F421915

General Info

Members Datasets Scaffolds Average Seq Length
360 206 360 119

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_101917215|Ga0307416_1019172152
Length 129
Sequence VTTRAGAHAADEICREGLCPKYQKAMALLGKRWTGLVLRVLLDGPSRFGDFLARIDGISDPILSDRLKELECQGLVQRRVLPETPVRVEYALTEKGRALIPIIESMRTYGSDWLGATGSCAETPAVVAA

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
113 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
114 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
132 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
133 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
134 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
138 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
139 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
146 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 1.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 5.56
Rhizosphere 93.61
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10189713 3300003373 Bacteria 507
2 Ga0070658_10498546 3300005327 Bacteria 1052
3 Ga0070658_10631859 3300005327 Bacteria 929
4 Ga0070683_100036434 3300005329 Bacteria 4501
5 Ga0070683_100046234 3300005329 Bacteria 4020
6 Ga0070683_100490811 3300005329 Bacteria 1173
7 Ga0070683_100580308 3300005329 Bacteria 1072
8 Ga0070683_101804891 3300005329 Bacteria 588
9 Ga0070690_100233183 3300005330 Bacteria 1295
10 Ga0070690_101527351 3300005330 Bacteria 540
11 Ga0070682_100105141 3300005337 Bacteria 1871
12 Ga0070682_100482074 3300005337 Bacteria 957
13 Ga0068868_100051517 3300005338 Bacteria 3238
14 Ga0068868_100875881 3300005338 Bacteria 815
15 Ga0070660_100239045 3300005339 Bacteria 1479
16 Ga0070660_100354962 3300005339 Bacteria 1208
17 Ga0070691_10170047 3300005341 Bacteria 1129
18 Ga0070691_10734698 3300005341 Bacteria 596
19 Ga0070687_101542653 3300005343 Bacteria 501
20 Ga0070661_100264414 3300005344 Bacteria 1330
21 Ga0070692_10176584 3300005345 Bacteria 1235
22 Ga0070668_100213893 3300005347 Bacteria 1587
23 Ga0070668_100239335 3300005347 Bacteria 1503
24 Ga0070668_100296483 3300005347 Bacteria 1355
25 Ga0070668_101537516 3300005347 Bacteria 609
26 Ga0070675_101230002 3300005354 Bacteria 690
27 Ga0070671_100572688 3300005355 Bacteria 975
28 Ga0070674_100765860 3300005356 Bacteria 831
29 Ga0070659_100294536 3300005366 Bacteria 1352
30 Ga0070659_100326921 3300005366 Bacteria 1283
31 Ga0070659_101747877 3300005366 Bacteria 557
32 Ga0070710_10000002 3300005437 Bacteria 290371
33 Ga0070700_100025508 3300005441 Bacteria 3481
34 Ga0070700_100305212 3300005441 Bacteria 1163
35 Ga0070700_100589814 3300005441 Bacteria 869
36 Ga0070694_101131968 3300005444 Bacteria 654
37 Ga0070678_100039327 3300005456 Bacteria 3336
38 Ga0070678_100161520 3300005456 Bacteria 1816
39 Ga0070662_100109120 3300005457 Bacteria 2106
40 Ga0070662_100410479 3300005457 Bacteria 1119
41 Ga0068867_100052280 3300005459 Bacteria 3015
42 Ga0068867_100313530 3300005459 Bacteria 1297
43 Ga0070684_100292563 3300005535 Bacteria 1493
44 Ga0070684_100495791 3300005535 Bacteria 1131
45 Ga0070684_100613832 3300005535 Bacteria 1011
46 Ga0070684_100653611 3300005535 Bacteria 979
47 Ga0070684_100990791 3300005535 Bacteria 789
48 Ga0070684_101875690 3300005535 Bacteria 566
49 Ga0068853_101689655 3300005539 Bacteria 614
50 Ga0070672_100130656 3300005543 Bacteria 2063
51 Ga0070686_101126856 3300005544 Bacteria 649
52 Ga0070696_100396280 3300005546 Bacteria 1079
53 Ga0070693_100524505 3300005547 Bacteria 844
54 Ga0070665_100254564 3300005548 Bacteria 1757
55 Ga0070665_101986393 3300005548 Bacteria 587
56 Ga0070704_100375888 3300005549 Bacteria 1206
57 Ga0070704_101671680 3300005549 Bacteria 588
58 Ga0070664_101223420 3300005564 Bacteria 709
59 Ga0070664_101422873 3300005564 Bacteria 656
60 Ga0068866_10050761 3300005718 Bacteria 2108
61 Ga0068861_100054319 3300005719 Bacteria 3051
62 Ga0068870_10286952 3300005840 Bacteria 1034
63 Ga0068858_100839537 3300005842 Bacteria 897
64 Ga0068860_100372126 3300005843 Bacteria 1409
65 Ga0081538_10010704 3300005981 Bacteria 7505
66 Ga0081538_10059045 3300005981 Bacteria 2219
67 Ga0081538_10060617 3300005981 Bacteria 2174
68 Ga0081538_10131141 3300005981 Bacteria 1178
69 Ga0081538_10326243 3300005981 Bacteria 559
70 Ga0081540_1130936 3300005983 Bacteria 1024
71 Ga0081540_1144834 3300005983 Bacteria 948
72 Ga0081539_10001190 3300005985 Bacteria 46973
73 Ga0081539_10279800 3300005985 Bacteria 727
74 Ga0070717_10000006 3300006028 Bacteria 353403
75 Ga0075365_10303088 3300006038 Bacteria 1124
76 Ga0075428_100727463 3300006844 Bacteria 1057
77 Ga0075434_101497983 3300006871 Bacteria 684
78 Ga0068865_100177950 3300006881 Bacteria 1636
79 Ga0105240_11730928 3300009093 Bacteria 652
80 Ga0111539_10413993 3300009094 Bacteria 1570
81 Ga0111539_11283538 3300009094 Bacteria 850
82 Ga0111539_13052893 3300009094 Bacteria 541
83 Ga0105245_10013848 3300009098 Bacteria 7026
84 Ga0105245_10157559 3300009098 Bacteria 2152
85 Ga0105245_10500424 3300009098 Bacteria 1231
86 Ga0105245_10581030 3300009098 Bacteria 1145
87 Ga0105245_10728184 3300009098 Bacteria 1026
88 Ga0105245_11509436 3300009098 Bacteria 723
89 Ga0105247_11375023 3300009101 Bacteria 570
