F421895

General Info

Members Datasets Scaffolds Average Seq Length
360 202 720 106

Family's Representative Sequence

Representative Sequence 3300025911|Ga0207654_10312854|Ga0207654_103128543
Length 121
Sequence MSAQDVAAPIAVWRRCLNNVGVALATFLLRASFIVFVDPHRFPHWFRQSLKYVPPSVLAAIVTPGLFMSGGAIDVSRDAYPRIAAGLVAIVASFHVRNTMAAIVTGMATLWALQWMLGRFA

Samples

Sample ID Description Type Environment
1 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
154 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
155 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
192 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5
Nodule 0
Rhizoplane 0.56
Rhizosphere 94.17
Stem 0
Stem Tuber 0
Unclassified 7.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207654_10312854 3300025911 Unclassified 1071
2 Ga0065712_10103519 3300005290 Bacteria 1983
3 Ga0070658_10049647 3300005327 Bacteria 3400
4 Ga0070658_10509614 3300005327 Bacteria 1040
5 Ga0070683_100153322 3300005329 Bacteria 2185
6 Ga0070683_100380771 3300005329 Bacteria 1344
7 Ga0070690_100235639 3300005330 Bacteria 1289
8 Ga0070690_100878276 3300005330 Bacteria 700
9 Ga0070677_10730069 3300005333 Unclassified 560
10 Ga0068869_100342605 3300005334 Bacteria 1217
11 Ga0068869_100610526 3300005334 Bacteria 922
12 Ga0068869_101008264 3300005334 Bacteria 725
13 Ga0070680_100031950 3300005336 Bacteria 4234
14 Ga0070680_100292735 3300005336 Bacteria 1380
15 Ga0070680_100763909 3300005336 Unclassified 832
16 Ga0068868_100017934 3300005338 Bacteria 5281
17 Ga0070660_100446777 3300005339 Bacteria 1072
18 Ga0070660_100774767 3300005339 Bacteria 806
19 Ga0070689_100516553 3300005340 Bacteria 1025
20 Ga0070689_100956633 3300005340 Bacteria 760
21 Ga0070687_100085083 3300005343 Unclassified 1735
22 Ga0070687_100136622 3300005343 Bacteria 1422
23 Ga0070687_101026018 3300005343 Bacteria 599
24 Ga0070661_100256428 3300005344 Unclassified 1351
25 Ga0070661_100310914 3300005344 Bacteria 1229
26 Ga0070661_100552951 3300005344 Bacteria 926
27 Ga0070661_100864448 3300005344 Bacteria 745
28 Ga0070692_10136904 3300005345 Bacteria 1382
29 Ga0070692_10884558 3300005345 Bacteria 616
30 Ga0070675_100117185 3300005354 Bacteria 2260
31 Ga0070671_100181663 3300005355 Bacteria 1781
32 Ga0070674_101171156 3300005356 Bacteria 681
33 Ga0070673_100337342 3300005364 Bacteria 1335
34 Ga0070673_100354456 3300005364 Unclassified 1303
35 Ga0070673_101444999 3300005364 Bacteria 648
36 Ga0070659_100065443 3300005366 Bacteria 2879
37 Ga0070709_10793142 3300005434 Bacteria 743
38 Ga0070714_100955040 3300005435 Bacteria 833
39 Ga0070714_101750962 3300005435 Bacteria 607
40 Ga0070714_101969467 3300005435 Bacteria 570
41 Ga0070714_102492184 3300005435 Unclassified 502
42 Ga0070701_10008256 3300005438 Bacteria 4494
43 Ga0070701_10376298 3300005438 Bacteria 894
44 Ga0070705_100321578 3300005440 Bacteria 1117
45 Ga0070705_100717567 3300005440 Bacteria 787
46 Ga0070705_101077191 3300005440 Bacteria 656
