F422102

General Info

Members Datasets Scaffolds Average Seq Length
361 207 722 341

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100049079|Ga0070683_1000490793
Length 361
Sequence MHRQLQAIIMVLSLINKSKQIMKPIHKTITLLAIAFSGLTTAYAQDPLPSWNDGPAKQAIVEFVKATTTQGSPQFVPTEERVATFDQDGTLWVEHPMYTQVMYCLERVPTLVKAKPELANIAPFNTVLELLHGDRAAMEKLTLPDIEKVGIATMTGMPVEAFRAEAKQWLAEAKHPRWKKLYTELTYLPMQEVLKYLRANGYKTYIVTGGGQDFVRVYAEQTYGVPPEQVVGTALGTTYSYAKDGKPFLTKEPKLLLNDNDAGKPEGIHLMIGRRPHIAFGNSTGDQQMLEYTKAGDGARLSLLVLHDDAEREYAYGPAQGLPDSKVGTFTQALYDEAKKNGWIVISMKNDWKAIFTFESK

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
138 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
141 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
142 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
143 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
150 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
153 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
157 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
158 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
159 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
204 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
205 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
206 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
207 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 0
Isolates 1.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0.55
Rhizoplane 4.99
Rhizosphere 91.97
Stem 0
Stem Tuber 0
Unclassified 15.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100049079 3300005329 Plasmid 3903
2 JGI25405J52794_10001392 3300003911 Bacteria 3959
3 Ga0065714_10007499 3300005288 Bacteria 3532
4 Ga0065704_10011711 3300005289 Unclassified 2958
5 Ga0065715_10011451 3300005293 Plasmid 3282
6 Ga0065715_10099467 3300005293 Unclassified 3408
7 Ga0065715_10149785 3300005293 Bacteria 1743
8 Ga0070658_10256573 3300005327 Unclassified 1484
9 Ga0070676_10029632 3300005328 Bacteria 3114
10 Ga0070683_100041987 3300005329 Bacteria 4210
11 Ga0070690_100046684 3300005330 Bacteria 2754
12 Ga0070670_100005400 3300005331 Bacteria 10786
13 Ga0070670_100023567 3300005331 Bacteria 5298
14 Ga0070670_100063605 3300005331 Bacteria 3167
15 Ga0068869_100027382 3300005334 Bacteria 3973
16 Ga0070666_10005921 3300005335 Bacteria 7509
17 Ga0070666_10115690 3300005335 Bacteria 1857
18 Ga0068868_100189315 3300005338 Bacteria 1711
19 Ga0070660_100074362 3300005339 Bacteria 2658
20 Ga0070689_100026417 3300005340 Bacteria 4371
21 Ga0070689_100028752 3300005340 Unclassified 4204
22 Ga0070689_100086201 3300005340 Bacteria 2470
23 Ga0070668_100002576 3300005347 Bacteria 13334
24 Ga0070668_100009585 3300005347 Bacteria 7186
25 Ga0070668_100012908 3300005347 Bacteria 6222
26 Ga0070668_100242639 3300005347 Bacteria 1493
27 Ga0070669_100002307 3300005353 Bacteria 13813
28 Ga0070669_100007344 3300005353 Bacteria 7903
29 Ga0070675_100003431 3300005354 Bacteria 12009
30 Ga0070675_100014701 3300005354 Bacteria 6174
31 Ga0070675_100025758 3300005354 Bacteria 4716
32 Ga0070675_100060029 3300005354 Unclassified 3139
33 Ga0070675_100065661 3300005354 Bacteria 3001
34 Ga0070675_100102263 3300005354 Bacteria 2414
35 Ga0070675_100204159 3300005354 Bacteria 1716
36 Ga0070671_100038266 3300005355 Bacteria 3981
37 Ga0070671_100102918 3300005355 Bacteria 2396
38 Ga0070671_100240958 3300005355 Bacteria 1535
39 Ga0070671_100336194 3300005355 Bacteria 1288
40 Ga0070673_100007836 3300005364 Bacteria 7073
41 Ga0070673_100066128 3300005364 Unclassified 2886
42 Ga0070673_100166528 3300005364 Bacteria 1878
43 Ga0070688_100023484 3300005365 Bacteria 3628
44 Ga0070688_100057310 3300005365 Unclassified 2448
45 Ga0070659_100009112 3300005366 Bacteria 7279
46 Ga0070667_100035820 3300005367 Bacteria 4158
47 Ga0070709_10180954 3300005434 Bacteria 1480
48 Ga0070714_100084789 3300005435 Unclassified 2765
49 Ga0070714_100118617 3300005435 Bacteria 2351
