F422103

General Info

Members Datasets Scaffolds Average Seq Length
361 198 722 363

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100069795|Ga0070683_1000697952
Length 393
Sequence MMMRTRAGLLAIIIVPACSKPPAQQAPPVPVQIAAVSRVSAPLTIEANGVVEPLHTVSIAAQVGGSLEAVEFNEGDDVQVGQVLFKIDPRPFEAALRQAEATLARDTSQAQSAAREAERYKALVEKDYVTRSQADQVAAAXXXTQATVQSDRAAVDNARVNLGYTTIRSPIAGRTGRLLVKAGNLVRPNGDPLVVINQLRPILVRFPVLQKDFPAIQRRNLRGPIPVRVVTADSGQVTEAGALAFLDNAVDSLTGSVTAKARFQNQSNALWPGEYVRVSVELQVEPNVVAVPTRAVLAGQQGNYVFVVGNDKRATVRQVSVGRAVGDLTTVDKGLQAGEQVVVDGQSRLTPNARVDAKPAPVNAGRTTQAGGTDSVSGTTTGGSVAGVRAGTS

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 1.39
Rhizosphere 98.34
Stem 0
Stem Tuber 0
Unclassified 6.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100069795 3300005329 Bacteria 3277
2 Ga0058862_12738725 3300004803 Bacteria 2602
3 Ga0065707_10011471 3300005295 Bacteria 2729
4 Ga0070676_10007915 3300005328 Bacteria 5713
5 Ga0070683_100001829 3300005329 Bacteria 16588
6 Ga0070683_100002086 3300005329 Bacteria 15785
7 Ga0070683_100003461 3300005329 Bacteria 12827
8 Ga0070683_100004704 3300005329 Bacteria 11282
9 Ga0070683_100006445 3300005329 Bacteria 9846
10 Ga0070683_100010381 3300005329 Bacteria 8009
11 Ga0070683_100013129 3300005329 Bacteria 7213
12 Ga0070683_100020970 3300005329 Bacteria 5826
13 Ga0070683_100048751 3300005329 Bacteria 3916
14 Ga0070683_100289860 3300005329 Unclassified 1557
15 Ga0070690_100044614 3300005330 Bacteria 2815
16 Ga0070670_100037296 3300005331 Bacteria 4182
17 Ga0070670_100299729 3300005331 Bacteria 1406
18 Ga0068869_100005517 3300005334 Bacteria 7962
19 Ga0068869_100015067 3300005334 Bacteria 5176
20 Ga0070680_100004437 3300005336 Bacteria 10566
21 Ga0070680_100019749 3300005336 Bacteria 5343
22 Ga0070680_100025413 3300005336 Bacteria 4734
23 Ga0070680_100031412 3300005336 Bacteria 4270
24 Ga0070680_100195499 3300005336 Bacteria 1705
25 Ga0070680_100266511 3300005336 Unclassified 1450
26 Ga0070682_100003457 3300005337 Bacteria 8738
27 Ga0070660_100036657 3300005339 Bacteria 3715
28 Ga0070660_100280217 3300005339 Bacteria 1364
29 Ga0070689_100026445 3300005340 Bacteria 4369
30 Ga0070689_100059800 3300005340 Bacteria 2961
31 Ga0070691_10054754 3300005341 Bacteria 1910
32 Ga0070687_100019470 3300005343 Bacteria 3158
33 Ga0070661_100003523 3300005344 Bacteria 10782
34 Ga0070661_100014882 3300005344 Bacteria 5488
35 Ga0070661_100047130 3300005344 Bacteria 3154
36 Ga0070661_100163826 3300005344 Unclassified 1685
37 Ga0070692_10007987 3300005345 Bacteria 4695
38 Ga0070692_10037874 3300005345 Bacteria 2454
39 Ga0070668_100010977 3300005347 Bacteria 6741
40 Ga0070675_100000850 3300005354 Bacteria 21684
41 Ga0070673_100153080 3300005364 Bacteria 1954
42 Ga0070688_100013665 3300005365 Bacteria 4585
43 Ga0070659_100005384 3300005366 Bacteria 9187
44 Ga0070659_100093543 3300005366 Bacteria 2412
45 Ga0070667_100027593 3300005367 Bacteria 4725
46 Ga0070709_10001256 3300005434 Bacteria 13874
47 Ga0070713_100028778 3300005436 Bacteria 4391
48 Ga0070701_10103733 3300005438 Unclassified 1579
49 Ga0070711_100004142 3300005439 Bacteria 8524
50 Ga0070705_100018685 3300005440 Bacteria 3638
51 Ga0070705_100207797 3300005440 Bacteria 1347
52 Ga0070700_100014402 3300005441 Bacteria 4465
53 Ga0070694_100096587 3300005444 Bacteria 2083
54 Ga0070708_100000004 3300005445 Bacteria 168041
55 Ga0070708_100015107 3300005445 Bacteria 6368
56 Ga0070663_100051564 3300005455 Bacteria 2932
57 Ga0070662_100015431 3300005457 Bacteria 5117
58 Ga0070662_100087139 3300005457 Bacteria 2337
59 Ga0070681_10002474 3300005458 Bacteria 16919