47 Ga0070700_101237350 3300005441 Unclassified 625
48 Ga0070694_101268149 3300005444 Bacteria 619
49 Ga0070663_101019954 3300005455 Bacteria 720
50 Ga0070678_100363764 3300005456 Bacteria 1247
51 Ga0070678_100520776 3300005456 Bacteria 1052
52 Ga0070681_10056966 3300005458 Bacteria 3888
53 Ga0070681_10280612 3300005458 Bacteria 1576
54 Ga0068867_100138668 3300005459 Bacteria 1899
55 Ga0068867_102368864 3300005459 Bacteria 505
56 Ga0070685_10519588 3300005466 Bacteria 845
57 Ga0070698_100168487 3300005471 Bacteria 2132
58 Ga0070679_100017639 3300005530 Bacteria 6910
59 Ga0070679_100075491 3300005530 Bacteria 3360
60 Ga0070679_101231506 3300005530 Bacteria 694
61 Ga0070684_100160075 3300005535 Bacteria 2042
62 Ga0070684_100198027 3300005535 Bacteria 1829
63 Ga0070684_100539468 3300005535 Unclassified 1082
64 Ga0070684_100845314 3300005535 Bacteria 857
65 Ga0070697_101307360 3300005536 Unclassified 647
66 Ga0068853_100017264 3300005539 Bacteria 5956
67 Ga0068853_100167914 3300005539 Bacteria 1984
68 Ga0068853_100215887 3300005539 Bacteria 1750
69 Ga0068853_100482088 3300005539 Unclassified 1169
70 Ga0070686_101257969 3300005544 Bacteria 617
71 Ga0070696_101286431 3300005546 Bacteria 620
72 Ga0070693_100012736 3300005547 Bacteria 4264
73 Ga0070693_101341917 3300005547 Bacteria 554
74 Ga0070665_100054234 3300005548 Bacteria 4021
75 Ga0070665_100075331 3300005548 Bacteria 3381
76 Ga0070704_100038995 3300005549 Bacteria 3258
77 Ga0070704_100185086 3300005549 Bacteria 1669
78 Ga0068855_100018124 3300005563 Bacteria 8461
79 Ga0068855_100018542 3300005563 Bacteria 8368
80 Ga0068855_100028313 3300005563 Bacteria 6701
81 Ga0068855_100033076 3300005563 Bacteria 6174
82 Ga0068855_100038425 3300005563 Bacteria 5687
83 Ga0068855_100483270 3300005563 Bacteria 1348
84 Ga0068855_101279319 3300005563 Bacteria 760
85 Ga0070664_100315779 3300005564 Unclassified 1415
86 Ga0068856_100060367 3300005614 Bacteria 3746
87 Ga0068856_102123579 3300005614 Bacteria 571
88 Ga0070702_100143275 3300005615 Bacteria 1525
89 Ga0070702_101465752 3300005615 Bacteria 560
90 Ga0068852_100000823 3300005616 Bacteria 20478
91 Ga0068852_100005931 3300005616 Bacteria 8784
92 Ga0068852_100046801 3300005616 Bacteria 3687
93 Ga0068852_102503505 3300005616 Bacteria 536
94 Ga0068859_100013054 3300005617 Bacteria 8347
95 Ga0068859_100420281 3300005617 Bacteria 1433
96 Ga0068859_100450219 3300005617 Bacteria 1384
97 Ga0068864_101046240 3300005618 Bacteria 811
98 Ga0068864_102286771 3300005618 Bacteria 547
99 Ga0068866_11104037 3300005718 Bacteria 568
100 Ga0068861_100099026 3300005719 Bacteria 2315
101 Ga0068861_102452061 3300005719 Bacteria 525
102 Ga0068851_10003721 3300005834 Bacteria 6810
103 Ga0068851_10343177 3300005834 Bacteria 867
104 Ga0068851_10470303 3300005834 Unclassified 750
105 Ga0068858_100025891 3300005842 Bacteria 5456
106 Ga0068858_100571192 3300005842 Bacteria 1096
107 Ga0068858_100775351 3300005842 Bacteria 935
108 Ga0068858_101062651 3300005842 Bacteria 794
