_100008373 3300006844 Bacteria 11465
80 Ga0075430_100211762 3300006846 Bacteria 1608
81 Ga0075431_100152735 3300006847 Bacteria 2377
82 Ga0075431_100770276 3300006847 Bacteria 937
83 Ga0075433_10035360 3300006852 Bacteria 4295
84 Ga0075433_10048122 3300006852 Unclassified 3708
85 Ga0075433_10203684 3300006852 Bacteria 1759
86 Ga0075434_100001384 3300006871 Bacteria 20357
87 Ga0075434_100029752 3300006871 Bacteria 5376
88 Ga0075429_100413144 3300006880 Bacteria 1182
89 Ga0068865_101053674 3300006881 Unclassified 714
90 Ga0075435_100149597 3300007076 Unclassified 1962
91 Ga0075435_100419024 3300007076 Bacteria 1153
92 Ga0105240_10211196 3300009093 Bacteria 2268
93 Ga0111539_10001319 3300009094 Bacteria 33146
94 Ga0111539_10035625 3300009094 Bacteria 6024
95 Ga0111539_10065629 3300009094 Bacteria 4288
96 Ga0111539_10459539 3300009094 Unclassified 1483
97 Ga0111539_10976659 3300009094 Bacteria 985
98 Ga0114129_10004100 3300009147 Bacteria 20591
99 Ga0105249_10000493 3300009553 Bacteria 36447
100 Ga0105249_10841228 3300009553 Bacteria 983
101 Ga0105246_10377550 3300011119 Bacteria 1170
102 Ga0163162_10343132 3300013306 Bacteria 1626
103 Ga0163162_11324788 3300013306 Bacteria 818
104 Ga0163163_10026689 3300014325 Bacteria 5524
105 Ga0163163_11194196 3300014325 Bacteria 823
106 Ga0157380_10007499 3300014326 Bacteria 7747
107 Ga0157379_10238524 3300014968 Bacteria 1649
108 Ga0207697_10000470 3300025315 Bacteria 22759
109 Ga0207697_10005597 3300025315 Bacteria 5816
110 Ga0207688_10001589 3300025901 Bacteria 11976
111 Ga0207688_10290091 3300025901 Unclassified 998
112 Ga0207680_10044735 3300025903 Bacteria 2606
113 Ga0207645_10444154 3300025907 Bacteria 875
114 Ga0207707_10373510 3300025912 Bacteria 1227
115 Ga0207649_10163314 3300025920 Bacteria 1545
116 Ga0207681_10028913 3300025923 Bacteria 3594
117 Ga0207681_10630435 3300025923 Unclassified 888
118 Ga0207650_10096341 3300025925 Bacteria 2269
119 Ga0207650_10734050 3300025925 Bacteria 835
120 Ga0207659_10073667 3300025926 Bacteria 2501
121 Ga0207700_10008414 3300025928 Bacteria 6389
122 Ga0207690_10021121 3300025932 Bacteria 4033
123 Ga0207669_10053984 3300025937 Bacteria 2425
124 Ga0207691_10103210 3300025940 Bacteria 2543
125 Ga0207691_10112312 3300025940 Bacteria 2422
126 Ga0207711_10373679 3300025941 Bacteria 1322
127 Ga0207689_10044036 3300025942 Bacteria 3689
128 Ga0207661_10002905 3300025944 Bacteria 11843
129 Ga0207661_10124022 3300025944 Bacteria 2204
130 Ga0207679_10008468 3300025945 Bacteria 6550
131 Ga0207679_10116049 3300025945 Bacteria 2122
132 Ga0207679_11077964 3300025945 Bacteria 737
133 Ga0207651_10092187 3300025960 Bacteria 2221
134 Ga0207712_10007060 3300025961 Bacteria 7084
135 Ga0207639_10872608 3300026041 Bacteria 840
136 Ga0207678_10085851 3300026067 Bacteria 2690
137 Ga0207678_10433417 3300026067 Bacteria 1141
138 Ga0207641_10906956 3300026088 Unclassified 875
139 Ga0207676_10595632 3300026095 Bacteria 1061