90 Ga0114129_11513360 3300009147 Bacteria 824
91 Ga0114129_11870059 3300009147 Bacteria 729
92 Ga0105243_10110957 3300009148 Bacteria 2295
93 Ga0105243_10588010 3300009148 Bacteria 1070
94 Ga0105243_11701078 3300009148 Bacteria 660
95 Ga0105242_10422469 3300009176 Bacteria 1249
96 Ga0105242_10544957 3300009176 Bacteria 1111
97 Ga0105242_10951773 3300009176 Bacteria 863
98 Ga0105248_11326868 3300009177 Bacteria 814
99 Ga0105237_12402013 3300009545 Bacteria 537
100 Ga0105249_10671080 3300009553 Bacteria 1095
101 Ga0105249_11061606 3300009553 Bacteria 880
102 Ga0105239_10529135 3300010375 Bacteria 1341
103 Ga0105239_11703050 3300010375 Bacteria 730
104 Ga0105246_10018236 3300011119 Bacteria 4472
105 Ga0105246_10241310 3300011119 Unclassified 1429
106 Ga0157370_10732652 3300013104 Bacteria 901
107 Ga0157369_12679420 3300013105 Bacteria 502
108 Ga0157374_11121154 3300013296 Bacteria 807
109 Ga0163162_10694865 3300013306 Bacteria 1139
110 Ga0163162_12509743 3300013306 Bacteria 593
111 Ga0157372_10342639 3300013307 Bacteria 1741
112 Ga0157372_10635550 3300013307 Bacteria 1243
113 Ga0157372_10870595 3300013307 Bacteria 1046
114 Ga0157375_12150895 3300013308 Bacteria 664
115 Ga0163163_10153931 3300014325 Bacteria 2343
116 Ga0163163_11222845 3300014325 Bacteria 814
117 Ga0157380_10090101 3300014326 Bacteria 2529
118 Ga0157380_10182821 3300014326 Bacteria 1843
119 Ga0157380_10283742 3300014326 Bacteria 1517
120 Ga0157380_10768658 3300014326 Bacteria 977
121 Ga0157377_10458421 3300014745 Bacteria 882
122 Ga0157377_10942153 3300014745 Bacteria 649
123 Ga0157377_11534260 3300014745 Bacteria 531
124 Ga0157379_10570564 3300014968 Bacteria 1054
125 Ga0157376_10492372 3300014969 Bacteria 1203
126 Ga0206351_10679669 3300020077 Bacteria 590
127 Ga0206352_10807627 3300020078 Bacteria 520
128 Ga0206353_11802316 3300020082 Bacteria 549
129 Ga0207656_10274097 3300025321 Bacteria 831
130 Ga0207692_10000005 3300025898 Bacteria 370169
131 Ga0207642_10070110 3300025899 Bacteria 1665
132 Ga0207642_10563275 3300025899 Bacteria 705
133 Ga0207642_10721552 3300025899 Bacteria 629
134 Ga0207642_10982932 3300025899 Bacteria 543
135 Ga0207710_10389337 3300025900 Bacteria 714
136 Ga0207645_10164502 3300025907 Bacteria 1452
137 Ga0207643_10197117 3300025908 Bacteria 1225
138 Ga0207705_10346139 3300025909 Bacteria 1144
139 Ga0207707_10887774 3300025912 Bacteria 738
140 Ga0207707_11341511 3300025912 Bacteria 573
141 Ga0207695_11587403 3300025913 Bacteria 535
142 Ga0207662_10007952 3300025918 Bacteria 5777
143 Ga0207662_10155307 3300025918 Bacteria 1458
144 Ga0207657_10198312 3300025919 Bacteria 1616
145 Ga0207657_11116248 3300025919 Bacteria 602
146 Ga0207649_10805196 3300025920 Bacteria 733
147 Ga0207652_11487480 3300025921 Bacteria 581
148 Ga0207681_10648989 3300025923 Bacteria 875
149 Ga0207650_11251488 3300025925 Bacteria 632
150 Ga0207687_10502204 3300025927 Bacteria 1012
151 Ga0207687_10506270 3300025927 Bacteria 1008
152 Ga0207687_10559070 3300025927 Bacteria 961
153 Ga0207664_10022995 3300025929 Bacteria 4664
154 Ga0207690_10178880 3300025932 Bacteria 1595
155 Ga0207690_10491908 3300025932 Bacteria 991
156 Ga0207690_10510946 3300025932 Bacteria 973
157 Ga0207706_10075832 3300025933 Bacteria 2958
158 Ga0207686_11176357 3300025934 Bacteria 627
159 Ga0207709_10087276 3300025935 Bacteria 2028
160 Ga0207709_10259028 3300025935 Bacteria 1274
161 Ga0207709_11155406 3300025935 Bacteria 637
162 Ga0207669_10096920 3300025937 Bacteria 1938
163 Ga0207669_10099501 3300025937 Bacteria 1918
164 Ga0207669_10251251 3300025937 Unclassified 1317
165 Ga0207669_11169079 3300025937 Bacteria 651
166 Ga0207704_10474460 3300025938 Bacteria 1003
167 Ga0207691_10354931 3300025940 Bacteria 1254
168 Ga0207711_11157321 3300025941 Bacteria 715
169 Ga0207689_11000448 3300025942 Bacteria 705
170 Ga0207661_10693399 3300025944 Bacteria 937
171 Ga0207661_10906650 3300025944 Bacteria 812
172 Ga0207679_10327092 3300025945 Bacteria 1329
173 Ga0207679_10433359 3300025945 Bacteria 1163
174 Ga0207712_10634941 3300025961 Bacteria 927
175 Ga0207668_10273036 3300025972 Bacteria 1383
176 Ga0207668_10476138 3300025972 Bacteria 1070
177 Ga0207677_10459597 3300026023 Bacteria 1092
178 Ga0207677_11104210 3300026023 Bacteria 723
179 Ga0207677_11153370 3300026023 Bacteria 708
180 Ga0207703_11692005 3300026035 Bacteria 608
181 Ga0207639_11560480 3300026041 Bacteria 619
182 Ga0207678_10333014 3300026067 Bacteria 1307
183 Ga0207678_10642768 3300026067 Bacteria 932
184 Ga0207708_10003012 3300026075 Bacteria 12419
185 Ga0207708_10181155 3300026075 Bacteria 1673
186 Ga0207708_10484872 3300026075 Bacteria 1034
187 Ga0207648_10444942 3300026089 Bacteria 1179
188 Ga0207675_100052980 3300026118 Bacteria 3786
189 Ga0207675_100130373 3300026118 Bacteria 2384
190 Ga0207683_10090481 3300026121 Bacteria 2725
191 Ga0207683_10450372 3300026121 Bacteria 1187
192 Ga0207698_10175974 3300026142 Bacteria 1890
193 Ga0207698_10486563 3300026142 Bacteria 1198
194 Ga0268266_11030627 3300028379 Bacteria 796
195 Ga0268266_11534853 3300028379 Bacteria 642
196 Ga0268265_10243435 3300028380 Bacteria 1589
197 Ga0265326_10000017 3300028558 Bacteria 152436