50 Ga0070713_100026274 3300005436 Bacteria 4569
51 Ga0070713_100071644 3300005436 Unclassified 2929
52 Ga0070710_10017658 3300005437 Plasmid 3656
53 Ga0070711_100038196 3300005439 Bacteria 3226
54 Ga0070711_100120081 3300005439 Bacteria 1942
55 Ga0070700_100025267 3300005441 Bacteria 3497
56 Ga0070663_100040527 3300005455 Unclassified 3261
57 Ga0070678_100003855 3300005456 Bacteria 8423
58 Ga0070662_100021575 3300005457 Bacteria 4399
59 Ga0070662_100164453 3300005457 Bacteria 1738
60 Ga0070681_10085561 3300005458 Unclassified 3105
61 Ga0068867_100004281 3300005459 Bacteria 10043
62 Ga0068867_100254312 3300005459 Bacteria 1430
63 Ga0070685_10017530 3300005466 Unclassified 3835
64 Ga0070685_10229510 3300005466 Bacteria 1220
65 Ga0070698_100237272 3300005471 Bacteria 1757
66 Ga0070699_100072970 3300005518 Bacteria 2986
67 Ga0070679_100053702 3300005530 Unclassified 4011
68 Ga0070684_100100711 3300005535 Bacteria 2580
69 Ga0070684_100131002 3300005535 Unclassified 2262
70 Ga0070697_100094909 3300005536 Bacteria 2472
71 Ga0070697_100484344 3300005536 Bacteria 1080
72 Ga0070672_100000534 3300005543 Bacteria 22369
73 Ga0070672_100018997 3300005543 Bacteria 4980
74 Ga0070672_100024687 3300005543 Bacteria 4447
75 Ga0070672_100092600 3300005543 Bacteria 2440
76 Ga0070665_100003480 3300005548 Bacteria 16773
77 Ga0070665_100019751 3300005548 Bacteria 6763
78 Ga0070665_100042072 3300005548 Bacteria 4592
79 Ga0070665_100079868 3300005548 Plasmid 3276
80 Ga0070665_100092824 3300005548 Unclassified 3023
81 Ga0070665_100106100 3300005548 Bacteria 2811
82 Ga0070665_100236224 3300005548 Unclassified 1828
83 Ga0070665_100518965 3300005548 Bacteria 1203
84 Ga0070704_100007891 3300005549 Bacteria 6354
85 Ga0070664_100083735 3300005564 Bacteria 2752
86 Ga0068859_100139416 3300005617 Bacteria 2499
87 Ga0068859_100168732 3300005617 Bacteria 2269
88 Ga0068859_100465458 3300005617 Bacteria 1360
89 Ga0068864_100001369 3300005618 Bacteria 20215
90 Ga0068864_100050212 3300005618 Bacteria 3590
91 Ga0068864_100054014 3300005618 Bacteria 3467
92 Ga0068866_10091430 3300005718 Bacteria 1658
93 Ga0068863_100003584 3300005841 Bacteria 15322
94 Ga0068863_100045698 3300005841 Bacteria 4156
95 Ga0068863_100130036 3300005841 Bacteria 2404
96 Ga0068858_100007316 3300005842 Bacteria 10691
97 Ga0068858_100009565 3300005842 Bacteria 9247
98 Ga0068860_100012271 3300005843 Bacteria 8443
99 Ga0068860_100014825 3300005843 Bacteria 7624
100 Ga0068860_100176466 3300005843 Bacteria 2065
101 Ga0068860_100366183 3300005843 Bacteria 1421
102 Ga0068862_100209083 3300005844 Bacteria 1763
103 Ga0081455_10004202 3300005937 Bacteria 16231
104 Ga0081455_10004602 3300005937 Bacteria 15406
105 Ga0081455_10006105 3300005937 Bacteria 13014
106 Ga0081455_10008549 3300005937 Bacteria 10625
107 Ga0081455_10040275 3300005937 Bacteria 4122
108 Ga0081538_10072729 3300005981 Bacteria 1883
109 Ga0081540_1001066 3300005983 Bacteria 24391
110 Ga0081540_1031596 3300005983 Bacteria 2908
111 Ga0075365_10081900 3300006038 Bacteria 2188
112 Ga0075364_10008946 3300006051 Bacteria 5997
113 Ga0075364_10060266 3300006051 Bacteria 2489
114 Ga0075432_10002020 3300006058 Bacteria 6745
115 Ga0070712_100080051 3300006175 Bacteria 2363
116 Ga0075366_10025363 3300006195 Bacteria 3462
117 Ga0097621_100010120 3300006237 Bacteria 6883
118 Ga0068871_100010043 3300006358 Bacteria 6883
119 Ga0068871_100184221 3300006358 Bacteria 1796
120 Ga0068871_100196961 3300006358 Bacteria 1738
121 Ga0075428_100177184 3300006844 Bacteria 2309
122 Ga0075431_100537902 3300006847 Bacteria 1156
123 Ga0075434_100158748 3300006871 Bacteria 2281
124 Ga0075434_100283213 3300006871 Bacteria 1677
125 Ga0068865_100078783 3300006881 Bacteria 2358
126 Ga0097620_100139416 3300006931 Bacteria 2499
127 Ga0097620_100168739 3300006931 Bacteria 2269
128 Ga0097620_100465459 3300006931 Bacteria 1360
129 Ga0075435_100052579 3300007076 Bacteria 3283
130 Ga0075435_100243192 3300007076 Bacteria 1531