109 Ga0068858_101462237 3300005842 Bacteria 674
110 Ga0068860_100144559 3300005843 Bacteria 2288
111 Ga0075364_10014535 3300006051 Bacteria 4866
112 Ga0075364_10347982 3300006051 Bacteria 1010
113 Ga0075364_11062659 3300006051 Bacteria 550
114 Ga0070715_10700038 3300006163 Bacteria 605
115 Ga0075367_10201701 3300006178 Bacteria 1243
116 Ga0075369_10001387 3300006186 Bacteria 8262
117 Ga0075366_10000908 3300006195 Bacteria 14344
118 Ga0075366_10011888 3300006195 Bacteria 4926
119 Ga0075366_10081826 3300006195 Bacteria 1929
120 Ga0097621_100052522 3300006237 Bacteria 3321
121 Ga0097621_100073114 3300006237 Bacteria 2838
122 Ga0097621_100076406 3300006237 Bacteria 2778
123 Ga0097621_100362817 3300006237 Archaea 1291
124 Ga0097621_100757945 3300006237 Bacteria 897
125 Ga0075370_10141268 3300006353 Bacteria 1408
126 Ga0068871_100009669 3300006358 Bacteria 7001
127 Ga0068871_100016657 3300006358 Bacteria 5544
128 Ga0068871_100433107 3300006358 Bacteria 1176
129 Ga0075434_100912208 3300006871 Bacteria 893
130 Ga0075429_100206438 3300006880 Bacteria 1721
131 Ga0068865_102163789 3300006881 Unclassified 506
132 Ga0075436_100063834 3300006914 Bacteria 2545
133 Ga0097620_100013054 3300006931 Bacteria 8347
134 Ga0097620_100420288 3300006931 Bacteria 1433
135 Ga0097620_100450237 3300006931 Bacteria 1384
136 Ga0075435_100424604 3300007076 Unclassified 1145
137 Ga0075435_100454829 3300007076 Bacteria 1104
138 Ga0105240_10019043 3300009093 Bacteria 9181
139 Ga0105240_10026838 3300009093 Bacteria 7553
140 Ga0105240_10041414 3300009093 Bacteria 5878
141 Ga0105240_10291161 3300009093 Bacteria 1872
142 Ga0105240_11159278 3300009093 Bacteria 820
143 Ga0105245_10072355 3300009098 Bacteria 3132
144 Ga0105245_10497632 3300009098 Bacteria 1235
145 Ga0105245_11299107 3300009098 Bacteria 776
146 Ga0105243_10620286 3300009148 Bacteria 1044
147 Ga0105243_11458501 3300009148 Bacteria 707
148 Ga0105241_10015862 3300009174 Bacteria 5519
149 Ga0105241_11423412 3300009174 Bacteria 664
150 Ga0105242_10030460 3300009176 Bacteria 4308
151 Ga0105242_10262381 3300009176 Bacteria 1561
152 Ga0105242_10812534 3300009176 Bacteria 927
153 Ga0105242_11996887 3300009176 Bacteria 622
154 Ga0105248_10126010 3300009177 Bacteria 2889
155 Ga0105248_10860876 3300009177 Bacteria 1023
156 Ga0105248_11985520 3300009177 Bacteria 661
157 Ga0105238_10014725 3300009551 Bacteria 7908
158 Ga0105238_10038040 3300009551 Bacteria 4889
159 Ga0105238_10050204 3300009551 Bacteria 4199
160 Ga0105238_10525184 3300009551 Bacteria 1186
161 Ga0105238_11015620 3300009551 Bacteria 850
162 Ga0105238_11457598 3300009551 Unclassified 712
163 Ga0105238_12599523 3300009551 Unclassified 542
164 Ga0105249_10205628 3300009553 Bacteria 1929
165 Ga0105249_10679848 3300009553 Bacteria 1088
166 Ga0157370_10008428 3300013104 Bacteria 11115
167 Ga0157370_10615782 3300013104 Bacteria 993
168 Ga0157369_10357819 3300013105 Bacteria 1516
169 Ga0157369_10486369 3300013105 Bacteria 1277