60 Ga0070681_10007837 3300005458 Bacteria 10444
61 Ga0070681_10014843 3300005458 Bacteria 7745
62 Ga0068867_100049183 3300005459 Bacteria 3103
63 Ga0068867_100080890 3300005459 Bacteria 2448
64 Ga0070685_10044330 3300005466 Bacteria 2546
65 Ga0070707_100005803 3300005468 Bacteria 11516
66 Ga0070707_100055742 3300005468 Bacteria 3790
67 Ga0070698_100088122 3300005471 Bacteria 3089
68 Ga0070698_100095106 3300005471 Bacteria 2958
69 Ga0070699_100016570 3300005518 Bacteria 6326
70 Ga0070699_100032648 3300005518 Bacteria 4496
71 Ga0070699_100080612 3300005518 Bacteria 2837
72 Ga0070679_100000411 3300005530 Bacteria 36449
73 Ga0070679_100000592 3300005530 Bacteria 30736
74 Ga0070679_100002128 3300005530 Bacteria 17844
75 Ga0070679_100016713 3300005530 Bacteria 7089
76 Ga0070679_100018840 3300005530 Bacteria 6701
77 Ga0070684_100009880 3300005535 Bacteria 7539
78 Ga0070684_100018239 3300005535 Bacteria 5778
79 Ga0070684_100029993 3300005535 Bacteria 4616
80 Ga0070684_100041411 3300005535 Bacteria 3971
81 Ga0070684_100048341 3300005535 Bacteria 3690
82 Ga0070684_100058500 3300005535 Bacteria 3369
83 Ga0070684_100069805 3300005535 Unclassified 3090
84 Ga0070672_100005525 3300005543 Bacteria 8390
85 Ga0070686_100232692 3300005544 Bacteria 1338
86 Ga0070696_100003420 3300005546 Bacteria 10581
87 Ga0070696_100011555 3300005546 Bacteria 5915
88 Ga0070693_100003237 3300005547 Bacteria 7562
89 Ga0070665_100018190 3300005548 Bacteria 7048
90 Ga0070704_100000214 3300005549 Bacteria 24167
91 Ga0068855_100013839 3300005563 Bacteria 9728
92 Ga0068855_100060465 3300005563 Bacteria 4430
93 Ga0070664_100003915 3300005564 Bacteria 12014
94 Ga0070664_100009880 3300005564 Bacteria 7733
95 Ga0070664_100083774 3300005564 Bacteria 2751
96 Ga0070664_100202331 3300005564 Bacteria 1772
97 Ga0068857_100007624 3300005577 Bacteria 9321
98 Ga0068857_100089674 3300005577 Bacteria 2751
99 Ga0068854_100059477 3300005578 Bacteria 2761
100 Ga0068856_100004857 3300005614 Bacteria 13313
101 Ga0068856_100049926 3300005614 Bacteria 4124
102 Ga0068856_100050835 3300005614 Bacteria 4087
103 Ga0068856_100092315 3300005614 Bacteria 3012
104 Ga0070702_100000423 3300005615 Bacteria 15017
105 Ga0068852_100015627 3300005616 Bacteria 5896
106 Ga0068852_100032018 3300005616 Unclassified 4349
107 Ga0068852_100041137 3300005616 Bacteria 3904
108 Ga0068852_100103622 3300005616 Bacteria 2574
109 Ga0068859_100007554 3300005617 Bacteria 11040
110 Ga0068859_100148904 3300005617 Bacteria 2416
111 Ga0068859_100169018 3300005617 Bacteria 2267
112 Ga0068864_100005755 3300005618 Bacteria 10171
113 Ga0068864_100026510 3300005618 Bacteria 4887
114 Ga0068851_10030401 3300005834 Bacteria 2678
115 Ga0068863_100017273 3300005841 Bacteria 6922
116 Ga0068863_100040876 3300005841 Bacteria 4409
117 Ga0068858_100041383 3300005842 Bacteria 4272
118 Ga0068858_100049430 3300005842 Bacteria 3895
119 Ga0068858_100127116 3300005842 Bacteria 2388
120 Ga0068860_100017205 3300005843 Bacteria 7048
121 Ga0068862_100035932 3300005844 Bacteria 4198
122 Ga0070716_100058042 3300006173 Bacteria 2226
123 Ga0070712_100103644 3300006175 Bacteria 2110
124 Ga0068871_100002925 3300006358 Bacteria 11720
125 Ga0075428_100015807 3300006844 Bacteria 8358
126 Ga0075428_100049512 3300006844 Bacteria 4609
127 Ga0075428_100182691 3300006844 Bacteria 2270
128 Ga0075431_100015159 3300006847 Bacteria 7808
129 Ga0075431_100029874 3300006847 Bacteria 5611
130 Ga0075431_100162548 3300006847 Bacteria 2296
131 Ga0075433_10017998 3300006852 Bacteria 5864
132 Ga0075433_10088841 3300006852 Bacteria 2731