131 Ga0075435_100269445 3300007076 Unclassified 1452
132 Ga0111539_10304739 3300009094 Bacteria 1854
133 Ga0111539_10397662 3300009094 Bacteria 1605
134 Ga0105248_10045745 3300009177 Bacteria 4907
135 Ga0105248_10425522 3300009177 Bacteria 1495
136 Ga0105238_10279231 3300009551 Unclassified 1651
137 Ga0105249_10086217 3300009553 Bacteria 2928
138 Ga0105239_10093835 3300010375 Bacteria 3314
139 Ga0105239_10243032 3300010375 Bacteria 2021
140 Ga0157370_10418605 3300013104 Unclassified 1232
141 Ga0157374_10011348 3300013296 Bacteria 7709
142 Ga0157374_10011665 3300013296 Bacteria 7619
143 Ga0157374_10141610 3300013296 Unclassified 2335
144 Ga0157374_10208870 3300013296 Bacteria 1914
145 Ga0157374_10309087 3300013296 Bacteria 1565
146 Ga0157378_10106925 3300013297 Bacteria 2560
147 Ga0157378_10191251 3300013297 Bacteria 1930
148 Ga0157378_10213585 3300013297 Bacteria 1830
149 Ga0163162_10006832 3300013306 Bacteria 11069
150 Ga0163162_10039128 3300013306 Bacteria 4737
151 Ga0163162_10100190 3300013306 Bacteria 2988
152 Ga0163162_10190194 3300013306 Bacteria 2180
153 Ga0157375_10013272 3300013308 Bacteria 7326
154 Ga0157375_10050276 3300013308 Bacteria 4088
155 Ga0157375_10064878 3300013308 Plasmid 3637
156 Ga0157375_10201180 3300013308 Bacteria 2148
157 Ga0157375_10272275 3300013308 Bacteria 1855
158 Ga0157375_10423932 3300013308 Bacteria 1496
159 Ga0157375_10512089 3300013308 Bacteria 1364
160 Ga0163163_10005327 3300014325 Bacteria 11113
161 Ga0163163_10024773 3300014325 Bacteria 5714
162 Ga0163163_10089939 3300014325 Bacteria 3083
163 Ga0163163_10328617 3300014325 Unclassified 1583
164 Ga0157380_10169639 3300014326 Bacteria 1905
165 Ga0182008_10039072 3300014497 Unclassified 2373
166 Ga0157379_10003262 3300014968 Bacteria 13738
167 Ga0157379_10042650 3300014968 Bacteria 4051
168 Ga0157376_10028389 3300014969 Bacteria 4447
169 Ga0157376_10034364 3300014969 Bacteria 4093
170 Ga0157376_10038102 3300014969 Bacteria 3909
171 Ga0157376_10146588 3300014969 Bacteria 2124
172 Ga0163161_10067232 3300017792 Bacteria 2618
173 Ga0163161_10129000 3300017792 Bacteria 1906
174 Ga0163161_10207108 3300017792 Bacteria 1514
175 Ga0207673_1000656 3300025290 Plasmid 3673
176 Ga0207697_10001539 3300025315 Bacteria 12504
177 Ga0207697_10001887 3300025315 Bacteria 11203
178 Ga0207697_10009628 3300025315 Unclassified 4164
179 Ga0207697_10018395 3300025315 Unclassified 2866
180 Ga0207692_10165688 3300025898 Bacteria 1277
181 Ga0207688_10144941 3300025901 Unclassified 1399
182 Ga0207680_10038978 3300025903 Bacteria 2753
183 Ga0207680_10104347 3300025903 Unclassified 1827
184 Ga0207680_10219735 3300025903 Bacteria 1302
185 Ga0207647_10003578 3300025904 Bacteria 11648
186 Ga0207699_10139145 3300025906 Bacteria 1594
187 Ga0207645_10002288 3300025907 Bacteria 15185
188 Ga0207705_10306402 3300025909 Unclassified 1219
189 Ga0207707_10041233 3300025912 Unclassified 4031
190 Ga0207693_10039722 3300025915 Unclassified 3705
191 Ga0207693_10045820 3300025915 Bacteria 3436
192 Ga0207693_10248018 3300025915 Bacteria 1397
193 Ga0207657_10260405 3300025919 Unclassified 1380
194 Ga0207649_10009937 3300025920 Bacteria 5215
195 Ga0207652_10010382 3300025921 Bacteria 7498
196 Ga0207681_10014840 3300025923 Bacteria 4851
197 Ga0207681_10025441 3300025923 Bacteria 3807
198 Ga0207650_10026400 3300025925 Bacteria 4143
199 Ga0207650_10069404 3300025925 Bacteria 2648
200 Ga0207650_10124177 3300025925 Bacteria 2013
201 Ga0207659_10027373 3300025926 Bacteria 3860
202 Ga0207659_10041444 3300025926 Unclassified 3224
203 Ga0207659_10078996 3300025926 Bacteria 2426
204 Ga0207687_10045548 3300025927 Unclassified 3032
205 Ga0207700_10078127 3300025928 Bacteria 2573
206 Ga0207644_10068145 3300025931 Bacteria 2595
207 Ga0207644_10080549 3300025931 Bacteria 2405
208 Ga0207644_10132963 3300025931 Bacteria 1907
209 Ga0207690_10081537 3300025932 Bacteria 2261
210 Ga0207706_10023666 3300025933 Bacteria 5515