170 Ga0157369_10517503 3300013105 Bacteria 1234
171 Ga0157378_10208534 3300013297 Bacteria 1852
172 Ga0157378_11519599 3300013297 Bacteria 714
173 Ga0157378_12007776 3300013297 Bacteria 628
174 Ga0163162_10040884 3300013306 Bacteria 4638
175 Ga0163162_10162573 3300013306 Bacteria 2355
176 Ga0163162_10288834 3300013306 Bacteria 1772
177 Ga0163162_10675064 3300013306 Bacteria 1156
178 Ga0157372_10001692 3300013307 Bacteria 23859
179 Ga0157372_10062670 3300013307 Bacteria 4167
180 Ga0157372_10090069 3300013307 Bacteria 3486
181 Ga0157372_10516120 3300013307 Bacteria 1393
182 Ga0157372_10688593 3300013307 Bacteria 1190
183 Ga0157375_10409546 3300013308 Bacteria 1522
184 Ga0157375_10615270 3300013308 Bacteria 1245
185 Ga0157375_12802282 3300013308 Unclassified 583
186 Ga0157380_11854175 3300014326 Bacteria 663
187 Ga0157379_10179661 3300014968 Bacteria 1912
188 Ga0157379_10204277 3300014968 Unclassified 1787
189 Ga0157376_10049853 3300014969 Bacteria 3470
190 Ga0157376_10097760 3300014969 Bacteria 2558
191 Ga0157376_10101135 3300014969 Bacteria 2519
192 Ga0163161_10104267 3300017792 Bacteria 2114
193 Ga0207656_10011152 3300025321 Bacteria 3388
194 Ga0207643_10529863 3300025908 Bacteria 755
195 Ga0207705_10505280 3300025909 Bacteria 939
196 Ga0207705_11466997 3300025909 Bacteria 517
197 Ga0207654_10117310 3300025911 Bacteria 1666
198 Ga0207654_10368854 3300025911 Bacteria 992
199 Ga0207707_10058255 3300025912 Bacteria 3362
200 Ga0207707_10317067 3300025912 Bacteria 1347
201 Ga0207695_10032788 3300025913 Bacteria 5678
202 Ga0207695_10082202 3300025913 Bacteria 3258
203 Ga0207695_10094488 3300025913 Bacteria 2997
204 Ga0207695_10180568 3300025913 Bacteria 2031
205 Ga0207695_10758503 3300025913 Bacteria 850
206 Ga0207663_10888216 3300025916 Bacteria 712
207 Ga0207660_10323813 3300025917 Bacteria 1231
208 Ga0207662_10338737 3300025918 Bacteria 1007
209 Ga0207657_10565034 3300025919 Bacteria 889
210 Ga0207649_11155179 3300025920 Bacteria 611
211 Ga0207652_10012257 3300025921 Bacteria 6925
212 Ga0207652_10073162 3300025921 Bacteria 2981
213 Ga0207652_10269718 3300025921 Bacteria 1535
214 Ga0207652_11068664 3300025921 Bacteria 707
215 Ga0207681_10188811 3300025923 Bacteria 1575
216 Ga0207694_10052571 3300025924 Bacteria 3158
217 Ga0207694_10078732 3300025924 Bacteria 2584
218 Ga0207694_10276025 3300025924 Bacteria 1379
219 Ga0207694_10349928 3300025924 Bacteria 1223
220 Ga0207659_10158980 3300025926 Bacteria 1772
221 Ga0207687_10212685 3300025927 Bacteria 1518
222 Ga0207687_10556580 3300025927 Bacteria 963
223 Ga0207687_11047967 3300025927 Bacteria 700
224 Ga0207687_11373158 3300025927 Bacteria 607
225 Ga0207664_10364698 3300025929 Bacteria 1280
226 Ga0207664_10557203 3300025929 Bacteria 1029
227 Ga0207644_10342875 3300025931 Unclassified 1212
228 Ga0207690_10046393 3300025932 Bacteria 2877
229 Ga0207686_10011601 3300025934 Bacteria 4830
230 Ga0207686_10791657 3300025934 Bacteria 759
231 Ga0207709_10368184 3300025935 Bacteria 1090