133 Ga0075434_100003834 3300006871 Bacteria 13451
134 Ga0075434_100009403 3300006871 Bacteria 9109
135 Ga0068865_100009653 3300006881 Bacteria 5985
136 Ga0075436_100000153 3300006914 Bacteria 42824
137 Ga0075436_100019387 3300006914 Bacteria 4661
138 Ga0075436_100040528 3300006914 Bacteria 3214
139 Ga0097620_100007554 3300006931 Bacteria 11040
140 Ga0097620_100148908 3300006931 Bacteria 2416
141 Ga0097620_100169016 3300006931 Bacteria 2267
142 Ga0075435_100005954 3300007076 Bacteria 8578
143 Ga0111539_10180439 3300009094 Bacteria 2466
144 Ga0105245_10040176 3300009098 Bacteria 4167
145 Ga0105245_10147655 3300009098 Bacteria 2220
146 Ga0114129_10051942 3300009147 Bacteria 5754
147 Ga0114129_10159191 3300009147 Bacteria 3086
148 Ga0114129_10331036 3300009147 Unclassified 2022
149 Ga0114129_10518004 3300009147 Bacteria 1555
150 Ga0114129_10741997 3300009147 Unclassified 1258
151 Ga0105241_10005691 3300009174 Bacteria 9198
152 Ga0105242_10022932 3300009176 Bacteria 4917
153 Ga0105242_10366494 3300009176 Unclassified 1335
154 Ga0105248_10007205 3300009177 Bacteria 12200
155 Ga0105248_10025591 3300009177 Bacteria 6562
156 Ga0105248_10098391 3300009177 Bacteria 3296
157 Ga0105248_10314268 3300009177 Bacteria 1764
158 Ga0105238_10031169 3300009551 Bacteria 5428
159 Ga0105249_10168016 3300009553 Bacteria 2125
160 Ga0105249_10210501 3300009553 Bacteria 1908
161 Ga0105246_10002213 3300011119 Bacteria 11738
162 Ga0157373_10043612 3300013100 Bacteria 3204
163 Ga0157371_10022957 3300013102 Bacteria 4563
164 Ga0157371_10068491 3300013102 Bacteria 2512
165 Ga0157370_10001121 3300013104 Bacteria 33460
166 Ga0157370_10036174 3300013104 Bacteria 4793
167 Ga0157369_10122977 3300013105 Unclassified 2753
168 Ga0157374_10005301 3300013296 Bacteria 10826
169 Ga0163162_10005152 3300013306 Bacteria 12597
170 Ga0157372_10001804 3300013307 Bacteria 23258
171 Ga0157372_10004307 3300013307 Bacteria 15214
172 Ga0157372_10004789 3300013307 Bacteria 14376
173 Ga0157372_10031462 3300013307 Bacteria 5810
174 Ga0157375_10014947 3300013308 Bacteria 6940
175 Ga0163163_10015007 3300014325 Bacteria 7142
176 Ga0157380_10039503 3300014326 Unclassified 3670
177 Ga0157377_10000815 3300014745 Bacteria 12909
178 Ga0157379_10012560 3300014968 Bacteria 7398
179 Ga0157376_10004687 3300014969 Bacteria 9532
180 Ga0207697_10005594 3300025315 Bacteria 5817
181 Ga0207656_10023976 3300025321 Bacteria 2463
182 Ga0207692_10098167 3300025898 Unclassified 1602
183 Ga0207645_10003322 3300025907 Bacteria 12271
184 Ga0207654_10005143 3300025911 Bacteria 6600
185 Ga0207707_10000446 3300025912 Bacteria 42961
186 Ga0207707_10005934 3300025912 Bacteria 10688
187 Ga0207695_10007797 3300025913 Bacteria 13553
188 Ga0207693_10059080 3300025915 Bacteria 3004
189 Ga0207693_10069454 3300025915 Bacteria 2757
190 Ga0207660_10008643 3300025917 Bacteria 6584
191 Ga0207660_10008818 3300025917 Bacteria 6519
192 Ga0207660_10013718 3300025917 Bacteria 5316
193 Ga0207662_10000492 3300025918 Bacteria 17643
194 Ga0207657_10021524 3300025919 Bacteria 6064
195 Ga0207657_10038040 3300025919 Bacteria 4289
196 Ga0207649_10005300 3300025920 Bacteria 6978
197 Ga0207649_10020500 3300025920 Bacteria 3793
198 Ga0207649_10022740 3300025920 Bacteria 3622
199 Ga0207652_10008737 3300025921 Bacteria 8153
200 Ga0207652_10025536 3300025921 Bacteria 4913
201 Ga0207652_10026572 3300025921 Bacteria 4824
202 Ga0207652_10102412 3300025921 Bacteria 2531
203 Ga0207652_10119565 3300025921 Bacteria 2343
204 Ga0207646_10048122 3300025922 Bacteria 3823
205 Ga0207681_10188861 3300025923 Bacteria 1575