198 Ga0265334_10000029 3300028573 Bacteria 114485
199 Ga0265336_10018880 3300028666 Bacteria 2229
200 Ga0265338_10022616 3300028800 Bacteria 6499
201 Ga0265324_10001650 3300029957 Bacteria 12336
202 Ga0265340_10315632 3300031247 Bacteria 692
203 Ga0265314_10197021 3300031711 Bacteria 1194
204 Ga0307405_10429791 3300031731 Bacteria 1042
205 Ga0307405_10667704 3300031731 Bacteria 857
206 Ga0307413_10578332 3300031824 Bacteria 916
207 Ga0307410_10586446 3300031852 Bacteria 928
208 Ga0307410_10605995 3300031852 Bacteria 914
209 Ga0307406_10327150 3300031901 Bacteria 1188
210 Ga0307409_100190578 3300031995 Bacteria 1825
211 Ga0307409_100744044 3300031995 Bacteria 984
212 Ga0307409_101582406 3300031995 Unclassified 683
213 Ga0307409_101958745 3300031995 Bacteria 615
214 Ga0307409_102094737 3300031995 Bacteria 595
215 Ga0307409_102698103 3300031995 Bacteria 525
216 Ga0307416_100292301 3300032002 Bacteria 1614
217 Ga0307416_100937234 3300032002 Bacteria 967
218 Ga0307416_101917215 3300032002 Bacteria 696
219 Ga0307415_101174373 3300032126 Bacteria 722
220 Ga0307415_101252131 3300032126 Bacteria 701
221 Ga0316574_0152113 3300035398 Bacteria 1491
222 Ga0395900_0007810 3300037418 Bacteria 11027
223 Ga0395898_0030094 3300037466 Bacteria 5436
224 Ga0395898_1070681 3300037466 Bacteria 740
225 Ga0395905_0655897 3300037471 Bacteria 951
226 Ga0395901_2079480 3300038443 Bacteria 513
227 Ga0439453_0087788 3300041408 Bacteria 679
228 Ga0451789_0022496 3300041443 Bacteria 609
229 Ga0451800_0003992 3300041459 Bacteria 530
230 Ga0451802_1436040 3300041460 Bacteria 611
231 Ga0451853_2465475 3300041512 Bacteria 744
232 Ga0451853_3967593 3300041512 Bacteria 591
233 Ga0439448_0196068 3300042005 Bacteria 707
234 Ga0439455_0215368 3300042012 Bacteria 558
235 Ga0439464_0124124 3300042439 Bacteria 797
236 Ga0439440_0026737 3300042993 Bacteria 1337
237 Ga0466965_0026255 3300044683 Bacteria 2823
238 Ga0466965_0122861 3300044683 Bacteria 1342
239 Ga0466965_0205791 3300044683 Bacteria 1045
240 Ga0466965_0234959 3300044683 Bacteria 980
241 Ga0466965_0882881 3300044683 Bacteria 521
242 Ga0466966_0141631 3300044684 Bacteria 1469
243 Ga0466961_0398296 3300044693 Bacteria 836
244 Ga0466963_0046770 3300044694 Bacteria 2854
245 Ga0466963_0176355 3300044694 Bacteria 1491
246 Ga0466963_0256481 3300044694 Bacteria 1227
247 Ga0466963_0435110 3300044694 Bacteria 925
248 Ga0466963_0457610 3300044694 Bacteria 900
249 Ga0466963_0461671 3300044694 Unclassified 896
250 Ga0466964_0077155 3300044706 Bacteria 1422
251 Ga0466971_0142054 3300044719 Bacteria 1118
252 Ga0466968_0078953 3300044735 Bacteria 1443
253 Ga0466970_0658252 3300044765 Bacteria 609
254 Ga0466957_0216422 3300044842 Bacteria 1263
255 Ga0466957_0221282 3300044842 Bacteria 1250
256 Ga0466957_0248389 3300044842 Bacteria 1182
257 Ga0466957_0361144 3300044842 Unclassified 987
258 Ga0466957_1333336 3300044842 Bacteria 521
259 Ga0466959_0100456 3300045049 Bacteria 2071
260 Ga0451576_1190380 3300045051 Bacteria 796
261 Ga0466958_0084852 3300045836 Bacteria 1953
262 Ga0466958_0511300 3300045836 Bacteria 779
263 Ga0466967_0005794 3300045976 Bacteria 8641
264 Ga0466967_0049635 3300045976 Bacteria 3670
265 Ga0466967_0057891 3300045976 Bacteria 3423
266 Ga0466967_0684639 3300045976 Bacteria 1015
267 Ga0466967_0705640 3300045976 Bacteria 999
268 Ga0466967_0764411 3300045976 Bacteria 958
269 Ga0466967_0893497 3300045976 Bacteria 883
270 Ga0466967_1046089 3300045976 Bacteria 813
271 Ga0466967_1050699 3300045976 Bacteria 811
272 Ga0466967_1123673 3300045976 Bacteria 783
273 Ga0466967_1626756 3300045976 Bacteria 643
274 Ga0495603_0582157 3300046455 Bacteria 641
275 Ga0495653_0934891 3300046463 Bacteria 515
276 Ga0495584_0386404 3300046491 Bacteria 711
277 Ga0495620_0223812 3300046515 Bacteria 720
278 Ga0495637_0242447 3300046520 Bacteria 651
279 Ga0495643_0336853 3300046522 Bacteria 679
280 Ga0495598_0361607 3300046537 Bacteria 561
281 Ga0495609_0329071 3300046538 Bacteria 619
282 Ga0495659_0432881 3300046664 Bacteria 571
283 Ga0495661_0552345 3300046665 Bacteria 545
284 Ga0496100_0567382 3300048903 Bacteria 879
285 Ga0496102_0182100 3300048905 Bacteria 1980
286 Ga0496104_0708536 3300048907 Bacteria 914
287 Ga0496106_0155448 3300048909 Bacteria 1806
288 Ga0496106_1359204 3300048909 Bacteria 550
289 Ga0496107_0140494 3300048910 Bacteria 1785
290 Ga0496109_0036275 3300048912 Bacteria 4450
291 Ga0496109_0170847 3300048912 Bacteria 2039
292 Ga0496109_0281670 3300048912 Bacteria 1567
293 Ga0496109_1567429 3300048912 Bacteria 593
294 Ga0496110_0081172 3300048913 Bacteria 2891
295 Ga0496111_1230552 3300048914 Bacteria 530
296 Ga0496112_0112840 3300048915 Bacteria 2689
297 Ga0496112_0422940 3300048915 Unclassified 1271
298 Ga0496113_0352477 3300048916 Bacteria 1181
299 Ga0496113_0818360 3300048916 Unclassified 739
300 Ga0496114_0622613 3300048917 Bacteria 951
301 Ga0501317_101223 3300049533 Bacteria 520
302 Ga0501031_0040637 3300049568 Bacteria 3037
303 Ga0501031_0061359 3300049568 Bacteria 2450
304 Ga0501031_0225647 3300049568 Bacteria 1219
305 Ga0501032_0144175 3300049569 Bacteria 1568
306 Ga0501033_0881412 3300049570 Bacteria 602
307 Ga0501036_0097620 3300049572 Bacteria 2483