232 Ga0207670_10231023 3300025936 Bacteria 1421
233 Ga0207670_10891750 3300025936 Bacteria 744
234 Ga0207704_10293357 3300025938 Bacteria 1242
235 Ga0207691_10739014 3300025940 Bacteria 829
236 Ga0207689_10096305 3300025942 Bacteria 2430
237 Ga0207661_10216677 3300025944 Bacteria 1690
238 Ga0207679_10254112 3300025945 Unclassified 1496
239 Ga0207667_10006733 3300025949 Bacteria 13876
240 Ga0207667_10020766 3300025949 Bacteria 7295
241 Ga0207667_10021121 3300025949 Bacteria 7221
242 Ga0207667_10080931 3300025949 Bacteria 3365
243 Ga0207651_10964163 3300025960 Bacteria 761
244 Ga0207651_11258091 3300025960 Bacteria 665
245 Ga0207712_10498851 3300025961 Bacteria 1040
246 Ga0207677_10013698 3300026023 Bacteria 4707
247 Ga0207703_10117604 3300026035 Bacteria 2278
248 Ga0207703_11204668 3300026035 Bacteria 728
249 Ga0207703_12091328 3300026035 Bacteria 542
250 Ga0207639_10089162 3300026041 Bacteria 2464
251 Ga0207639_10245467 3300026041 Bacteria 1559
252 Ga0207639_10440386 3300026041 Bacteria 1181
253 Ga0207708_11340300 3300026075 Unclassified 627
254 Ga0207702_10473370 3300026078 Unclassified 1218
255 Ga0207702_11859607 3300026078 Bacteria 594
256 Ga0207648_10164538 3300026089 Bacteria 1960
257 Ga0207648_11185600 3300026089 Bacteria 717
258 Ga0207675_100130673 3300026118 Bacteria 2381
259 Ga0207675_101451421 3300026118 Bacteria 707
260 Ga0207683_10346443 3300026121 Bacteria 1363
261 Ga0207683_10371696 3300026121 Unclassified 1313
262 Ga0207698_10015160 3300026142 Bacteria 5153
263 Ga0207698_10083208 3300026142 Bacteria 2589
264 Ga0207698_10380305 3300026142 Bacteria 1343
265 Ga0207698_11901011 3300026142 Bacteria 610
266 Ga0207698_12076466 3300026142 Bacteria 582
267 Ga0268266_10050067 3300028379 Bacteria 3584
268 Ga0268266_10108228 3300028379 Bacteria 2459
269 Ga0268264_10028474 3300028381 Bacteria 4571
270 Ga0265330_10258587 3300031235 Bacteria 733
271 Ga0265340_10076486 3300031247 Bacteria 1581
272 Ga0307408_100409367 3300031548 Bacteria 1167
273 Ga0307408_101014085 3300031548 Bacteria 766
274 Ga0265314_10024870 3300031711 Bacteria 4531
275 Ga0265342_10155797 3300031712 Bacteria 1266
276 Ga0307405_10749930 3300031731 Bacteria 813
277 Ga0307405_10931671 3300031731 Bacteria 737
278 Ga0307410_10573536 3300031852 Bacteria 938
279 Ga0307410_11232933 3300031852 Bacteria 652
280 Ga0307406_11966785 3300031901 Bacteria 522
281 Ga0307412_10370488 3300031911 Bacteria 1156
282 Ga0307416_101005413 3300032002 Bacteria 937
283 Ga0307416_101839839 3300032002 Bacteria 709
284 Ga0373936_0455718 3300035113 Bacteria 592
285 Ga0373945_0206057 3300035116 Bacteria 818
286 Ga0373953_0412416 3300035117 Bacteria 595
287 Ga0373957_0033563 3300035120 Bacteria 1896
288 Ga0373955_0009860 3300035172 Bacteria 4493
289 Ga0373924_0254427 3300035410 Bacteria 778
290 Ga0373924_0281094 3300035410 Bacteria 738
291 Ga0373931_0332811 3300035691 Bacteria 946
292 Ga0373935_0424982 3300035692 Bacteria 957
293 Ga0373927_0076924 3300035695 Bacteria 2161