211 Ga0207706_10047619 3300025933 Bacteria 3792
212 Ga0207706_10140443 3300025933 Bacteria 2125
213 Ga0207670_10018543 3300025936 Bacteria 4233
214 Ga0207670_10067141 3300025936 Bacteria 2467
215 Ga0207669_10053202 3300025937 Bacteria 2437
216 Ga0207704_10125210 3300025938 Bacteria 1768
217 Ga0207704_10279916 3300025938 Unclassified 1267
218 Ga0207665_10126591 3300025939 Bacteria 1809
219 Ga0207665_10175238 3300025939 Unclassified 1551
220 Ga0207691_10000677 3300025940 Bacteria 33636
221 Ga0207691_10006114 3300025940 Bacteria 11632
222 Ga0207691_10008989 3300025940 Bacteria 9581
223 Ga0207691_10133145 3300025940 Bacteria 2195
224 Ga0207689_10130899 3300025942 Bacteria 2065
225 Ga0207661_10042156 3300025944 Unclassified 3597
226 Ga0207661_10095872 3300025944 Unclassified 2481
227 Ga0207679_10107731 3300025945 Unclassified 2193
228 Ga0207651_10011984 3300025960 Bacteria 4881
229 Ga0207651_10034504 3300025960 Bacteria 3277
230 Ga0207712_10037810 3300025961 Bacteria 3296
231 Ga0207668_10002923 3300025972 Bacteria 10022
232 Ga0207668_10047967 3300025972 Bacteria 2928
233 Ga0207668_10105855 3300025972 Bacteria 2100
234 Ga0207668_10151472 3300025972 Bacteria 1796
235 Ga0207658_10002708 3300025986 Bacteria 12787
236 Ga0207658_10027957 3300025986 Bacteria 3968
237 Ga0207658_10053425 3300025986 Bacteria 2985
238 Ga0207658_10236490 3300025986 Bacteria 1545
239 Ga0207677_10033293 3300026023 Bacteria 3323
240 Ga0207703_10007720 3300026035 Bacteria 8516
241 Ga0207703_10100798 3300026035 Bacteria 2447
242 Ga0207678_10071724 3300026067 Unclassified 2969
243 Ga0207708_10047698 3300026075 Bacteria 3260
244 Ga0207702_10163224 3300026078 Unclassified 2036
245 Ga0207641_10003755 3300026088 Bacteria 13339
246 Ga0207641_10006268 3300026088 Bacteria 10060
247 Ga0207641_10455186 3300026088 Bacteria 1237
248 Ga0207641_10505099 3300026088 Bacteria 1175
249 Ga0207648_10002616 3300026089 Bacteria 19280
250 Ga0207648_10010875 3300026089 Bacteria 8602
251 Ga0207676_10092244 3300026095 Bacteria 2490
252 Ga0207675_100291760 3300026118 Bacteria 1587
253 Ga0207683_10007812 3300026121 Bacteria 9154
254 Ga0207683_10040015 3300026121 Bacteria 4089
255 Ga0268266_10008705 3300028379 Bacteria 8995
256 Ga0268266_10052328 3300028379 Bacteria 3506
257 Ga0268266_10074903 3300028379 Unclassified 2939
258 Ga0268266_10113762 3300028379 Unclassified 2400
259 Ga0268266_10439861 3300028379 Bacteria 1238
260 Ga0268265_10103549 3300028380 Bacteria 2305
261 Ga0268264_10008952 3300028381 Bacteria 8309
262 Ga0268264_10040094 3300028381 Bacteria 3869
263 Ga0265330_10021561 3300031235 Bacteria 2938
264 Ga0265332_10002400 3300031238 Bacteria 9550
265 Ga0265329_10002532 3300031242 Bacteria 8252
266 Ga0265331_10004678 3300031250 Bacteria 8474
267 Ga0265327_10016317 3300031251 Bacteria 4723
268 Ga0265327_10021399 3300031251 Bacteria 3904
269 Ga0265316_10018383 3300031344 Bacteria 6007
270 Ga0265316_10201420 3300031344 Bacteria 1475
271 Ga0307408_100041605 3300031548 Bacteria 3258
272 Ga0316575_10059452 3300031665 Bacteria 1525
273 Ga0316579_10054495 3300031691 Bacteria 1874
274 Ga0265314_10007058 3300031711 Bacteria 9805
275 Ga0316576_10186895 3300031727 Bacteria 1562
276 Ga0316578_10057411 3300031728 Bacteria 2287
277 Ga0316578_10075267 3300031728 Bacteria 2002
278 Ga0316577_10093806 3300031733 Bacteria 1680
279 Ga0316583_10008595 3300032133 Bacteria 3683
280 Ga0373943_0107820 3300035170 Bacteria 1465
281 Ga0316574_0028986 3300035398 Bacteria 3341
282 Ga0373935_0092621 3300035692 Unclassified 1981
283 Ga0373935_0112187 3300035692 Bacteria 1811
284 Ga0373947_0239738 3300035725 Bacteria 1196
285 Ga0373937_0124407 3300036401 Bacteria 2405
286 Ga0373937_0573506 3300036401 Bacteria 1072
287 Ga0316582_0055819 3300036647 Bacteria 2518
288 Ga0316584_0075905 3300036712 Bacteria 2518
289 Ga0395898_0015299 3300037466 Bacteria 7874
290 Ga0316581_0002821 3300037588 Bacteria 4238
291 Ga0436360_0174180 3300039438 Bacteria 1438