206 Ga0207694_10017454 3300025924 Bacteria 5425
207 Ga0207650_10007264 3300025925 Bacteria 7546
208 Ga0207650_10247999 3300025925 Bacteria 1441
209 Ga0207659_10001484 3300025926 Bacteria 13981
210 Ga0207687_10042777 3300025927 Bacteria 3119
211 Ga0207700_10028947 3300025928 Bacteria 3904
212 Ga0207644_10019905 3300025931 Bacteria 4558
213 Ga0207644_10189671 3300025931 Bacteria 1616
214 Ga0207690_10007277 3300025932 Bacteria 6576
215 Ga0207690_10028381 3300025932 Bacteria 3547
216 Ga0207706_10009640 3300025933 Bacteria 8864
217 Ga0207706_10018161 3300025933 Bacteria 6327
218 Ga0207706_10092269 3300025933 Bacteria 2663
219 Ga0207686_10099622 3300025934 Bacteria 1937
220 Ga0207670_10060628 3300025936 Bacteria 2578
221 Ga0207670_10107669 3300025936 Bacteria 2002
222 Ga0207665_10016274 3300025939 Bacteria 4882
223 Ga0207691_10006336 3300025940 Bacteria 11428
224 Ga0207691_10113868 3300025940 Bacteria 2403
225 Ga0207711_10003617 3300025941 Bacteria 13373
226 Ga0207711_10258049 3300025941 Bacteria 1601
227 Ga0207689_10005235 3300025942 Bacteria 11631
228 Ga0207689_10009798 3300025942 Bacteria 8257
229 Ga0207661_10000514 3300025944 Bacteria 24999
230 Ga0207661_10000639 3300025944 Bacteria 22548
231 Ga0207661_10016095 3300025944 Bacteria 5512
232 Ga0207661_10019035 3300025944 Bacteria 5110
233 Ga0207661_10024716 3300025944 Bacteria 4556
234 Ga0207661_10036967 3300025944 Bacteria 3815
235 Ga0207661_10055825 3300025944 Bacteria 3169
236 Ga0207661_10087061 3300025944 Bacteria 2593
237 Ga0207661_10111707 3300025944 Bacteria 2312
238 Ga0207661_10133885 3300025944 Bacteria 2127
239 Ga0207679_10000632 3300025945 Bacteria 23445
240 Ga0207679_10003354 3300025945 Bacteria 9885
241 Ga0207679_10080200 3300025945 Bacteria 2491
242 Ga0207679_10116601 3300025945 Bacteria 2118
243 Ga0207667_10174247 3300025949 Bacteria 2210
244 Ga0207651_10013909 3300025960 Bacteria 4627
245 Ga0207668_10016574 3300025972 Bacteria 4601
246 Ga0207640_10304816 3300025981 Unclassified 1261
247 Ga0207703_10024512 3300026035 Bacteria 4745
248 Ga0207703_10075008 3300026035 Bacteria 2802
249 Ga0207708_10012911 3300026075 Bacteria 6228
250 Ga0207708_10062846 3300026075 Bacteria 2836
251 Ga0207702_10011583 3300026078 Bacteria 7349
252 Ga0207702_10054069 3300026078 Bacteria 3401
253 Ga0207641_10004971 3300026088 Bacteria 11405
254 Ga0207641_10061893 3300026088 Bacteria 3192
255 Ga0207648_10078173 3300026089 Bacteria 2886
256 Ga0207676_10001581 3300026095 Bacteria 16744
257 Ga0207676_10143565 3300026095 Unclassified 2047
258 Ga0207674_10000351 3300026116 Bacteria 59444
259 Ga0207674_10001108 3300026116 Bacteria 35009
260 Ga0207674_10014838 3300026116 Bacteria 8593
261 Ga0207674_10058024 3300026116 Bacteria 3923
262 Ga0207674_10140617 3300026116 Bacteria 2373
263 Ga0207675_100005524 3300026118 Bacteria 12093
264 Ga0207698_10015670 3300026142 Bacteria 5085
265 Ga0207698_10070137 3300026142 Bacteria 2775
266 Ga0268264_10018120 3300028381 Bacteria 5758
267 Ga0307408_100008381 3300031548 Bacteria 6827
268 Ga0307413_10022289 3300031824 Bacteria 3411
269 Ga0307410_10012646 3300031852 Bacteria 4890
270 Ga0307406_10004370 3300031901 Bacteria 7689
271 Ga0307407_10061801 3300031903 Bacteria 2191
272 Ga0373934_0003096 3300035086 Bacteria 6074
273 Ga0373923_0018204 3300035111 Bacteria 2700
274 Ga0373953_0057249 3300035117 Bacteria 1587
275 Ga0373943_0011962 3300035170 Bacteria 3907
276 Ga0373955_0000524 3300035172 Bacteria 16321
277 Ga0373955_0040428 3300035172 Bacteria 2494
278 Ga0373924_0129342 3300035410 Bacteria 1098
279 Ga0373931_0007672 3300035691 Bacteria 5091