308 Ga0501036_0129954 3300049572 Bacteria 2127
309 Ga0501037_0283129 3300049573 Bacteria 1155
310 Ga0501038_0182350 3300049574 Bacteria 1693
311 Ga0501038_0271760 3300049574 Bacteria 1336
312 Ga0501039_0052085 3300049575 Bacteria 3167
313 Ga0501039_0134848 3300049575 Bacteria 1938
314 Ga0501040_0033965 3300049576 Bacteria 3457
315 Ga0501040_0084723 3300049576 Bacteria 2199
316 Ga0501041_0079218 3300049577 Bacteria 2022
317 Ga0501042_0051078 3300049578 Bacteria 2950
318 Ga0501042_0167051 3300049578 Bacteria 1587
319 Ga0501042_0272724 3300049578 Bacteria 1221
320 Ga0501046_0135459 3300049580 Bacteria 1866
321 Ga0501046_1138877 3300049580 Bacteria 538
322 Ga0501048_0162196 3300049582 Bacteria 1582
323 Ga0501048_0794887 3300049582 Bacteria 680
324 Ga0501068_0744649 3300049584 Bacteria 642
325 Ga0501070_1195884 3300049586 Bacteria 583
326 Ga0501071_0033407 3300049587 Bacteria 3655
327 Ga0501071_0371215 3300049587 Bacteria 1090
328 Ga0501071_1141868 3300049587 Bacteria 602
329 Ga0501071_1296728 3300049587 Bacteria 562
330 Ga0501072_0030051 3300049588 Bacteria 4247
331 Ga0501072_0075763 3300049588 Bacteria 2661
332 Ga0501072_0358925 3300049588 Bacteria 1157
333 Ga0501074_0424370 3300049590 Bacteria 943
334 Ga0501075_0027080 3300049591 Bacteria 4224
335 Ga0501075_0145773 3300049591 Bacteria 1804
336 Ga0501076_0048038 3300049592 Bacteria 3374
337 Ga0501076_0101762 3300049592 Bacteria 2316
338 Ga0501076_0158258 3300049592 Bacteria 1844
339 Ga0501076_1707519 3300049592 Bacteria 516
340 Ga0501077_0026548 3300049593 Bacteria 3675
341 Ga0501079_0658505 3300049741 Bacteria 824
342 Ga0501081_0251161 3300049743 Bacteria 1291
343 Ga0501083_0471704 3300049744 Bacteria 817
344 Ga0501035_0258034 3300049822 Bacteria 1478
345 Ga0501044_1013553 3300049823 Bacteria 702
346 Ga0501045_0052452 3300049824 Bacteria 2978
347 nmdc:mga05p37_1461809_c1 3300050507 Bacteria 683
348 nmdc:mga0qj67_648898_c1 3300050509 Bacteria 842
349 nmdc:mga08y16_478494_c1 3300050511 Bacteria 1267
350 nmdc:mga08y16_545309_c1 3300050511 Bacteria 1174
351 nmdc:mga08y16_555169_c1 3300050511 Bacteria 1162
352 nmdc:mga08y16_593128_c1 3300050511 Bacteria 1117
353 Ga0501084_0017709 3300054114 Bacteria 5927
354 Ga0501084_0198369 3300054114 Bacteria 1693
355 Ga0501082_0424604 3300060353 Bacteria 1161
356 Ga0501082_0896870 3300060353 Bacteria 775
357 Ga0530510_0077996 3300061734 Bacteria 2407
358 Ga0530510_0103936 3300061734 Bacteria 2078
359 Ga0530510_0586683 3300061734 Bacteria 847
360 Ga0530510_0670917 3300061734 Bacteria 790

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046538 Ga0495609_0329071 Ga0495609_0329071_23_328 98
2 3300044765 Ga0466970_0658252 Ga0466970_0658252_33_347 101
3 3300038443 Ga0395901_2079480 Ga0395901_2079480_136_444 102
4 3300014325 Ga0163163_10153931 Ga0163163_101539313 103
5 3300014745 Ga0157377_10942153 Ga0157377_109421532 103
6 3300025925 Ga0207650_11251488 Ga0207650_112514882 103
7 3300025945 Ga0207679_10327092 Ga0207679_103270922 103
8 3300037418 Ga0395900_0007810 Ga0395900_0007810_5664_5975 103
9 3300037466 Ga0395898_0030094 Ga0395898_0030094_1392_1703 103
10 3300037466 Ga0395898_1070681 Ga0395898_1070681_333_644 103
11 3300037471 Ga0395905_0655897 Ga0395905_0655897_28_339 103
12 3300041512 Ga0451853_3967593 Ga0451853_3967593_169_480 103
13 3300048912 Ga0496109_0170847 Ga0496109_0170847_784_1095 103
14 3300048913 Ga0496110_0081172 Ga0496110_0081172_2120_2431 103
15 3300048915 Ga0496112_0422940 Ga0496112_0422940_718_1029 103
16 3300048916 Ga0496113_0818360 Ga0496113_0818360_358_669 103
17 3300005347 Ga0070668_100213893 Ga0070668_1002138932 104
18 3300005548 Ga0070665_101986393 Ga0070665_1019863931 105
19 3300013308 Ga0157375_12150895 Ga0157375_121508952 107
20 3300035398 Ga0316574_0152113 Ga0316574_0152113_328_681 109
21 3300005329 Ga0070683_100490811 Ga0070683_1004908112 110
22 3300042439 Ga0439464_0124124 Ga0439464_0124124_193_531 111
23 3300044683 Ga0466965_0026255 Ga0466965_0026255_2459_2803 112
24 3300044694 Ga0466963_0046770 Ga0466963_0046770_2228_2566 112
25 3300049533 Ga0501317_101223 Ga0501317_101223_168_509 112
26 3300005339 Ga0070660_100239045 Ga0070660_1002390452 113
27 3300005539 Ga0068853_101689655 Ga0068853_1016896551 113
28 3300013104 Ga0157370_10732652 Ga0157370_107326522 113
29 3300005981 Ga0081538_10059045 Ga0081538_100590452 114
30 3300009553 Ga0105249_11061606 Ga0105249_110616062 114
31 3300045976 Ga0466967_1626756 Ga0466967_1626756_93_440 114
32 3300009545 Ga0105237_12402013 Ga0105237_124020131 115
33 3300025908 Ga0207643_10197117 Ga0207643_101971171 115
34 3300026023 Ga0207677_11153370 Ga0207677_111533702 115
35 3300028379 Ga0268266_11534853 Ga0268266_115348531 115
36 3300032002 Ga0307416_101917215 Ga0307416_1019172152 115
37 3300044694 Ga0466963_0435110 Ga0466963_0435110_558_905 115
38 3300044735 Ga0466968_0078953 Ga0466968_0078953_303_662 115
39 3300045976 Ga0466967_1046089 Ga0466967_1046089_388_735 115
40 3300046455 Ga0495603_0582157 Ga0495603_0582157_56_412 115
41 3300046463 Ga0495653_0934891 Ga0495653_0934891_59_406 115
42 3300048912 Ga0496109_1567429 Ga0496109_1567429_165_512 115
43 3300049568 Ga0501031_0061359 Ga0501031_0061359_358_705 115