292 Ga0436362_0704318 3300039453 Bacteria 986
293 Ga0451807_2211933 3300041486 Bacteria 3474
294 Ga0439455_0000780 3300042012 Bacteria 4801
295 Ga0450902_000183 3300042137 Bacteria 7255
296 Ga0439458_0003612 3300042157 Bacteria 3603
297 Ga0439460_0045223 3300042461 Bacteria 1305
298 Ga0451576_0001178 3300045051 Bacteria 46877
299 Ga0451576_0025827 3300045051 Bacteria 6327
300 Ga0451576_0215388 3300045051 Bacteria 2005
301 Ga0495617_005619 3300046452 Bacteria 4435
302 Ga0495592_0003800 3300046454 Bacteria 10904
303 Ga0495603_0201863 3300046455 Bacteria 1149
304 Ga0495662_0148928 3300046476 Unclassified 1153
305 Ga0495628_0144989 3300046516 Unclassified 1810
306 Ga0495630_0096182 3300046517 Unclassified 2239
307 Ga0495643_0022383 3300046522 Bacteria 3607
308 Ga0495587_0088119 3300046536 Bacteria 1796
309 Ga0495645_0008172 3300046543 Bacteria 7296
310 Ga0495656_0023452 3300046615 Bacteria 2429
311 Ga0495599_0000638 3300046678 Bacteria 19791
312 Ga0495646_0064421 3300046680 Unclassified 2172
313 Ga0495581_0126671 3300047315 Bacteria 1487
314 Ga0495604_0007389 3300047317 Bacteria 8707
315 Ga0495674_0068080 3300047319 Unclassified 3082
316 Ga0495674_0226063 3300047319 Unclassified 1546
317 Ga0495675_0118016 3300047444 Bacteria 1653
318 Ga0495602_0013438 3300048088 Bacteria 8369
319 Ga0496102_0134688 3300048905 Bacteria 2314
320 Ga0496104_0072759 3300048907 Bacteria 3269
321 Ga0496104_0269061 3300048907 Unclassified 1617
322 Ga0496104_0312327 3300048907 Bacteria 1485
323 Ga0496106_0087389 3300048909 Bacteria 2402
324 Ga0496107_0285478 3300048910 Bacteria 1228
325 Ga0496108_0059340 3300048911 Unclassified 3217
326 Ga0496108_0272163 3300048911 Bacteria 1474
327 Ga0496109_0046108 3300048912 Bacteria 3958
328 Ga0496109_0210814 3300048912 Unclassified 1827
329 Ga0496109_0396977 3300048912 Bacteria 1303
330 Ga0496110_0213464 3300048913 Bacteria 1755
331 Ga0496112_0067728 3300048915 Plasmid 3524
332 Ga0496112_0236494 3300048915 Bacteria 1780
333 Ga0496112_0276624 3300048915 Bacteria 1626
334 Ga0496113_0182594 3300048916 Bacteria 1663
335 Ga0496114_0340783 3300048917 Unclassified 1325
336 Ga0501046_0102889 3300049580 Bacteria 2190
337 Ga0501069_0159743 3300049585 Bacteria 1298
338 Ga0501075_0061588 3300049591 Bacteria 2828
339 Ga0501076_0143631 3300049592 Bacteria 1940
340 Ga0501076_0217758 3300049592 Bacteria 1561
341 Ga0501045_0113379 3300049824 Bacteria 2011
342 nmdc:mga03683_81536_c1 3300050489 Bacteria 1397
343 nmdc:mga00v17_77600_c1 3300050491 Bacteria 2068
344 nmdc:mga0k408_20899_c1 3300050493 Bacteria 3673
345 nmdc:mga09592_97996_c1 3300050508 Bacteria 2509
346 nmdc:mga08y16_233705_c1 3300050511 Bacteria 1901
347 nmdc:mga08y16_485364_c1 3300050511 Unclassified 1257
348 nmdc:mga0n895_153618_c1 3300050512 Bacteria 2332
349 nmdc:mga0n895_258305_c1 3300050512 Bacteria 1768
350 nmdc:mga0n895_415675_c1 3300050512 Bacteria 1360
351 nmdc:mga0rr50_118102_c1 3300050513 Bacteria 2107
352 nmdc:mga0rr50_226262_c1 3300050513 Bacteria 1546
353 nmdc:mga0rr50_464446_c1 3300050513 Bacteria 1074
354 Ga0495601_0090834 3300053077 Unclassified 1965
355 Ga0495612_0023458 3300053078 Unclassified 2476
356 Ga0501084_0179462 3300054114 Bacteria 1787
357 Ga0530510_0023394 3300061734 Bacteria 4402
358 2852393517 2852387548 Bacteria 8025568
359 2894241545 2894232714 Bacteria 8834183
360 8046773601 8046767195 Bacteria 7547379
361 8057575627 8057575449 Bacteria 7367519
362 Ga0070683_100049079
363 JGI25405J52794_10001392
364 Ga0065714_10007499
365 Ga0065704_10011711
366 Ga0065715_10011451
367 Ga0065715_10099467
368 Ga0065715_10149785
369 Ga0070658_10256573
370 Ga0070676_10029632
371 Ga0070683_100041987
372 Ga0070690_100046684
373 Ga0070670_100005400
374 Ga0070670_100023567
375 Ga0070670_100063605
376 Ga0068869_100027382
377 Ga0070666_10005921
378 Ga0070666_10115690
379 Ga0068868_100189315
380 Ga0070660_100074362
381 Ga0070689_100026417
382 Ga0070689_100028752
383 Ga0070689_100086201