140 Ga0207676_11321333 3300026095 Bacteria 716
141 Ga0207674_10051252 3300026116 Bacteria 4213
142 Ga0207674_10796133 3300026116 Bacteria 912
143 Ga0207675_100031454 3300026118 Unclassified 4943
144 Ga0207683_10415209 3300026121 Bacteria 1239
145 Ga0207698_10276719 3300026142 Unclassified 1550
146 Ga0207698_10893197 3300026142 Bacteria 895
147 Ga0209974_10200928 3300027876 Bacteria 736
148 Ga0207428_10000629 3300027907 Bacteria 41471
149 Ga0207428_10063858 3300027907 Bacteria 2908
150 Ga0268266_10570620 3300028379 Bacteria 1085
151 Ga0268265_10062695 3300028380 Bacteria 2857
152 Ga0307409_100171339 3300031995 Bacteria 1911
153 Ga0373929_0160969 3300035085 Unclassified 608
154 Ga0373943_0191929 3300035170 Bacteria 1127
155 Ga0373946_0251680 3300035171 Bacteria 862
156 Ga0373931_0269331 3300035691 Bacteria 1042
157 Ga0373933_0082182 3300035724 Bacteria 1977
158 Ga0373947_0314043 3300035725 Bacteria 1047
159 Ga0373937_0005654 3300036401 Bacteria 10730
160 Ga0373925_0025123 3300037068 Bacteria 4350
161 Ga0436365_0870406 3300039437 Bacteria 1197
162 Ga0451802_1619323 3300041460 Bacteria 903
163 Ga0451853_2814995 3300041512 Unclassified 597
164 Ga0439443_006386 3300042003 Unclassified 1611
165 Ga0439445_0074642 3300042004 Unclassified 942
166 Ga0439446_0102847 3300042156 Unclassified 905
167 Ga0451577_0042171 3300042876 Unclassified 4093
168 Ga0451576_1420646 3300045051 Bacteria 722
169 Ga0495651_0395263 3300046462 Bacteria 904
170 Ga0495599_0152781 3300046678 Bacteria 1429
171 Ga0495646_0177704 3300046680 Bacteria 1170
172 Ga0495647_0078340 3300046681 Unclassified 1336
173 Ga0495658_0636244 3300046683 Bacteria 683
174 Ga0495581_0466735 3300047315 Unclassified 735
175 Ga0496101_0719677 3300048904 Unclassified 788
176 Ga0496104_0045334 3300048907 Bacteria 4134
177 Ga0496106_0457894 3300048909 Bacteria 1025
178 Ga0496106_0737023 3300048909 Bacteria 784
179 Ga0496108_0007522 3300048911 Bacteria 8833
180 Ga0496108_0107272 3300048911 Bacteria 2385
181 Ga0496109_0001987 3300048912 Bacteria 16952
182 Ga0496109_0474638 3300048912 Bacteria 1181
183 Ga0496110_0003305 3300048913 Bacteria 12312
184 Ga0496111_0058422 3300048914 Bacteria 2793
185 Ga0496112_0000728 3300048915 Bacteria 22872
186 Ga0496112_0316979 3300048915 Bacteria 1504
187 Ga0496113_0123692 3300048916 Bacteria 2025
188 Ga0496114_0207962 3300048917 Bacteria 1716
189 Ga0501032_0004632 3300049569 Bacteria 10342
190 Ga0501032_0015539 3300049569 Bacteria 5368
191 Ga0501032_0112669 3300049569 Bacteria 1799
192 Ga0501033_0003498 3300049570 Bacteria 12873
193 Ga0501033_0025700 3300049570 Bacteria 4436
194 Ga0501033_0046763 3300049570 Bacteria 3217
195 Ga0501033_0054307 3300049570 Bacteria 2964
196 Ga0501034_0032150 3300049571 Bacteria 5330
197 Ga0501034_0032907 3300049571 Bacteria 5264
198 Ga0501034_0176622 3300049571 Bacteria 2101
199 Ga0501034_0224356 3300049571 Bacteria 1830
200 Ga0501034_0233738 3300049571 Bacteria 1786