44 3300049573 Ga0501037_0283129 Ga0501037_0283129_478_825 115
45 3300005981 Ga0081538_10060617 Ga0081538_100606173 116
46 3300044842 Ga0466957_0221282 Ga0466957_0221282_555_905 116
47 3300046520 Ga0495637_0242447 Ga0495637_0242447_35_391 116
48 3300046665 Ga0495661_0552345 Ga0495661_0552345_60_416 116
49 3300049568 Ga0501031_0040637 Ga0501031_0040637_975_1352 116
50 3300049568 Ga0501031_0225647 Ga0501031_0225647_43_420 116
51 3300049569 Ga0501032_0144175 Ga0501032_0144175_158_535 116
52 3300049570 Ga0501033_0881412 Ga0501033_0881412_153_503 116
53 3300049572 Ga0501036_0097620 Ga0501036_0097620_1840_2217 116
54 3300049572 Ga0501036_0129954 Ga0501036_0129954_871_1221 116
55 3300049574 Ga0501038_0271760 Ga0501038_0271760_37_414 116
56 3300049575 Ga0501039_0052085 Ga0501039_0052085_103_453 116
57 3300049575 Ga0501039_0134848 Ga0501039_0134848_544_921 116
58 3300049576 Ga0501040_0033965 Ga0501040_0033965_1280_1657 116
59 3300049576 Ga0501040_0084723 Ga0501040_0084723_1634_2011 116
60 3300049577 Ga0501041_0079218 Ga0501041_0079218_1630_1980 116
61 3300049578 Ga0501042_0051078 Ga0501042_0051078_208_558 116
62 3300049578 Ga0501042_0167051 Ga0501042_0167051_190_567 116
63 3300049578 Ga0501042_0272724 Ga0501042_0272724_282_659 116
64 3300049580 Ga0501046_0135459 Ga0501046_0135459_736_1086 116
65 3300049582 Ga0501048_0162196 Ga0501048_0162196_367_744 116
66 3300049582 Ga0501048_0794887 Ga0501048_0794887_302_652 116
67 3300049584 Ga0501068_0744649 Ga0501068_0744649_10_387 116
68 3300049586 Ga0501070_1195884 Ga0501070_1195884_83_460 116
69 3300049587 Ga0501071_0033407 Ga0501071_0033407_1396_1773 116
70 3300049587 Ga0501071_0371215 Ga0501071_0371215_75_452 116
71 3300049587 Ga0501071_1296728 Ga0501071_1296728_155_505 116
72 3300049588 Ga0501072_0030051 Ga0501072_0030051_2058_2435 116
73 3300049588 Ga0501072_0075763 Ga0501072_0075763_2250_2627 116
74 3300049590 Ga0501074_0424370 Ga0501074_0424370_401_778 116
75 3300049591 Ga0501075_0027080 Ga0501075_0027080_3144_3494 116
76 3300049591 Ga0501075_0145773 Ga0501075_0145773_1271_1648 116
77 3300049592 Ga0501076_0048038 Ga0501076_0048038_2324_2674 116
78 3300049592 Ga0501076_0101762 Ga0501076_0101762_925_1302 116
79 3300049592 Ga0501076_1707519 Ga0501076_1707519_92_469 116
80 3300049593 Ga0501077_0026548 Ga0501077_0026548_3004_3381 116
81 3300049741 Ga0501079_0658505 Ga0501079_0658505_413_790 116
82 3300049743 Ga0501081_0251161 Ga0501081_0251161_29_406 116
83 3300049744 Ga0501083_0471704 Ga0501083_0471704_165_542 116
84 3300049822 Ga0501035_0258034 Ga0501035_0258034_197_574 116
85 3300049823 Ga0501044_1013553 Ga0501044_1013553_206_583 116
86 3300049824 Ga0501045_0052452 Ga0501045_0052452_410_787 116
87 3300054114 Ga0501084_0017709 Ga0501084_0017709_543_920 116
88 3300054114 Ga0501084_0198369 Ga0501084_0198369_754_1131 116
89 3300060353 Ga0501082_0424604 Ga0501082_0424604_749_1099 116
90 3300060353 Ga0501082_0896870 Ga0501082_0896870_148_525 116
91 3300061734 Ga0530510_0077996 Ga0530510_0077996_1884_2261 116
92 3300061734 Ga0530510_0103936 Ga0530510_0103936_129_506 116
93 3300061734 Ga0530510_0670917 Ga0530510_0670917_348_725 116
94 3300005329 Ga0070683_100036434 Ga0070683_1000364345 117
95 3300005329 Ga0070683_100580308 Ga0070683_1005803082 117
96 3300005330 Ga0070690_100233183 Ga0070690_1002331831 117
97 3300005337 Ga0070682_100482074 Ga0070682_1004820742 117
98 3300005338 Ga0068868_100051517 Ga0068868_1000515173 117
99 3300005338 Ga0068868_100875881 Ga0068868_1008758812 117
100 3300005339 Ga0070660_100354962 Ga0070660_1003549622 117
101 3300005341 Ga0070691_10170047 Ga0070691_101700472 117
102 3300005344 Ga0070661_100264414 Ga0070661_1002644142 117
103 3300005345 Ga0070692_10176584 Ga0070692_101765842 117
104 3300005347 Ga0070668_100239335 Ga0070668_1002393352 117
105 3300005347 Ga0070668_101537516 Ga0070668_1015375162 117
106 3300005441 Ga0070700_100025508 Ga0070700_1000255084 117
107 3300005444 Ga0070694_101131968 Ga0070694_1011319682 117
108 3300005457 Ga0070662_100109120 Ga0070662_1001091203 117
109 3300005535 Ga0070684_100292563 Ga0070684_1002925632 117
110 3300005535 Ga0070684_100495791 Ga0070684_1004957912 117
111 3300005535 Ga0070684_100613832 Ga0070684_1006138322 117
112 3300005535 Ga0070684_100653611 Ga0070684_1006536111 117
113 3300005535 Ga0070684_101875690 Ga0070684_1018756901 117
114 3300005549 Ga0070704_100375888 Ga0070704_1003758882 117
115 3300005549 Ga0070704_101671680 Ga0070704_1016716801 117
116 3300005564 Ga0070664_101223420 Ga0070664_1012234202 117
117 3300005718 Ga0068866_10050761 Ga0068866_100507612 117
118 3300005719 Ga0068861_100054319 Ga0068861_1000543192 117
119 3300005840 Ga0068870_10286952 Ga0068870_102869522 117
120 3300005842 Ga0068858_100839537 Ga0068858_1008395372 117
121 3300005843 Ga0068860_100372126 Ga0068860_1003721262 117
122 3300005985 Ga0081539_10279800 Ga0081539_102798002 117
123 3300006881 Ga0068865_100177950 Ga0068865_1001779502 117
124 3300009093 Ga0105240_11730928 Ga0105240_117309282 117
125 3300009094 Ga0111539_13052893 Ga0111539_130528931 117
126 3300009098 Ga0105245_10013848 Ga0105245_100138485 117
127 3300009098 Ga0105245_10500424 Ga0105245_105004242 117
128 3300009098 Ga0105245_10728184 Ga0105245_107281842 117