280 Ga0373935_0052524 3300035692 Bacteria 2591
281 Ga0373927_0023276 3300035695 Unclassified 4057
282 Ga0373927_0048217 3300035695 Bacteria 2755
283 Ga0373933_0012451 3300035724 Bacteria 4696
284 Ga0373933_0015510 3300035724 Bacteria 4249
285 Ga0373937_0000184 3300036401 Bacteria 61363
286 Ga0373937_0143126 3300036401 Bacteria 2237
287 Ga0373925_0054226 3300037068 Bacteria 2998
288 Ga0373925_0107513 3300037068 Unclassified 2151
289 Ga0373925_0204600 3300037068 Unclassified 1571
290 Ga0395905_0066428 3300037471 Bacteria 3378
291 Ga0451577_0146021 3300042876 Bacteria 2127
292 Ga0453683_0001790 3300044673 Bacteria 17778
293 Ga0466963_0023599 3300044694 Bacteria 3909
294 Ga0466963_0038170 3300044694 Bacteria 3140
295 Ga0451576_0011221 3300045051 Bacteria 10207
296 Ga0451576_0064223 3300045051 Bacteria 3824
297 Ga0495592_0092865 3300046454 Bacteria 2162
298 Ga0495629_0059362 3300046459 Bacteria 2674
299 Ga0495629_0062374 3300046459 Bacteria 2604
300 Ga0495651_0274513 3300046462 Bacteria 1141
301 Ga0495582_0002708 3300046473 Bacteria 9889
302 Ga0495594_0004339 3300046499 Bacteria 7297
303 Ga0495594_0005226 3300046499 Bacteria 6674
304 Ga0495594_0046708 3300046499 Bacteria 2378
305 Ga0495608_0027955 3300046511 Unclassified 3834
306 Ga0495618_0014529 3300046514 Bacteria 4800
307 Ga0495628_0148520 3300046516 Bacteria 1786
308 Ga0495630_0005983 3300046517 Bacteria 8601
309 Ga0495630_0246454 3300046517 Unclassified 1365
310 Ga0495666_0036548 3300046526 Bacteria 2392
311 Ga0495666_0063601 3300046526 Bacteria 1761
312 Ga0495652_0005542 3300046529 Bacteria 11871
313 Ga0495652_0026055 3300046529 Bacteria 5168
314 Ga0495665_0006061 3300046531 Bacteria 6522
315 Ga0495665_0021754 3300046531 Bacteria 3449
316 Ga0495640_0063538 3300046533 Bacteria 2500
317 Ga0495586_0005972 3300046535 Bacteria 6515
318 Ga0495587_0004323 3300046536 Bacteria 9377
319 Ga0495587_0007522 3300046536 Bacteria 7054
320 Ga0495645_0000075 3300046543 Bacteria 68269
321 Ga0495645_0047125 3300046543 Bacteria 3141
322 Ga0495667_0019162 3300046559 Bacteria 4617
323 Ga0495667_0046253 3300046559 Bacteria 2878
324 Ga0495599_0016221 3300046678 Bacteria 4623
325 Ga0495599_0023348 3300046678 Bacteria 3866
326 Ga0495623_0007324 3300046679 Bacteria 7159
327 Ga0495623_0086149 3300046679 Archaea 1936
328 Ga0495646_0021314 3300046680 Unclassified 4097
329 Ga0495658_0004436 3300046683 Bacteria 6904
330 Ga0495674_0085627 3300047319 Bacteria 2699
331 Ga0495674_0284822 3300047319 Unclassified 1353
332 Ga0495675_0003225 3300047444 Bacteria 9812
333 Ga0495675_0173875 3300047444 Unclassified 1321
334 Ga0495684_0026438 3300047471 Unclassified 4461
335 Ga0495684_0040004 3300047471 Bacteria 3595
336 Ga0495684_0057532 3300047471 Bacteria 2963
337 Ga0495602_0044670 3300048088 Bacteria 4016
338 Ga0496109_0044888 3300048912 Bacteria 4010
339 Ga0496109_0113329 3300048912 Bacteria 2522
340 Ga0496112_0000627 3300048915 Bacteria 24523
341 Ga0496113_0046081 3300048916 Bacteria 3236
342 Ga0496113_0060163 3300048916 Bacteria 2863
343 Ga0501070_0323384 3300049586 Bacteria 1254
344 Ga0501259_000017 3300049688 Bacteria 23940
345 nmdc:mga05p37_258409_c1 3300050507 Bacteria 2086
346 nmdc:mga05p37_52553_c1 3300050507 Bacteria 5010
347 nmdc:mga05p37_597719_c1 3300050507 Unclassified 1246
348 nmdc:mga09592_114217_c1 3300050508 Bacteria 2318
349 nmdc:mga09592_48713_c1 3300050508 Bacteria 3572
350 nmdc:mga06r32_117880_c1 3300050510 Bacteria 2617
351 nmdc:mga06r32_49764_c1 3300050510 Bacteria 4009
352 nmdc:mga06r32_67200_c1 3300050510 Bacteria 3460