294 Ga0373933_0172381 3300035724 Bacteria 1377
295 Ga0373947_0724156 3300035725 Unclassified 679
296 Ga0373937_0044192 3300036401 Bacteria 4068
297 Ga0373925_0096186 3300037068 Bacteria 2269
298 Ga0373925_0754188 3300037068 Bacteria 802
299 Ga0395899_0124361 3300037312 Bacteria 1845
300 Ga0395900_0112624 3300037418 Bacteria 2794
301 Ga0395905_0051332 3300037471 Bacteria 3863
302 Ga0395905_1245029 3300037471 Bacteria 648
303 Ga0395901_0238721 3300038443 Bacteria 1896
304 Ga0436365_0943956 3300039437 Bacteria 1786
305 Ga0439432_177990 3300042006 Bacteria 620
306 Ga0439446_0026641 3300042156 Bacteria 1657
307 Ga0439434_0357956 3300042435 Unclassified 510
308 Ga0466970_0320236 3300044765 Bacteria 877
309 Ga0495651_0145681 3300046462 Bacteria 1713
310 Ga0495653_0506198 3300046463 Bacteria 752
311 Ga0495608_0005328 3300046511 Bacteria 9189
312 Ga0495628_0071469 3300046516 Bacteria 2705
313 Ga0495587_0207441 3300046536 Bacteria 1107
314 Ga0495598_0039289 3300046537 Bacteria 1375
315 Ga0495598_0147072 3300046537 Bacteria 820
316 Ga0495621_0001320 3300046539 Bacteria 6408
317 Ga0495645_0000490 3300046543 Bacteria 27455
318 Ga0495645_0532122 3300046543 Bacteria 731
319 Ga0495667_0012132 3300046559 Bacteria 5840
320 Ga0495657_0096961 3300046675 Bacteria 1883
321 Ga0495599_0268539 3300046678 Bacteria 1035
322 Ga0495658_0447518 3300046683 Bacteria 825
323 Ga0495604_0281073 3300047317 Bacteria 1124
324 Ga0495680_0481395 3300047322 Bacteria 845
325 Ga0495684_0695925 3300047471 Bacteria 675
326 Ga0496104_0027083 3300048907 Bacteria 5301
327 Ga0496109_0684490 3300048912 Bacteria 963
328 Ga0501032_0488192 3300049569 Bacteria 788
329 Ga0501034_0208519 3300049571 Bacteria 1910
330 Ga0501042_0231550 3300049578 Bacteria 1333
331 Ga0501043_0365766 3300049579 Bacteria 1094
332 Ga0501047_0003648 3300049581 Bacteria 14509
333 Ga0501048_0141263 3300049582 Bacteria 1703
334 Ga0501067_0041656 3300049583 Bacteria 2550
335 Ga0501069_0001230 3300049585 Bacteria 12515
336 Ga0501070_0001632 3300049586 Bacteria 19881
337 Ga0501072_0196879 3300049588 Bacteria 1607
338 Ga0501073_0004853 3300049589 Bacteria 10093
339 Ga0501074_0054948 3300049590 Bacteria 2870
340 Ga0501079_0010664 3300049741 Bacteria 6996
341 Ga0501080_0046912 3300049742 Bacteria 4021
342 Ga0501083_0001539 3300049744 Bacteria 15778
343 Ga0501035_0538941 3300049822 Bacteria 957
344 Ga0501044_0067622 3300049823 Bacteria 3640
345 nmdc:mga03683_127665_c1 3300050489 Bacteria 1135
346 nmdc:mga03n38_239643_c1 3300050490 Bacteria 954
347 nmdc:mga00v17_1008338_c1 3300050491 Bacteria 524
348 nmdc:mga00v17_123908_c1 3300050491 Bacteria 1648
349 nmdc:mga00v17_154931_c1 3300050491 Bacteria 1473
350 nmdc:mga0k408_7678_c1 3300050493 Bacteria 5763
351 nmdc:mga0k408_96468_c1 3300050493 Bacteria 1741
352 nmdc:mga06z11_445200_c1 3300050494 Bacteria 782
353 nmdc:mga08x19_199986_c1 3300050514 Bacteria 1369
354 nmdc:mga0sz30_25303_c1 3300050516 Bacteria 2427
355 Ga0495601_0003644 3300053077 Bacteria 8857