129 3300009147 Ga0114129_11870059 Ga0114129_118700591 117
130 3300009148 Ga0105243_10588010 Ga0105243_105880101 117
131 3300009176 Ga0105242_10422469 Ga0105242_104224691 117
132 3300009176 Ga0105242_10951773 Ga0105242_109517732 117
133 3300011119 Ga0105246_10241310 Ga0105246_102413102 117
134 3300013296 Ga0157374_11121154 Ga0157374_111211542 117
135 3300013307 Ga0157372_10870595 Ga0157372_108705952 117
136 3300014325 Ga0163163_11222845 Ga0163163_112228452 117
137 3300014326 Ga0157380_10182821 Ga0157380_101828212 117
138 3300014745 Ga0157377_11534260 Ga0157377_115342601 117
139 3300020078 Ga0206352_10807627 Ga0206352_108076271 117
140 3300025899 Ga0207642_10070110 Ga0207642_100701102 117
141 3300025899 Ga0207642_10982932 Ga0207642_109829322 117
142 3300025900 Ga0207710_10389337 Ga0207710_103893371 117
143 3300025907 Ga0207645_10164502 Ga0207645_101645022 117
144 3300025918 Ga0207662_10007952 Ga0207662_100079523 117
145 3300025919 Ga0207657_10198312 Ga0207657_101983122 117
146 3300025920 Ga0207649_10805196 Ga0207649_108051962 117
147 3300025921 Ga0207652_11487480 Ga0207652_114874801 117
148 3300025927 Ga0207687_10559070 Ga0207687_105590702 117
149 3300025933 Ga0207706_10075832 Ga0207706_100758324 117
150 3300025934 Ga0207686_11176357 Ga0207686_111763572 117
151 3300025935 Ga0207709_10087276 Ga0207709_100872762 117
152 3300025935 Ga0207709_10259028 Ga0207709_102590282 117
153 3300025937 Ga0207669_10099501 Ga0207669_100995012 117
154 3300025942 Ga0207689_11000448 Ga0207689_110004481 117
155 3300025972 Ga0207668_10273036 Ga0207668_102730361 117
156 3300026023 Ga0207677_11104210 Ga0207677_111042102 117
157 3300026075 Ga0207708_10484872 Ga0207708_104848722 117
158 3300026118 Ga0207675_100052980 Ga0207675_1000529803 117
159 3300031995 Ga0307409_101582406 Ga0307409_1015824062 117
160 3300031995 Ga0307409_101958745 Ga0307409_1019587452 117
161 3300031995 Ga0307409_102094737 Ga0307409_1020947372 117
162 3300032002 Ga0307416_100937234 Ga0307416_1009372342 117
163 3300032126 Ga0307415_101174373 Ga0307415_1011743732 117
164 3300032126 Ga0307415_101252131 Ga0307415_1012521312 117
165 3300042012 Ga0439455_0215368 Ga0439455_0215368_159_512 117
166 3300044683 Ga0466965_0122861 Ga0466965_0122861_664_1017 117
167 3300044683 Ga0466965_0205791 Ga0466965_0205791_56_409 117
168 3300044683 Ga0466965_0234959 Ga0466965_0234959_513_875 117
169 3300044683 Ga0466965_0882881 Ga0466965_0882881_81_434 117
170 3300044694 Ga0466963_0176355 Ga0466963_0176355_365_718 117
171 3300044694 Ga0466963_0256481 Ga0466963_0256481_132_485 117
172 3300044694 Ga0466963_0457610 Ga0466963_0457610_57_410 117
173 3300044706 Ga0466964_0077155 Ga0466964_0077155_30_383 117
174 3300044719 Ga0466971_0142054 Ga0466971_0142054_545_898 117
175 3300044842 Ga0466957_0216422 Ga0466957_0216422_328_690 117
176 3300044842 Ga0466957_0248389 Ga0466957_0248389_200_553 117
177 3300044842 Ga0466957_1333336 Ga0466957_1333336_119_472 117
178 3300045836 Ga0466958_0511300 Ga0466958_0511300_161_514 117
179 3300045976 Ga0466967_0049635 Ga0466967_0049635_1175_1528 117
180 3300045976 Ga0466967_0057891 Ga0466967_0057891_280_633 117
181 3300045976 Ga0466967_0684639 Ga0466967_0684639_205_564 117
182 3300045976 Ga0466967_0764411 Ga0466967_0764411_17_370 117
183 3300045976 Ga0466967_0893497 Ga0466967_0893497_251_607 117
184 3300045976 Ga0466967_1050699 Ga0466967_1050699_297_650 117
185 3300045976 Ga0466967_1123673 Ga0466967_1123673_344_700 117
186 3300048903 Ga0496100_0567382 Ga0496100_0567382_78_434 117
187 3300048905 Ga0496102_0182100 Ga0496102_0182100_1089_1445 117
188 3300048909 Ga0496106_0155448 Ga0496106_0155448_121_477 117
189 3300048910 Ga0496107_0140494 Ga0496107_0140494_505_861 117
190 3300048912 Ga0496109_0036275 Ga0496109_0036275_2269_2634 117
191 3300048914 Ga0496111_1230552 Ga0496111_1230552_21_377 117
192 3300048915 Ga0496112_0112840 Ga0496112_0112840_1416_1769 117
193 3300049574 Ga0501038_0182350 Ga0501038_0182350_638_1018 117
194 3300049587 Ga0501071_1141868 Ga0501071_1141868_63_416 117
195 3300049592 Ga0501076_0158258 Ga0501076_0158258_1263_1643 117
196 3300005330 Ga0070690_101527351 Ga0070690_1015273511 118
197 3300005341 Ga0070691_10734698 Ga0070691_107346982 118
198 3300005354 Ga0070675_101230002 Ga0070675_1012300021 118
199 3300005441 Ga0070700_100305212 Ga0070700_1003052122 118
200 3300005456 Ga0070678_100161520 Ga0070678_1001615202 118
201 3300005459 Ga0068867_100052280 Ga0068867_1000522803 118
202 3300005535 Ga0070684_100990791 Ga0070684_1009907911 118
203 3300005546 Ga0070696_100396280 Ga0070696_1003962801 118
204 3300005564 Ga0070664_101422873 Ga0070664_1014228731 118
205 3300005983 Ga0081540_1144834 Ga0081540_11448342 118
206 3300006028 Ga0070717_10000006 Ga0070717_10000006104 118
207 3300006871 Ga0075434_101497983 Ga0075434_1014979831 118
208 3300009094 Ga0111539_11283538 Ga0111539_112835381 118
209 3300009147 Ga0114129_11513360 Ga0114129_115133601 118
210 3300009148 Ga0105243_11701078 Ga0105243_117010782 118
211 3300009553 Ga0105249_10671080 Ga0105249_106710802 118
212 3300014326 Ga0157380_10090101 Ga0157380_100901013 118
213 3300014969 Ga0157376_10492372 Ga0157376_104923721 118