201 Ga0501034_0972957 3300049571 Bacteria 733
202 Ga0501036_0005997 3300049572 Bacteria 9853
203 Ga0501036_0011717 3300049572 Bacteria 7264
204 Ga0501036_0070513 3300049572 Unclassified 2955
205 Ga0501037_0003421 3300049573 Bacteria 11532
206 Ga0501037_0008196 3300049573 Bacteria 7659
207 Ga0501037_0038691 3300049573 Bacteria 3513
208 Ga0501037_0081047 3300049573 Bacteria 2353
209 Ga0501038_0009954 3300049574 Bacteria 8708
210 Ga0501038_0037555 3300049574 Bacteria 4246
211 Ga0501038_0041875 3300049574 Bacteria 3992
212 Ga0501038_0107751 3300049574 Bacteria 2311
213 Ga0501039_0020162 3300049575 Bacteria 5111
214 Ga0501040_0068789 3300049576 Unclassified 2442
215 Ga0501040_0074378 3300049576 Unclassified 2348
216 Ga0501040_0328865 3300049576 Unclassified 1094
217 Ga0501040_0721380 3300049576 Unclassified 721
218 Ga0501040_0745701 3300049576 Bacteria 708
219 Ga0501041_0499203 3300049577 Bacteria 774
220 Ga0501042_0002204 3300049578 Bacteria 11887
221 Ga0501042_0087286 3300049578 Bacteria 2238
222 Ga0501042_0359195 3300049578 Unclassified 1054
223 Ga0501043_0006775 3300049579 Bacteria 9146
224 Ga0501043_0013435 3300049579 Bacteria 6404
225 Ga0501043_0075602 3300049579 Bacteria 2645
226 Ga0501043_0075665 3300049579 Bacteria 2644
227 Ga0501043_0180924 3300049579 Bacteria 1642
228 Ga0501043_0275953 3300049579 Bacteria 1289
229 Ga0501046_0011772 3300049580 Bacteria 7469
230 Ga0501046_0012621 3300049580 Bacteria 7184
231 Ga0501046_0054429 3300049580 Bacteria 3147
232 Ga0501047_0000207 3300049581 Bacteria 71430
233 Ga0501047_0002476 3300049581 Bacteria 17626
234 Ga0501047_0059581 3300049581 Bacteria 3685
235 Ga0501047_0101119 3300049581 Unclassified 2762
236 Ga0501047_0303801 3300049581 Bacteria 1437
237 Ga0501047_0344437 3300049581 Bacteria 1328
238 Ga0501048_0003433 3300049582 Bacteria 12034
239 Ga0501048_0032894 3300049582 Bacteria 3747
240 Ga0501048_0044982 3300049582 Bacteria 3154
241 Ga0501048_0045179 3300049582 Bacteria 3147
242 Ga0501048_0085795 3300049582 Bacteria 2220
243 Ga0501048_0117172 3300049582 Bacteria 1881
244 Ga0501067_0013234 3300049583 Bacteria 4567
245 Ga0501067_0039698 3300049583 Bacteria 2613
246 Ga0501067_0064480 3300049583 Bacteria 2028
247 Ga0501067_0079470 3300049583 Bacteria 1817
248 Ga0501068_0002208 3300049584 Bacteria 10359
249 Ga0501068_0022237 3300049584 Bacteria 3706
250 Ga0501068_0032472 3300049584 Bacteria 3105
251 Ga0501068_0059048 3300049584 Bacteria 2328
252 Ga0501068_0084605 3300049584 Bacteria 1951
253 Ga0501068_0578226 3300049584 Bacteria 731
254 Ga0501069_0000397 3300049585 Bacteria 19646
255 Ga0501069_0062032 3300049585 Bacteria 2087
256 Ga0501069_0067152 3300049585 Bacteria 2005
257 Ga0501069_0099943 3300049585 Unclassified 1646
258 Ga0501070_0042625 3300049586 Bacteria 3779
259 Ga0501070_0047286 3300049586 Bacteria 3576
260 Ga0501070_0152323 3300049586 Bacteria 1907
261 Ga0501070_0285359 3300049586 Bacteria 1346