353 nmdc:mga08y16_196585_c1 3300050511 Bacteria 2090
354 nmdc:mga0n895_181484_c1 3300050512 Bacteria 2136
355 nmdc:mga0n895_25252_c1 3300050512 Bacteria 5612
356 nmdc:mga0n895_554166_c1 3300050512 Bacteria 1155
357 nmdc:mga0rr50_166812_c1 3300050513 Bacteria 1791
358 nmdc:mga08x19_219_c1 3300050514 Bacteria 43753
359 nmdc:mga0a205_111389_c1 3300050515 Bacteria 2636
360 nmdc:mga0a205_12818_c1 3300050515 Bacteria 7775
361 Ga0500638_000022 3300053162 Bacteria 67797
362 Ga0070683_100069795
363 Ga0058862_12738725
364 Ga0065707_10011471
365 Ga0070676_10007915
366 Ga0070683_100001829
367 Ga0070683_100002086
368 Ga0070683_100003461
369 Ga0070683_100004704
370 Ga0070683_100006445
371 Ga0070683_100010381
372 Ga0070683_100013129
373 Ga0070683_100020970
374 Ga0070683_100048751
375 Ga0070683_100289860
376 Ga0070690_100044614
377 Ga0070670_100037296
378 Ga0070670_100299729
379 Ga0068869_100005517
380 Ga0068869_100015067
381 Ga0070680_100004437
382 Ga0070680_100019749
383 Ga0070680_100025413
384 Ga0070680_100031412
385 Ga0070680_100195499
386 Ga0070680_100266511
387 Ga0070682_100003457
388 Ga0070660_100036657
389 Ga0070660_100280217
390 Ga0070689_100026445
391 Ga0070689_100059800
392 Ga0070691_10054754
393 Ga0070687_100019470
394 Ga0070661_100003523
395 Ga0070661_100014882
396 Ga0070661_100047130
397 Ga0070661_100163826
398 Ga0070692_10007987
399 Ga0070692_10037874
400 Ga0070668_100010977
401 Ga0070675_100000850
402 Ga0070673_100153080
403 Ga0070688_100013665
404 Ga0070659_100005384
405 Ga0070659_100093543
406 Ga0070667_100027593
407 Ga0070709_10001256
408 Ga0070713_100028778
409 Ga0070701_10103733
410 Ga0070711_100004142
411 Ga0070705_100018685
412 Ga0070705_100207797
413 Ga0070700_100014402
414 Ga0070694_100096587
415 Ga0070708_100000004
416 Ga0070708_100015107
417 Ga0070663_100051564
418 Ga0070662_100015431
419 Ga0070662_100087139
420 Ga0070681_10002474
421 Ga0070681_10007837
422 Ga0070681_10014843
423 Ga0068867_100049183
424 Ga0068867_100080890
425 Ga0070685_10044330
426 Ga0070707_100005803
427 Ga0070707_100055742
428 Ga0070698_100088122
429 Ga0070698_100095106
430 Ga0070699_100016570
431 Ga0070699_100032648
432 Ga0070699_100080612
433 Ga0070679_100000411
434 Ga0070679_100000592
435 Ga0070679_100002128
436 Ga0070679_100016713
437 Ga0070679_100018840
438 Ga0070684_100009880
439 Ga0070684_100018239
440 Ga0070684_100029993
441 Ga0070684_100041411
442 Ga0070684_100048341
443 Ga0070684_100058500
444 Ga0070684_100069805
445 Ga0070672_100005525
446 Ga0070686_100232692
447 Ga0070696_100003420
448 Ga0070696_100011555
449 Ga0070693_100003237
450 Ga0070665_100018190
451 Ga0070704_100000214
452 Ga0068855_100013839
453 Ga0068855_100060465
454 Ga0070664_100003915
455 Ga0070664_100009880
456 Ga0070664_100083774
457 Ga0070664_100202331
458 Ga0068857_100007624
459 Ga0068857_100089674
460 Ga0068854_100059477
461 Ga0068856_100004857
462 Ga0068856_100049926
463 Ga0068856_100050835
464 Ga0068856_100092315
465 Ga0070702_100000423
466 Ga0068852_100015627
467 Ga0068852_100032018
468 Ga0068852_100041137
469 Ga0068852_100103622
470 Ga0068859_100007554
471 Ga0068859_100148904
472 Ga0068859_100169018
473 Ga0068864_100005755
474 Ga0068864_100026510
475 Ga0068851_10030401
476 Ga0068863_100017273
477 Ga0068863_100040876
478 Ga0068858_100041383
479 Ga0068858_100049430
480 Ga0068858_100127116
481 Ga0068860_100017205
482 Ga0068862_100035932
483 Ga0070716_100058042
484 Ga0070712_100103644
485 Ga0068871_100002925
486 Ga0075428_100015807
487 Ga0075428_100049512
488 Ga0075428_100182691
489 Ga0075431_100015159
490 Ga0075431_100029874
491 Ga0075431_100162548