356 Ga0495595_0055377 3300053084 Bacteria 1846
357 Ga0495595_0714576 3300053084 Unclassified 514
358 Ga0495619_0085361 3300053085 Bacteria 2132
359 Ga0501084_0029207 3300054114 Bacteria 4612
360 Ga0501082_0115434 3300060353 Bacteria 2325
361 Ga0207654_10312854
362 Ga0065712_10103519
363 Ga0070658_10049647
364 Ga0070658_10509614
365 Ga0070683_100153322
366 Ga0070683_100380771
367 Ga0070690_100235639
368 Ga0070690_100878276
369 Ga0070677_10730069
370 Ga0068869_100342605
371 Ga0068869_100610526
372 Ga0068869_101008264
373 Ga0070680_100031950
374 Ga0070680_100292735
375 Ga0070680_100763909
376 Ga0068868_100017934
377 Ga0070660_100446777
378 Ga0070660_100774767
379 Ga0070689_100516553
380 Ga0070689_100956633
381 Ga0070687_100085083
382 Ga0070687_100136622
383 Ga0070687_101026018
384 Ga0070661_100256428
385 Ga0070661_100310914
386 Ga0070661_100552951
387 Ga0070661_100864448
388 Ga0070692_10136904
389 Ga0070692_10884558
390 Ga0070675_100117185
391 Ga0070671_100181663
392 Ga0070674_101171156
393 Ga0070673_100337342
394 Ga0070673_100354456
395 Ga0070673_101444999
396 Ga0070659_100065443
397 Ga0070709_10793142
398 Ga0070714_100955040
399 Ga0070714_101750962
400 Ga0070714_101969467
401 Ga0070714_102492184
402 Ga0070701_10008256
403 Ga0070701_10376298
404 Ga0070705_100321578
405 Ga0070705_100717567
406 Ga0070705_101077191
407 Ga0070700_101237350
408 Ga0070694_101268149
409 Ga0070663_101019954
410 Ga0070678_100363764
411 Ga0070678_100520776
412 Ga0070681_10056966
413 Ga0070681_10280612
414 Ga0068867_100138668
415 Ga0068867_102368864
416 Ga0070685_10519588
417 Ga0070698_100168487
418 Ga0070679_100017639
419 Ga0070679_100075491
420 Ga0070679_101231506
421 Ga0070684_100160075
422 Ga0070684_100198027
423 Ga0070684_100539468
424 Ga0070684_100845314
425 Ga0070697_101307360
426 Ga0068853_100017264
427 Ga0068853_100167914
428 Ga0068853_100215887
429 Ga0068853_100482088
430 Ga0070686_101257969
431 Ga0070696_101286431
432 Ga0070693_100012736
433 Ga0070693_101341917
434 Ga0070665_100054234
435 Ga0070665_100075331
436 Ga0070704_100038995
437 Ga0070704_100185086
438 Ga0068855_100018124
439 Ga0068855_100018542
440 Ga0068855_100028313
441 Ga0068855_100033076
442 Ga0068855_100038425
443 Ga0068855_100483270
444 Ga0068855_101279319
445 Ga0070664_100315779
446 Ga0068856_100060367
447 Ga0068856_102123579
448 Ga0070702_100143275
449 Ga0070702_101465752
450 Ga0068852_100000823
451 Ga0068852_100005931
452 Ga0068852_100046801
453 Ga0068852_102503505
454 Ga0068859_100013054
455 Ga0068859_100420281
456 Ga0068859_100450219
457 Ga0068864_101046240
458 Ga0068864_102286771
459 Ga0068866_11104037
460 Ga0068861_100099026
461 Ga0068861_102452061
462 Ga0068851_10003721
463 Ga0068851_10343177
464 Ga0068851_10470303
465 Ga0068858_100025891
466 Ga0068858_100571192
467 Ga0068858_100775351
468 Ga0068858_101062651
469 Ga0068858_101462237
470 Ga0068860_100144559
471 Ga0075364_10014535
472 Ga0075364_10347982
473 Ga0075364_11062659