262 Ga0501071_0003316 3300049587 Bacteria 10054
263 Ga0501071_0025727 3300049587 Bacteria 4124
264 Ga0501071_0126739 3300049587 Bacteria 1895
265 Ga0501071_0137404 3300049587 Unclassified 1819
266 Ga0501071_0672881 3300049587 Unclassified 797
267 Ga0501072_0021555 3300049588 Bacteria 4997
268 Ga0501072_0036963 3300049588 Bacteria 3830
269 Ga0501072_0263331 3300049588 Unclassified 1372
270 Ga0501072_0381434 3300049588 Unclassified 1118
271 Ga0501073_0004762 3300049589 Bacteria 10184
272 Ga0501073_0007047 3300049589 Bacteria 8374
273 Ga0501073_0027259 3300049589 Bacteria 4088
274 Ga0501073_0034915 3300049589 Bacteria 3576
275 Ga0501073_0040946 3300049589 Bacteria 3275
276 Ga0501073_0214678 3300049589 Bacteria 1329
277 Ga0501073_0259690 3300049589 Bacteria 1199
278 Ga0501074_0005990 3300049590 Bacteria 8770
279 Ga0501074_0010512 3300049590 Bacteria 6718
280 Ga0501074_0056775 3300049590 Bacteria 2821
281 Ga0501074_0450699 3300049590 Bacteria 912
282 Ga0501074_0624710 3300049590 Unclassified 761
283 Ga0501075_0005395 3300049591 Bacteria 8745
284 Ga0501075_0369810 3300049591 Bacteria 1093
285 Ga0501075_0994099 3300049591 Bacteria 638
286 Ga0501076_0007847 3300049592 Bacteria 7778
287 Ga0501076_0077669 3300049592 Bacteria 2664
288 Ga0501076_0390282 3300049592 Unclassified 1144
289 Ga0501076_1232856 3300049592 Bacteria 615
290 Ga0501079_0004116 3300049741 Bacteria 10759
291 Ga0501079_0030167 3300049741 Bacteria 4166
292 Ga0501079_0100205 3300049741 Unclassified 2246
293 Ga0501079_0138845 3300049741 Unclassified 1893
294 Ga0501079_0194870 3300049741 Bacteria 1582
295 Ga0501079_0586917 3300049741 Bacteria 877
296 Ga0501080_0006520 3300049742 Bacteria 10484
297 Ga0501080_0009245 3300049742 Bacteria 8983
298 Ga0501080_0022223 3300049742 Bacteria 5876
299 Ga0501080_0180992 3300049742 Bacteria 1939
300 Ga0501080_0238608 3300049742 Unclassified 1660
301 Ga0501080_0419418 3300049742 Unclassified 1202
302 Ga0501081_0338929 3300049743 Unclassified 1107
303 Ga0501081_0485732 3300049743 Bacteria 920
304 Ga0501083_0011029 3300049744 Bacteria 6349
305 Ga0501083_0011940 3300049744 Bacteria 6086
306 Ga0501083_0031811 3300049744 Bacteria 3620
307 Ga0501083_0034433 3300049744 Bacteria 3463
308 Ga0501083_0035313 3300049744 Bacteria 3415
309 Ga0501083_0038568 3300049744 Bacteria 3247
310 Ga0501083_0063408 3300049744 Bacteria 2465
311 Ga0501035_0028191 3300049822 Bacteria 5125
312 Ga0501035_0053636 3300049822 Bacteria 3604
313 Ga0501035_0070632 3300049822 Bacteria 3092
314 Ga0501035_0105831 3300049822 Bacteria 2467
315 Ga0501035_0230750 3300049822 Bacteria 1577
316 Ga0501044_0002954 3300049823 Bacteria 19342
317 Ga0501044_0037802 3300049823 Bacteria 5044
318 Ga0501044_0118840 3300049823 Bacteria 2645
319 Ga0501044_0208289 3300049823 Bacteria 1910
320 Ga0501044_0707165 3300049823 Bacteria 892
321 Ga0501045_0013840 3300049824 Bacteria 5705
322 Ga0501045_0082403 3300049824 Bacteria 2372