492 Ga0075433_10017998
493 Ga0075433_10088841
494 Ga0075434_100003834
495 Ga0075434_100009403
496 Ga0068865_100009653
497 Ga0075436_100000153
498 Ga0075436_100019387
499 Ga0075436_100040528
500 Ga0097620_100007554
501 Ga0097620_100148908
502 Ga0097620_100169016
503 Ga0075435_100005954
504 Ga0111539_10180439
505 Ga0105245_10040176
506 Ga0105245_10147655
507 Ga0114129_10051942
508 Ga0114129_10159191
509 Ga0114129_10331036
510 Ga0114129_10518004
511 Ga0114129_10741997
512 Ga0105241_10005691
513 Ga0105242_10022932
514 Ga0105242_10366494
515 Ga0105248_10007205
516 Ga0105248_10025591
517 Ga0105248_10098391
518 Ga0105248_10314268
519 Ga0105238_10031169
520 Ga0105249_10168016
521 Ga0105249_10210501
522 Ga0105246_10002213
523 Ga0157373_10043612
524 Ga0157371_10022957
525 Ga0157371_10068491
526 Ga0157370_10001121
527 Ga0157370_10036174
528 Ga0157369_10122977
529 Ga0157374_10005301
530 Ga0163162_10005152
531 Ga0157372_10001804
532 Ga0157372_10004307
533 Ga0157372_10004789
534 Ga0157372_10031462
535 Ga0157375_10014947
536 Ga0163163_10015007
537 Ga0157380_10039503
538 Ga0157377_10000815
539 Ga0157379_10012560
540 Ga0157376_10004687
541 Ga0207697_10005594
542 Ga0207656_10023976
543 Ga0207692_10098167
544 Ga0207645_10003322
545 Ga0207654_10005143
546 Ga0207707_10000446
547 Ga0207707_10005934
548 Ga0207695_10007797
549 Ga0207693_10059080
550 Ga0207693_10069454
551 Ga0207660_10008643
552 Ga0207660_10008818
553 Ga0207660_10013718
554 Ga0207662_10000492
555 Ga0207657_10021524
556 Ga0207657_10038040
557 Ga0207649_10005300
558 Ga0207649_10020500
559 Ga0207649_10022740
560 Ga0207652_10008737
561 Ga0207652_10025536
562 Ga0207652_10026572
563 Ga0207652_10102412
564 Ga0207652_10119565
565 Ga0207646_10048122
566 Ga0207681_10188861
567 Ga0207694_10017454
568 Ga0207650_10007264
569 Ga0207650_10247999
570 Ga0207659_10001484
571 Ga0207687_10042777
572 Ga0207700_10028947
573 Ga0207644_10019905
574 Ga0207644_10189671
575 Ga0207690_10007277
576 Ga0207690_10028381
577 Ga0207706_10009640
578 Ga0207706_10018161
579 Ga0207706_10092269
580 Ga0207686_10099622
581 Ga0207670_10060628
582 Ga0207670_10107669
583 Ga0207665_10016274
584 Ga0207691_10006336
585 Ga0207691_10113868
586 Ga0207711_10003617
587 Ga0207711_10258049
588 Ga0207689_10005235
589 Ga0207689_10009798
590 Ga0207661_10000514
591 Ga0207661_10000639
592 Ga0207661_10016095
593 Ga0207661_10019035
594 Ga0207661_10024716
595 Ga0207661_10036967
596 Ga0207661_10055825
597 Ga0207661_10087061
598 Ga0207661_10111707
599 Ga0207661_10133885
600 Ga0207679_10000632
601 Ga0207679_10003354
602 Ga0207679_10080200
603 Ga0207679_10116601
604 Ga0207667_10174247
605 Ga0207651_10013909
606 Ga0207668_10016574
607 Ga0207640_10304816
608 Ga0207703_10024512
609 Ga0207703_10075008
610 Ga0207708_10012911
611 Ga0207708_10062846
612 Ga0207702_10011583
613 Ga0207702_10054069
614 Ga0207641_10004971
615 Ga0207641_10061893
616 Ga0207648_10078173
617 Ga0207676_10001581
618 Ga0207676_10143565
619 Ga0207674_10000351
620 Ga0207674_10001108
621 Ga0207674_10014838
622 Ga0207674_10058024
623 Ga0207674_10140617
624 Ga0207675_100005524
625 Ga0207698_10015670
626 Ga0207698_10070137
627 Ga0268264_10018120
628 Ga0307408_100008381
629 Ga0307413_10022289
630 Ga0307410_10012646
631 Ga0307406_10004370
632 Ga0307407_10061801
633 Ga0373934_0003096
634 Ga0373923_0018204
635 Ga0373953_0057249
636 Ga0373943_0011962
637 Ga0373955_0000524
638 Ga0373955_0040428
639 Ga0373924_0129342
640 Ga0373931_0007672
641 Ga0373935_0052524
642 Ga0373927_0023276
643 Ga0373927_0048217
644 Ga0373933_0012451
645 Ga0373933_0015510
646 Ga0373937_0000184