384 Ga0070668_100002576
385 Ga0070668_100009585
386 Ga0070668_100012908
387 Ga0070668_100242639
388 Ga0070669_100002307
389 Ga0070669_100007344
390 Ga0070675_100003431
391 Ga0070675_100014701
392 Ga0070675_100025758
393 Ga0070675_100060029
394 Ga0070675_100065661
395 Ga0070675_100102263
396 Ga0070675_100204159
397 Ga0070671_100038266
398 Ga0070671_100102918
399 Ga0070671_100240958
400 Ga0070671_100336194
401 Ga0070673_100007836
402 Ga0070673_100066128
403 Ga0070673_100166528
404 Ga0070688_100023484
405 Ga0070688_100057310
406 Ga0070659_100009112
407 Ga0070667_100035820
408 Ga0070709_10180954
409 Ga0070714_100084789
410 Ga0070714_100118617
411 Ga0070713_100026274
412 Ga0070713_100071644
413 Ga0070710_10017658
414 Ga0070711_100038196
415 Ga0070711_100120081
416 Ga0070700_100025267
417 Ga0070663_100040527
418 Ga0070678_100003855
419 Ga0070662_100021575
420 Ga0070662_100164453
421 Ga0070681_10085561
422 Ga0068867_100004281
423 Ga0068867_100254312
424 Ga0070685_10017530
425 Ga0070685_10229510
426 Ga0070698_100237272
427 Ga0070699_100072970
428 Ga0070679_100053702
429 Ga0070684_100100711
430 Ga0070684_100131002
431 Ga0070697_100094909
432 Ga0070697_100484344
433 Ga0070672_100000534
434 Ga0070672_100018997
435 Ga0070672_100024687
436 Ga0070672_100092600
437 Ga0070665_100003480
438 Ga0070665_100019751
439 Ga0070665_100042072
440 Ga0070665_100079868
441 Ga0070665_100092824
442 Ga0070665_100106100
443 Ga0070665_100236224
444 Ga0070665_100518965
445 Ga0070704_100007891
446 Ga0070664_100083735
447 Ga0068859_100139416
448 Ga0068859_100168732
449 Ga0068859_100465458
450 Ga0068864_100001369
451 Ga0068864_100050212
452 Ga0068864_100054014
453 Ga0068866_10091430
454 Ga0068863_100003584
455 Ga0068863_100045698
456 Ga0068863_100130036
457 Ga0068858_100007316
458 Ga0068858_100009565
459 Ga0068860_100012271
460 Ga0068860_100014825
461 Ga0068860_100176466
462 Ga0068860_100366183
463 Ga0068862_100209083
464 Ga0081455_10004202
465 Ga0081455_10004602
466 Ga0081455_10006105
467 Ga0081455_10008549
468 Ga0081455_10040275
469 Ga0081538_10072729
470 Ga0081540_1001066
471 Ga0081540_1031596
472 Ga0075365_10081900
473 Ga0075364_10008946
474 Ga0075364_10060266
475 Ga0075432_10002020
476 Ga0070712_100080051
477 Ga0075366_10025363
478 Ga0097621_100010120
479 Ga0068871_100010043
480 Ga0068871_100184221
481 Ga0068871_100196961
482 Ga0075428_100177184
483 Ga0075431_100537902
484 Ga0075434_100158748
485 Ga0075434_100283213
486 Ga0068865_100078783
487 Ga0097620_100139416
488 Ga0097620_100168739
489 Ga0097620_100465459
490 Ga0075435_100052579
491 Ga0075435_100243192
492 Ga0075435_100269445
493 Ga0111539_10304739
494 Ga0111539_10397662
495 Ga0105248_10045745
496 Ga0105248_10425522
497 Ga0105238_10279231
498 Ga0105249_10086217
499 Ga0105239_10093835
500 Ga0105239_10243032
501 Ga0157370_10418605
502 Ga0157374_10011348
503 Ga0157374_10011665
504 Ga0157374_10141610
505 Ga0157374_10208870
506 Ga0157374_10309087
507 Ga0157378_10106925
508 Ga0157378_10191251
509 Ga0157378_10213585
510 Ga0163162_10006832
511 Ga0163162_10039128
512 Ga0163162_10100190
513 Ga0163162_10190194
514 Ga0157375_10013272
515 Ga0157375_10050276
516 Ga0157375_10064878
517 Ga0157375_10201180
518 Ga0157375_10272275
519 Ga0157375_10423932
520 Ga0157375_10512089
521 Ga0163163_10005327
522 Ga0163163_10024773
523 Ga0163163_10089939
524 Ga0163163_10328617
525 Ga0157380_10169639
526 Ga0182008_10039072
527 Ga0157379_10003262
528 Ga0157379_10042650
529 Ga0157376_10028389
530 Ga0157376_10034364
531 Ga0157376_10038102
532 Ga0157376_10146588
533 Ga0163161_10067232
534 Ga0163161_10129000
535 Ga0163161_10207108
536 Ga0207673_1000656
537 Ga0207697_10001539
538 Ga0207697_10001887
539 Ga0207697_10009628
540 Ga0207697_10018395
541 Ga0207692_10165688
542 Ga0207688_10144941
543 Ga0207680_10038978
544 Ga0207680_10104347
545 Ga0207680_10219735
546 Ga0207647_10003578
547 Ga0207699_10139145
548 Ga0207645_10002288
549 Ga0207705_10306402
550 Ga0207707_10041233