323 Ga0501045_0556794 3300049824 Unclassified 850
324 nmdc:mga03n38_199873_c1 3300050490 Bacteria 1034
325 nmdc:mga00v17_327915_c1 3300050491 Bacteria 995
326 nmdc:mga0yw44_368163_c1 3300050492 Bacteria 969
327 nmdc:mga0yw44_39369_c1 3300050492 Bacteria 2803
328 nmdc:mga0k408_25847_c1 3300050493 Unclassified 3327
329 nmdc:mga0k408_41708_c1 3300050493 Unclassified 2642
330 nmdc:mga06z11_26118_c1 3300050494 Unclassified 2776
331 nmdc:mga06z11_29295_c1 3300050494 Bacteria 2651
332 nmdc:mga04h51_24188_c1 3300050495 Bacteria 1858
333 nmdc:mga06r32_144694_c1 3300050510 Bacteria 2354
334 nmdc:mga08y16_141729_c1 3300050511 Unclassified 2499
335 nmdc:mga08y16_1612_c1 3300050511 Bacteria 22827
336 nmdc:mga08y16_17765_c1 3300050511 Bacteria 7491
337 nmdc:mga08y16_233663_c1 3300050511 Bacteria 1901
338 nmdc:mga0n895_38378_c1 3300050512 Bacteria 4641
339 nmdc:mga0n895_401421_c1 3300050512 Bacteria 1386
340 nmdc:mga0n895_47383_c1 3300050512 Bacteria 4202
341 nmdc:mga0n895_686877_c1 3300050512 Bacteria 1020
342 nmdc:mga0rr50_69289_c1 3300050513 Unclassified 2684
343 nmdc:mga0rr50_842740_c1 3300050513 Bacteria 782
344 nmdc:mga0a205_10858_c1 3300050515 Bacteria 8377
345 nmdc:mga0a205_1117212_c1 3300050515 Bacteria 636
346 nmdc:mga0a205_348023_c1 3300050515 Bacteria 1350
347 nmdc:mga0a205_41377_c1 3300050515 Bacteria 4437
348 Ga0495601_0259757 3300053077 Bacteria 1134
349 Ga0500588_0024432 3300053146 Bacteria 1668
350 Ga0501084_0005232 3300054114 Bacteria 10617
351 Ga0501084_0009411 3300054114 Bacteria 8085
352 Ga0501084_0023622 3300054114 Bacteria 5127
353 Ga0501084_0141861 3300054114 Bacteria 2023
354 Ga0501084_0191229 3300054114 Bacteria 1727
355 Ga0501084_0565875 3300054114 Bacteria 960
356 Ga0501082_0004238 3300060353 Bacteria 12531
357 Ga0501082_0012570 3300060353 Bacteria 7274
358 Ga0501082_0045673 3300060353 Bacteria 3777
359 Ga0501082_0154554 3300060353 Bacteria 1993
360 Ga0501082_0369966 3300060353 Bacteria 1250
361 Ga0501082_0866117 3300060353 Bacteria 790
362 Ga0070666_10530522
363 Ga0065704_10198949
364 Ga0065712_10088995
365 Ga0065712_10097770
366 Ga0065715_10093700
367 Ga0065715_10146741
368 Ga0065715_10254848
369 Ga0065715_10584753
370 Ga0070683_100000208
371 Ga0070683_100005064
372 Ga0070670_100022638
373 Ga0070670_100112805
374 Ga0068869_100052046
375 Ga0068869_100087139
376 Ga0070666_10207843
377 Ga0068868_100086230
378 Ga0070661_100066045
379 Ga0070669_100021173
380 Ga0070669_100292964
381 Ga0070669_100315508
382 Ga0070669_100447357
383 Ga0070675_100082588
384 Ga0070675_100105150
385 Ga0070674_100236206
386 Ga0070673_100225003
387 Ga0070673_101112738
388 Ga0070688_100044396
389 Ga0070659_100033815
390 Ga0070659_100267655
391 Ga0070709_10622845
392 Ga0070713_100013159
393 Ga0070694_100223285
394 Ga0070694_101109766
395 Ga0070708_100300317
396 Ga0070663_100462121
397 Ga0070678_100474229
398 Ga0070662_100344340
399 Ga0070685_10087783
400 Ga0070685_10147648
401 Ga0070685_10249349