214 3300020082 Ga0206353_11802316 Ga0206353_118023161 118
215 3300025923 Ga0207681_10648989 Ga0207681_106489892 118
216 3300025929 Ga0207664_10022995 Ga0207664_100229954 118
217 3300025938 Ga0207704_10474460 Ga0207704_104744602 118
218 3300025941 Ga0207711_11157321 Ga0207711_111573212 118
219 3300025945 Ga0207679_10433359 Ga0207679_104333592 118
220 3300025961 Ga0207712_10634941 Ga0207712_106349412 118
221 3300026023 Ga0207677_10459597 Ga0207677_104595971 118
222 3300026075 Ga0207708_10003012 Ga0207708_100030127 118
223 3300026118 Ga0207675_100130373 Ga0207675_1001303732 118
224 3300026121 Ga0207683_10090481 Ga0207683_100904813 118
225 3300026142 Ga0207698_10486563 Ga0207698_104865632 118
226 3300028380 Ga0268265_10243435 Ga0268265_102434352 118
227 3300031731 Ga0307405_10667704 Ga0307405_106677042 118
228 3300031995 Ga0307409_102698103 Ga0307409_1026981031 118
229 3300041408 Ga0439453_0087788 Ga0439453_0087788_248_607 118
230 3300041459 Ga0451800_0003992 Ga0451800_0003992_19_378 118
231 3300041512 Ga0451853_2465475 Ga0451853_2465475_337_693 118
232 3300042005 Ga0439448_0196068 Ga0439448_0196068_196_555 118
233 3300042993 Ga0439440_0026737 Ga0439440_0026737_517_876 118
234 3300044693 Ga0466961_0398296 Ga0466961_0398296_73_456 118
235 3300045976 Ga0466967_0005794 Ga0466967_0005794_4064_4426 118
236 3300049580 Ga0501046_1138877 Ga0501046_1138877_80_463 118
237 3300049588 Ga0501072_0358925 Ga0501072_0358925_753_1109 118
238 3300050511 nmdc:mga08y16_478494_c1 nmdc:mga08y16_478494_c1_354_713 118
239 3300050511 nmdc:mga08y16_545309_c1 nmdc:mga08y16_545309_c1_799_1158 118
240 3300061734 Ga0530510_0586683 Ga0530510_0586683_279_635 118
241 3300005327 Ga0070658_10498546 Ga0070658_104985462 119
242 3300005327 Ga0070658_10631859 Ga0070658_106318591 119
243 3300005329 Ga0070683_100046234 Ga0070683_1000462345 119
244 3300005329 Ga0070683_101804891 Ga0070683_1018048911 119
245 3300005337 Ga0070682_100105141 Ga0070682_1001051412 119
246 3300005343 Ga0070687_101542653 Ga0070687_1015426531 119
247 3300005347 Ga0070668_100296483 Ga0070668_1002964832 119
248 3300005355 Ga0070671_100572688 Ga0070671_1005726882 119
249 3300005356 Ga0070674_100765860 Ga0070674_1007658601 119
250 3300005366 Ga0070659_100294536 Ga0070659_1002945362 119
251 3300005366 Ga0070659_100326921 Ga0070659_1003269212 119
252 3300005366 Ga0070659_101747877 Ga0070659_1017478771 119
253 3300005437 Ga0070710_10000002 Ga0070710_10000002155 119
254 3300005441 Ga0070700_100589814 Ga0070700_1005898142 119
255 3300005456 Ga0070678_100039327 Ga0070678_1000393273 119
256 3300005457 Ga0070662_100410479 Ga0070662_1004104792 119
257 3300005459 Ga0068867_100313530 Ga0068867_1003135302 119
258 3300005543 Ga0070672_100130656 Ga0070672_1001306562 119
259 3300005544 Ga0070686_101126856 Ga0070686_1011268561 119
260 3300005547 Ga0070693_100524505 Ga0070693_1005245051 119
261 3300005548 Ga0070665_100254564 Ga0070665_1002545642 119
262 3300005983 Ga0081540_1130936 Ga0081540_11309361 119
263 3300005985 Ga0081539_10001190 Ga0081539_1000119011 119
264 3300006038 Ga0075365_10303088 Ga0075365_103030882 119
265 3300006844 Ga0075428_100727463 Ga0075428_1007274632 119
266 3300009094 Ga0111539_10413993 Ga0111539_104139933 119
267 3300009098 Ga0105245_10157559 Ga0105245_101575592 119
268 3300009098 Ga0105245_10581030 Ga0105245_105810302 119
269 3300009098 Ga0105245_11509436 Ga0105245_115094362 119
270 3300009101 Ga0105247_11375023 Ga0105247_113750232 119
271 3300009148 Ga0105243_10110957 Ga0105243_101109573 119
272 3300009176 Ga0105242_10544957 Ga0105242_105449572 119
273 3300009177 Ga0105248_11326868 Ga0105248_113268682 119
274 3300010375 Ga0105239_10529135 Ga0105239_105291352 119
275 3300010375 Ga0105239_11703050 Ga0105239_117030502 119
276 3300011119 Ga0105246_10018236 Ga0105246_100182364 119
277 3300013105 Ga0157369_12679420 Ga0157369_126794201 119
278 3300013306 Ga0163162_10694865 Ga0163162_106948652 119
279 3300013306 Ga0163162_12509743 Ga0163162_125097432 119
280 3300013307 Ga0157372_10342639 Ga0157372_103426392 119
281 3300013307 Ga0157372_10635550 Ga0157372_106355502 119
282 3300014326 Ga0157380_10283742 Ga0157380_102837422 119
283 3300014326 Ga0157380_10768658 Ga0157380_107686582 119
284 3300014745 Ga0157377_10458421 Ga0157377_104584212 119
285 3300014968 Ga0157379_10570564 Ga0157379_105705642 119
286 3300020077 Ga0206351_10679669 Ga0206351_106796691 119
287 3300025321 Ga0207656_10274097 Ga0207656_102740972 119
288 3300025898 Ga0207692_10000005 Ga0207692_1000000556 119
289 3300025899 Ga0207642_10563275 Ga0207642_105632752 119
290 3300025899 Ga0207642_10721552 Ga0207642_107215522 119
291 3300025909 Ga0207705_10346139 Ga0207705_103461392 119
292 3300025912 Ga0207707_10887774 Ga0207707_108877741 119
293 3300025912 Ga0207707_11341511 Ga0207707_113415111 119
294 3300025913 Ga0207695_11587403 Ga0207695_115874031 119
295 3300025918 Ga0207662_10155307 Ga0207662_101553072 119
296 3300025919 Ga0207657_11116248 Ga0207657_111162481 119
297 3300025927 Ga0207687_10502204 Ga0207687_105022042 119
298 3300025927 Ga0207687_10506270 Ga0207687_105062702 119
299 3300025932 Ga0207690_10178880 Ga0207690_101788802 119
300 3300025932 Ga0207690_10491908 Ga0207690_104919081 119