551 Ga0207693_10039722
552 Ga0207693_10045820
553 Ga0207693_10248018
554 Ga0207657_10260405
555 Ga0207649_10009937
556 Ga0207652_10010382
557 Ga0207681_10014840
558 Ga0207681_10025441
559 Ga0207650_10026400
560 Ga0207650_10069404
561 Ga0207650_10124177
562 Ga0207659_10027373
563 Ga0207659_10041444
564 Ga0207659_10078996
565 Ga0207687_10045548
566 Ga0207700_10078127
567 Ga0207644_10068145
568 Ga0207644_10080549
569 Ga0207644_10132963
570 Ga0207690_10081537
571 Ga0207706_10023666
572 Ga0207706_10047619
573 Ga0207706_10140443
574 Ga0207670_10018543
575 Ga0207670_10067141
576 Ga0207669_10053202
577 Ga0207704_10125210
578 Ga0207704_10279916
579 Ga0207665_10126591
580 Ga0207665_10175238
581 Ga0207691_10000677
582 Ga0207691_10006114
583 Ga0207691_10008989
584 Ga0207691_10133145
585 Ga0207689_10130899
586 Ga0207661_10042156
587 Ga0207661_10095872
588 Ga0207679_10107731
589 Ga0207651_10011984
590 Ga0207651_10034504
591 Ga0207712_10037810
592 Ga0207668_10002923
593 Ga0207668_10047967
594 Ga0207668_10105855
595 Ga0207668_10151472
596 Ga0207658_10002708
597 Ga0207658_10027957
598 Ga0207658_10053425
599 Ga0207658_10236490
600 Ga0207677_10033293
601 Ga0207703_10007720
602 Ga0207703_10100798
603 Ga0207678_10071724
604 Ga0207708_10047698
605 Ga0207702_10163224
606 Ga0207641_10003755
607 Ga0207641_10006268
608 Ga0207641_10455186
609 Ga0207641_10505099
610 Ga0207648_10002616
611 Ga0207648_10010875
612 Ga0207676_10092244
613 Ga0207675_100291760
614 Ga0207683_10007812
615 Ga0207683_10040015
616 Ga0268266_10008705
617 Ga0268266_10052328
618 Ga0268266_10074903
619 Ga0268266_10113762
620 Ga0268266_10439861
621 Ga0268265_10103549
622 Ga0268264_10008952
623 Ga0268264_10040094
624 Ga0265330_10021561
625 Ga0265332_10002400
626 Ga0265329_10002532
627 Ga0265331_10004678
628 Ga0265327_10016317
629 Ga0265327_10021399
630 Ga0265316_10018383
631 Ga0265316_10201420
632 Ga0307408_100041605
633 Ga0316575_10059452
634 Ga0316579_10054495
635 Ga0265314_10007058
636 Ga0316576_10186895
637 Ga0316578_10057411
638 Ga0316578_10075267
639 Ga0316577_10093806
640 Ga0316583_10008595
641 Ga0373943_0107820
642 Ga0316574_0028986
643 Ga0373935_0092621
644 Ga0373935_0112187
645 Ga0373947_0239738
646 Ga0373937_0124407
647 Ga0373937_0573506
648 Ga0316582_0055819
649 Ga0316584_0075905
650 Ga0395898_0015299
651 Ga0316581_0002821
652 Ga0436360_0174180
653 Ga0436362_0704318
654 Ga0451807_2211933
655 Ga0439455_0000780
656 Ga0450902_000183
657 Ga0439458_0003612
658 Ga0439460_0045223
659 Ga0451576_0001178
660 Ga0451576_0025827
661 Ga0451576_0215388
662 Ga0495617_005619
663 Ga0495592_0003800
664 Ga0495603_0201863
665 Ga0495662_0148928
666 Ga0495628_0144989
667 Ga0495630_0096182
668 Ga0495643_0022383
669 Ga0495587_0088119
670 Ga0495645_0008172
671 Ga0495656_0023452
672 Ga0495599_0000638
673 Ga0495646_0064421
674 Ga0495581_0126671
675 Ga0495604_0007389
676 Ga0495674_0068080
677 Ga0495674_0226063
678 Ga0495675_0118016
679 Ga0495602_0013438
680 Ga0496102_0134688
681 Ga0496104_0072759
682 Ga0496104_0269061
683 Ga0496104_0312327
684 Ga0496106_0087389
685 Ga0496107_0285478
686 Ga0496108_0059340
687 Ga0496108_0272163
688 Ga0496109_0046108
689 Ga0496109_0210814
690 Ga0496109_0396977
691 Ga0496110_0213464
692 Ga0496112_0067728
693 Ga0496112_0236494
694 Ga0496112_0276624
695 Ga0496113_0182594
696 Ga0496114_0340783
697 Ga0501046_0102889
698 Ga0501069_0159743
699 Ga0501075_0061588
700 Ga0501076_0143631
701 Ga0501076_0217758
702 Ga0501045_0113379
703 nmdc:mga03683_81536_c1
704 nmdc:mga00v17_77600_c1
705 nmdc:mga0k408_20899_c1
706 nmdc:mga09592_97996_c1
707 nmdc:mga08y16_233705_c1
708 nmdc:mga08y16_485364_c1
709 nmdc:mga0n895_153618_c1
710 nmdc:mga0n895_258305_c1
711 nmdc:mga0n895_415675_c1
712 nmdc:mga0rr50_118102_c1
713 nmdc:mga0rr50_226262_c1
714 nmdc:mga0rr50_464446_c1
715 Ga0495601_0090834
716 Ga0495612_0023458
717 Ga0501084_0179462
718 Ga0530510_0023394
719 2852393517
720 2894241545
721 8046773601
722 8057575627