402 Ga0070679_100612229
403 Ga0070684_100002450
404 Ga0070684_100015861
405 Ga0068853_100905271
406 Ga0070672_100182121
407 Ga0070686_100885894
408 Ga0070686_101061513
409 Ga0070696_100218275
410 Ga0070696_100484694
411 Ga0070665_100928480
412 Ga0070704_101002793
413 Ga0070664_100001232
414 Ga0070664_100336514
415 Ga0070664_100621885
416 Ga0070702_100269533
417 Ga0068852_100456689
418 Ga0068852_101655108
419 Ga0068864_100351370
420 Ga0068864_101497519
421 Ga0068863_100824150
422 Ga0068862_100014205
423 Ga0068862_100190477
424 Ga0081455_10248361
425 Ga0075365_10010699
426 Ga0075365_10130339
427 Ga0075365_10156663
428 Ga0075368_10025629
429 Ga0075368_10201567
430 Ga0075363_100130264
431 Ga0075364_10005886
432 Ga0075362_10000155
433 Ga0075367_10004359
434 Ga0075367_10037374
435 Ga0075367_10074042
436 Ga0075366_10002888
437 Ga0075366_10016598
438 Ga0075366_10026695
439 Ga0075370_10017218
440 Ga0075428_100008373
441 Ga0075430_100211762
442 Ga0075431_100152735
443 Ga0075431_100770276
444 Ga0075433_10035360
445 Ga0075433_10048122
446 Ga0075433_10203684
447 Ga0075434_100001384
448 Ga0075434_100029752
449 Ga0075429_100413144
450 Ga0068865_101053674
451 Ga0075435_100149597
452 Ga0075435_100419024
453 Ga0105240_10211196
454 Ga0111539_10001319
455 Ga0111539_10035625
456 Ga0111539_10065629
457 Ga0111539_10459539
458 Ga0111539_10976659
459 Ga0114129_10004100
460 Ga0105249_10000493
461 Ga0105249_10841228
462 Ga0105246_10377550
463 Ga0163162_10343132
464 Ga0163162_11324788
465 Ga0163163_10026689
466 Ga0163163_11194196
467 Ga0157380_10007499
468 Ga0157379_10238524
469 Ga0207697_10000470
470 Ga0207697_10005597
471 Ga0207688_10001589
472 Ga0207688_10290091
473 Ga0207680_10044735
474 Ga0207645_10444154
475 Ga0207707_10373510
476 Ga0207649_10163314
477 Ga0207681_10028913
478 Ga0207681_10630435
479 Ga0207650_10096341
480 Ga0207650_10734050
481 Ga0207659_10073667
482 Ga0207700_10008414
483 Ga0207690_10021121
484 Ga0207669_10053984
485 Ga0207691_10103210
486 Ga0207691_10112312
487 Ga0207711_10373679
488 Ga0207689_10044036
489 Ga0207661_10002905
490 Ga0207661_10124022
491 Ga0207679_10008468
492 Ga0207679_10116049
493 Ga0207679_11077964
494 Ga0207651_10092187
495 Ga0207712_10007060
496 Ga0207639_10872608
497 Ga0207678_10085851
498 Ga0207678_10433417
499 Ga0207641_10906956
500 Ga0207676_10595632
501 Ga0207676_11321333
502 Ga0207674_10051252
503 Ga0207674_10796133
504 Ga0207675_100031454
505 Ga0207683_10415209
506 Ga0207698_10276719
507 Ga0207698_10893197
508 Ga0209974_10200928
509 Ga0207428_10000629
510 Ga0207428_10063858
511 Ga0268266_10570620
512 Ga0268265_10062695
513 Ga0307409_100171339
514 Ga0373929_0160969
515 Ga0373943_0191929
516 Ga0373946_0251680
517 Ga0373931_0269331
518 Ga0373933_0082182
519 Ga0373947_0314043
520 Ga0373937_0005654
521 Ga0373925_0025123
522 Ga0436365_0870406
523 Ga0451802_1619323
524 Ga0451853_2814995
525 Ga0439443_006386
526 Ga0439445_0074642
527 Ga0439446_0102847