301 3300025932 Ga0207690_10510946 Ga0207690_105109462 119
302 3300025935 Ga0207709_11155406 Ga0207709_111554062 119
303 3300025937 Ga0207669_10096920 Ga0207669_100969202 119
304 3300025937 Ga0207669_10251251 Ga0207669_102512512 119
305 3300025937 Ga0207669_11169079 Ga0207669_111690791 119
306 3300025940 Ga0207691_10354931 Ga0207691_103549312 119
307 3300025944 Ga0207661_10693399 Ga0207661_106933992 119
308 3300025944 Ga0207661_10906650 Ga0207661_109066502 119
309 3300025972 Ga0207668_10476138 Ga0207668_104761382 119
310 3300026035 Ga0207703_11692005 Ga0207703_116920051 119
311 3300026041 Ga0207639_11560480 Ga0207639_115604801 119
312 3300026067 Ga0207678_10333014 Ga0207678_103330142 119
313 3300026067 Ga0207678_10642768 Ga0207678_106427682 119
314 3300026075 Ga0207708_10181155 Ga0207708_101811552 119
315 3300026089 Ga0207648_10444942 Ga0207648_104449421 119
316 3300026121 Ga0207683_10450372 Ga0207683_104503722 119
317 3300026142 Ga0207698_10175974 Ga0207698_101759742 119
318 3300028379 Ga0268266_11030627 Ga0268266_110306271 119
319 3300028558 Ga0265326_10000017 Ga0265326_1000001763 119
320 3300028573 Ga0265334_10000029 Ga0265334_1000002931 119
321 3300028666 Ga0265336_10018880 Ga0265336_100188803 119
322 3300028800 Ga0265338_10022616 Ga0265338_100226164 119
323 3300029957 Ga0265324_10001650 Ga0265324_1000165012 119
324 3300031247 Ga0265340_10315632 Ga0265340_103156321 119
325 3300031711 Ga0265314_10197021 Ga0265314_101970212 119
326 3300031731 Ga0307405_10429791 Ga0307405_104297912 119
327 3300031824 Ga0307413_10578332 Ga0307413_105783322 119
328 3300031852 Ga0307410_10586446 Ga0307410_105864461 119
329 3300031852 Ga0307410_10605995 Ga0307410_106059952 119
330 3300031901 Ga0307406_10327150 Ga0307406_103271502 119
331 3300031995 Ga0307409_100190578 Ga0307409_1001905782 119
332 3300031995 Ga0307409_100744044 Ga0307409_1007440442 119
333 3300032002 Ga0307416_100292301 Ga0307416_1002923012 119
334 3300041443 Ga0451789_0022496 Ga0451789_0022496_129_497 119
335 3300041460 Ga0451802_1436040 Ga0451802_1436040_11_373 119
336 3300044684 Ga0466966_0141631 Ga0466966_0141631_969_1337 119
337 3300044694 Ga0466963_0461671 Ga0466963_0461671_262_630 119
338 3300044842 Ga0466957_0361144 Ga0466957_0361144_382_750 119
339 3300045049 Ga0466959_0100456 Ga0466959_0100456_202_570 119
340 3300045051 Ga0451576_1190380 Ga0451576_1190380_113_472 119
341 3300045836 Ga0466958_0084852 Ga0466958_0084852_238_606 119
342 3300045976 Ga0466967_0705640 Ga0466967_0705640_392_754 119
343 3300046491 Ga0495584_0386404 Ga0495584_0386404_295_663 119
344 3300046515 Ga0495620_0223812 Ga0495620_0223812_301_663 119
345 3300046522 Ga0495643_0336853 Ga0495643_0336853_47_409 119
346 3300046537 Ga0495598_0361607 Ga0495598_0361607_134_496 119
347 3300046664 Ga0495659_0432881 Ga0495659_0432881_15_383 119
348 3300048907 Ga0496104_0708536 Ga0496104_0708536_471_845 119
349 3300048909 Ga0496106_1359204 Ga0496106_1359204_81_449 119
350 3300048912 Ga0496109_0281670 Ga0496109_0281670_367_729 119
351 3300048916 Ga0496113_0352477 Ga0496113_0352477_591_959 119
352 3300048917 Ga0496114_0622613 Ga0496114_0622613_534_896 119
353 3300050507 nmdc:mga05p37_1461809_c1 nmdc:mga05p37_1461809_c1_233_595 119
354 3300050509 nmdc:mga0qj67_648898_c1 nmdc:mga0qj67_648898_c1_98_460 119
355 3300050511 nmdc:mga08y16_555169_c1 nmdc:mga08y16_555169_c1_758_1120 119
356 3300050511 nmdc:mga08y16_593128_c1 nmdc:mga08y16_593128_c1_190_552 119
357 3300003373 JGI25407J50210_10189713 JGI25407J50210_101897131 120
358 3300005981 Ga0081538_10010704 Ga0081538_1001070411 120
359 3300005981 Ga0081538_10131141 Ga0081538_101311412 120
360 3300005981 Ga0081538_10326243 Ga0081538_103262431 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

28

117

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a5n-assembly2.cif.gz_D redoxregulator hypr in its reduced form 0.9403 6 97
4a5m-assembly1.cif.gz_B redox regulator hypr in its oxidized form 0.9398 6 97
7kd3-assembly1.cif.gz_A structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 0.9328 3 100
7bze-assembly1.cif.gz_A-2 structure of bacillus subtilis hxlr, k13a mutant 0.9215 4 100
4hqe-assembly1.cif.gz_A the crystal structure of qsrr-dna complex 0.9148 6 99
ID Description Score Start End Superfamily
af_P32349_45_122_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9044 23 77 1.10.10.10
af_P9WMG3_11_158_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9022 7 108 1.10.10.10
af_Q2FVB5_3_147_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8928 21 97 1.10.10.10
4nb5B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8907 33 79 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8893 23 81 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7V9VSS9-F1-model_v4 deleted 0.9725 3 99
AF-A0A7M2Z0Z6-F1-model_v4 HxlR-type transcriptional regulator 0.9724 4 100 GO:0003677
AF-A0A2S4IA84-F1-model_v4 HTH hxlR-type domain-containing protein 0.966 6 97 GO:0003677
AF-A0A2W6D9V6-F1-model_v4 Transcriptional regulator 0.9628 1 100 GO:0003677
AF-M8DFD4-F1-model_v4 Transcriptional repressor 0.9622 6 99 GO:0003677

Feature Viewer

pLDDT pTM Quality
87.9 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map