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

80

256

0.7

PF12710

HAD

haloacid dehalogenase-like hydrolase

83

291

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ovy-assembly1.cif.gz_A-2 crystal structure of haloacid dehalogenase domain protein hydrolase from planctomyces limnophilus dsm 3776 0.873 26 338
4ovy-assembly1.cif.gz_A-2 crystal structure of haloacid dehalogenase domain protein hydrolase from planctomyces limnophilus dsm 3776 0.8651 26 338
1fuy-assembly1.cif.gz_B-2 crystal structure of betaa169l/betac170w double mutant of tryptophan synthase complexed with 5-fluoro-indole-propanol phosphate 0.6036 248 329
3kd3-assembly2.cif.gz_B crystal structure of a phosphoserine phosphohydrolase-like protein from francisella tularensis subsp. tularensis schu s4 0.5875 62 295
4gxt-assembly1.cif.gz_A the crystal structure of a conserved functionally unknown protein from anaerococcus prevotii dsm 20548 0.5872 37 326
ID Description Score Start End Superfamily
2a1sB02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.6736 218 234 3.30.1370.50
af_Q1PDX4_4_202_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.6348 217 238 3.10.20.90
af_Q9SGW8_243_498_1.10.1070.11 Mainly Alpha;Orthogonal Bundle;Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5;Phosphatidylinositol 3-/4-kinase, catalytic domain 0.6068 217 245 1.10.1070.11
af_A0A1D6NVU1_81_299_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.5898 39 267 3.40.50.1000
af_Q2FXX9_19_157_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.5874 167 269 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2V6FLM8-F1-model_v4 HAD family hydrolase 0.9682 243 340 GO:0016787
AF-A0A5E7NZ61-F1-model_v4 deleted 0.9632 270 339
AF-A0A369XIY4-F1-model_v4 HAD family hydrolase 0.963 21 191 GO:0016787
AF-K6ZTA4-F1-model_v4 Nonspecific acid phosphatase 0.9542 245 338
AF-A0A3N5ZDU1-F1-model_v4 Haloacid dehalogenase-like hydrolase 0.9511 244 338 GO:0016787

Map