528 Ga0451577_0042171
529 Ga0451576_1420646
530 Ga0495651_0395263
531 Ga0495599_0152781
532 Ga0495646_0177704
533 Ga0495647_0078340
534 Ga0495658_0636244
535 Ga0495581_0466735
536 Ga0496101_0719677
537 Ga0496104_0045334
538 Ga0496106_0457894
539 Ga0496106_0737023
540 Ga0496108_0007522
541 Ga0496108_0107272
542 Ga0496109_0001987
543 Ga0496109_0474638
544 Ga0496110_0003305
545 Ga0496111_0058422
546 Ga0496112_0000728
547 Ga0496112_0316979
548 Ga0496113_0123692
549 Ga0496114_0207962
550 Ga0501032_0004632
551 Ga0501032_0015539
552 Ga0501032_0112669
553 Ga0501033_0003498
554 Ga0501033_0025700
555 Ga0501033_0046763
556 Ga0501033_0054307
557 Ga0501034_0032150
558 Ga0501034_0032907
559 Ga0501034_0176622
560 Ga0501034_0224356
561 Ga0501034_0233738
562 Ga0501034_0972957
563 Ga0501036_0005997
564 Ga0501036_0011717
565 Ga0501036_0070513
566 Ga0501037_0003421
567 Ga0501037_0008196
568 Ga0501037_0038691
569 Ga0501037_0081047
570 Ga0501038_0009954
571 Ga0501038_0037555
572 Ga0501038_0041875
573 Ga0501038_0107751
574 Ga0501039_0020162
575 Ga0501040_0068789
576 Ga0501040_0074378
577 Ga0501040_0328865
578 Ga0501040_0721380
579 Ga0501040_0745701
580 Ga0501041_0499203
581 Ga0501042_0002204
582 Ga0501042_0087286
583 Ga0501042_0359195
584 Ga0501043_0006775
585 Ga0501043_0013435
586 Ga0501043_0075602
587 Ga0501043_0075665
588 Ga0501043_0180924
589 Ga0501043_0275953
590 Ga0501046_0011772
591 Ga0501046_0012621
592 Ga0501046_0054429
593 Ga0501047_0000207
594 Ga0501047_0002476
595 Ga0501047_0059581
596 Ga0501047_0101119
597 Ga0501047_0303801
598 Ga0501047_0344437
599 Ga0501048_0003433
600 Ga0501048_0032894
601 Ga0501048_0044982
602 Ga0501048_0045179
603 Ga0501048_0085795
604 Ga0501048_0117172
605 Ga0501067_0013234
606 Ga0501067_0039698
607 Ga0501067_0064480
608 Ga0501067_0079470
609 Ga0501068_0002208
610 Ga0501068_0022237
611 Ga0501068_0032472
612 Ga0501068_0059048
613 Ga0501068_0084605
614 Ga0501068_0578226
615 Ga0501069_0000397
616 Ga0501069_0062032
617 Ga0501069_0067152
618 Ga0501069_0099943
619 Ga0501070_0042625
620 Ga0501070_0047286
621 Ga0501070_0152323
622 Ga0501070_0285359
623 Ga0501071_0003316
624 Ga0501071_0025727
625 Ga0501071_0126739
626 Ga0501071_0137404
627 Ga0501071_0672881
628 Ga0501072_0021555
629 Ga0501072_0036963
630 Ga0501072_0263331
631 Ga0501072_0381434
632 Ga0501073_0004762
633 Ga0501073_0007047
634 Ga0501073_0027259
635 Ga0501073_0034915
636 Ga0501073_0040946
637 Ga0501073_0214678
638 Ga0501073_0259690
639 Ga0501074_0005990
640 Ga0501074_0010512
641 Ga0501074_0056775
642 Ga0501074_0450699
643 Ga0501074_0624710
644 Ga0501075_0005395
645 Ga0501075_0369810
646 Ga0501075_0994099
647 Ga0501076_0007847
648 Ga0501076_0077669
649 Ga0501076_0390282
650 Ga0501076_1232856
651 Ga0501079_0004116
652 Ga0501079_0030167
653 Ga0501079_0100205
654 Ga0501079_0138845
655 Ga0501079_0194870
656 Ga0501079_0586917
657 Ga0501080_0006520
658 Ga0501080_0009245
659 Ga0501080_0022223
660 Ga0501080_0180992