647 Ga0373937_0143126
648 Ga0373925_0054226
649 Ga0373925_0107513
650 Ga0373925_0204600
651 Ga0395905_0066428
652 Ga0451577_0146021
653 Ga0453683_0001790
654 Ga0466963_0023599
655 Ga0466963_0038170
656 Ga0451576_0011221
657 Ga0451576_0064223
658 Ga0495592_0092865
659 Ga0495629_0059362
660 Ga0495629_0062374
661 Ga0495651_0274513
662 Ga0495582_0002708
663 Ga0495594_0004339
664 Ga0495594_0005226
665 Ga0495594_0046708
666 Ga0495608_0027955
667 Ga0495618_0014529
668 Ga0495628_0148520
669 Ga0495630_0005983
670 Ga0495630_0246454
671 Ga0495666_0036548
672 Ga0495666_0063601
673 Ga0495652_0005542
674 Ga0495652_0026055
675 Ga0495665_0006061
676 Ga0495665_0021754
677 Ga0495640_0063538
678 Ga0495586_0005972
679 Ga0495587_0004323
680 Ga0495587_0007522
681 Ga0495645_0000075
682 Ga0495645_0047125
683 Ga0495667_0019162
684 Ga0495667_0046253
685 Ga0495599_0016221
686 Ga0495599_0023348
687 Ga0495623_0007324
688 Ga0495623_0086149
689 Ga0495646_0021314
690 Ga0495658_0004436
691 Ga0495674_0085627
692 Ga0495674_0284822
693 Ga0495675_0003225
694 Ga0495675_0173875
695 Ga0495684_0026438
696 Ga0495684_0040004
697 Ga0495684_0057532
698 Ga0495602_0044670
699 Ga0496109_0044888
700 Ga0496109_0113329
701 Ga0496112_0000627
702 Ga0496113_0046081
703 Ga0496113_0060163
704 Ga0501070_0323384
705 Ga0501259_000017
706 nmdc:mga05p37_258409_c1
707 nmdc:mga05p37_52553_c1
708 nmdc:mga05p37_597719_c1
709 nmdc:mga09592_114217_c1
710 nmdc:mga09592_48713_c1
711 nmdc:mga06r32_117880_c1
712 nmdc:mga06r32_49764_c1
713 nmdc:mga06r32_67200_c1
714 nmdc:mga08y16_196585_c1
715 nmdc:mga0n895_181484_c1
716 nmdc:mga0n895_25252_c1
717 nmdc:mga0n895_554166_c1
718 nmdc:mga0rr50_166812_c1
719 nmdc:mga08x19_219_c1
720 nmdc:mga0a205_111389_c1
721 nmdc:mga0a205_12818_c1
722 Ga0500638_000022

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

53

104

0.97

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

40

276

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qsh-assembly1.cif.gz_C crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.8907 60 160
7wta-assembly1.cif.gz_D cryo-em structure of human pyruvate carboxylase in apo state 0.8881 60 158
4qsh-assembly1.cif.gz_D crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.886 60 160
4qsh-assembly1.cif.gz_B crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.8858 60 160
4qsh-assembly1.cif.gz_A crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.8854 60 160
ID Description Score Start End Superfamily
1vf7H02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9622 57 160 2.40.50.100
1vf7H02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9491 57 160 2.40.50.100
af_C1P645_6_169_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9489 91 125 1.20.1270.60
3ne5C01 Mainly Beta;Beta Barrel;conserved putative lor/sdh protein from methanococcus maripaludis s2 fold; 0.9385 251 307 2.40.420.20
af_Q95XA0_44_243_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9373 91 125 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A7V9PGL9-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.8925 37 320 GO:0015562
GO:1990281
AF-A0A2V7TVZ0-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.8904 35 320 GO:0015562
GO:0030313
GO:1990281
AF-A0A537RT60-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.8779 16 320 GO:0015562
GO:1990281
AF-A0A1Q3V4I0-F1-model_v4 RND efflux pump membrane fusion protein barrel-sandwich domain-containing protein 0.866 32 319 GO:0015562
GO:1990281
AF-A0A2V7Y1V1-F1-model_v4 Multidrug transporter subunit MdtA 0.8617 18 320 GO:0005886
GO:0015562
GO:1990281

Map