661 Ga0501080_0238608
662 Ga0501080_0419418
663 Ga0501081_0338929
664 Ga0501081_0485732
665 Ga0501083_0011029
666 Ga0501083_0011940
667 Ga0501083_0031811
668 Ga0501083_0034433
669 Ga0501083_0035313
670 Ga0501083_0038568
671 Ga0501083_0063408
672 Ga0501035_0028191
673 Ga0501035_0053636
674 Ga0501035_0070632
675 Ga0501035_0105831
676 Ga0501035_0230750
677 Ga0501044_0002954
678 Ga0501044_0037802
679 Ga0501044_0118840
680 Ga0501044_0208289
681 Ga0501044_0707165
682 Ga0501045_0013840
683 Ga0501045_0082403
684 Ga0501045_0556794
685 nmdc:mga03n38_199873_c1
686 nmdc:mga00v17_327915_c1
687 nmdc:mga0yw44_368163_c1
688 nmdc:mga0yw44_39369_c1
689 nmdc:mga0k408_25847_c1
690 nmdc:mga0k408_41708_c1
691 nmdc:mga06z11_26118_c1
692 nmdc:mga06z11_29295_c1
693 nmdc:mga04h51_24188_c1
694 nmdc:mga06r32_144694_c1
695 nmdc:mga08y16_141729_c1
696 nmdc:mga08y16_1612_c1
697 nmdc:mga08y16_17765_c1
698 nmdc:mga08y16_233663_c1
699 nmdc:mga0n895_38378_c1
700 nmdc:mga0n895_401421_c1
701 nmdc:mga0n895_47383_c1
702 nmdc:mga0n895_686877_c1
703 nmdc:mga0rr50_69289_c1
704 nmdc:mga0rr50_842740_c1
705 nmdc:mga0a205_10858_c1
706 nmdc:mga0a205_1117212_c1
707 nmdc:mga0a205_348023_c1
708 nmdc:mga0a205_41377_c1
709 Ga0495601_0259757
710 Ga0500588_0024432
711 Ga0501084_0005232
712 Ga0501084_0009411
713 Ga0501084_0023622
714 Ga0501084_0141861
715 Ga0501084_0191229
716 Ga0501084_0565875
717 Ga0501082_0004238
718 Ga0501082_0012570
719 Ga0501082_0045673
720 Ga0501082_0154554
721 Ga0501082_0369966
722 Ga0501082_0866117

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

40

216

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.9384 1 180
6q3t-assembly1.cif.gz_A structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device 0.9367 3 180
6f2f-assembly1.cif.gz_A crystal structure of protease 1 from pyrococcus horikoshii co-cystallized in presence of 10 mm tb-xo4 and ammonium sulfate. 0.9367 3 180
7r66-assembly1.cif.gz_A structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution 0.9355 3 180
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.9277 1 180
ID Description Score Start End Superfamily
af_K7LRD9_234_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9376 127 181 3.40.50.720
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9367 3 180 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9205 3 180 3.40.50.880
2vrnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9193 2 177 3.40.50.880
af_Q869N4_1_194_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9108 1 181 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A257TJU7-F1-model_v4 DJ-1/PfpI domain-containing protein 0.9888 92 181
AF-A0A359M5Y6-F1-model_v4 Protease 0.9796 89 181 GO:0006508
GO:0008233
AF-A0A2E7PV89-F1-model_v4 DJ-1/PfpI domain-containing protein 0.9697 92 182
AF-A0A2V9QNU8-F1-model_v4 Protease 0.9675 89 177 GO:0006508
GO:0008233
AF-A0A358N2P1-F1-model_v4 Protease 0.9658 88 177 GO:0006508
GO:0008233

Map