474 Ga0070715_10700038
475 Ga0075367_10201701
476 Ga0075369_10001387
477 Ga0075366_10000908
478 Ga0075366_10011888
479 Ga0075366_10081826
480 Ga0097621_100052522
481 Ga0097621_100073114
482 Ga0097621_100076406
483 Ga0097621_100362817
484 Ga0097621_100757945
485 Ga0075370_10141268
486 Ga0068871_100009669
487 Ga0068871_100016657
488 Ga0068871_100433107
489 Ga0075434_100912208
490 Ga0075429_100206438
491 Ga0068865_102163789
492 Ga0075436_100063834
493 Ga0097620_100013054
494 Ga0097620_100420288
495 Ga0097620_100450237
496 Ga0075435_100424604
497 Ga0075435_100454829
498 Ga0105240_10019043
499 Ga0105240_10026838
500 Ga0105240_10041414
501 Ga0105240_10291161
502 Ga0105240_11159278
503 Ga0105245_10072355
504 Ga0105245_10497632
505 Ga0105245_11299107
506 Ga0105243_10620286
507 Ga0105243_11458501
508 Ga0105241_10015862
509 Ga0105241_11423412
510 Ga0105242_10030460
511 Ga0105242_10262381
512 Ga0105242_10812534
513 Ga0105242_11996887
514 Ga0105248_10126010
515 Ga0105248_10860876
516 Ga0105248_11985520
517 Ga0105238_10014725
518 Ga0105238_10038040
519 Ga0105238_10050204
520 Ga0105238_10525184
521 Ga0105238_11015620
522 Ga0105238_11457598
523 Ga0105238_12599523
524 Ga0105249_10205628
525 Ga0105249_10679848
526 Ga0157370_10008428
527 Ga0157370_10615782
528 Ga0157369_10357819
529 Ga0157369_10486369
530 Ga0157369_10517503
531 Ga0157378_10208534
532 Ga0157378_11519599
533 Ga0157378_12007776
534 Ga0163162_10040884
535 Ga0163162_10162573
536 Ga0163162_10288834
537 Ga0163162_10675064
538 Ga0157372_10001692
539 Ga0157372_10062670
540 Ga0157372_10090069
541 Ga0157372_10516120
542 Ga0157372_10688593
543 Ga0157375_10409546
544 Ga0157375_10615270
545 Ga0157375_12802282
546 Ga0157380_11854175
547 Ga0157379_10179661
548 Ga0157379_10204277
549 Ga0157376_10049853
550 Ga0157376_10097760
551 Ga0157376_10101135
552 Ga0163161_10104267
553 Ga0207656_10011152
554 Ga0207643_10529863
555 Ga0207705_10505280
556 Ga0207705_11466997
557 Ga0207654_10117310
558 Ga0207654_10368854
559 Ga0207707_10058255
560 Ga0207707_10317067
561 Ga0207695_10032788
562 Ga0207695_10082202
563 Ga0207695_10094488
564 Ga0207695_10180568
565 Ga0207695_10758503
566 Ga0207663_10888216
567 Ga0207660_10323813
568 Ga0207662_10338737
569 Ga0207657_10565034
570 Ga0207649_11155179
571 Ga0207652_10012257
572 Ga0207652_10073162
573 Ga0207652_10269718
574 Ga0207652_11068664
575 Ga0207681_10188811
576 Ga0207694_10052571
577 Ga0207694_10078732
578 Ga0207694_10276025
579 Ga0207694_10349928
580 Ga0207659_10158980
581 Ga0207687_10212685
582 Ga0207687_10556580
583 Ga0207687_11047967
584 Ga0207687_11373158
585 Ga0207664_10364698
586 Ga0207664_10557203
587 Ga0207644_10342875
588 Ga0207690_10046393
589 Ga0207686_10011601
590 Ga0207686_10791657
591 Ga0207709_10368184
592 Ga0207670_10231023
593 Ga0207670_10891750
594 Ga0207704_10293357
595 Ga0207691_10739014
596 Ga0207689_10096305
597 Ga0207661_10216677
598 Ga0207679_10254112
599 Ga0207667_10006733
600 Ga0207667_10020766
601 Ga0207667_10021121
602 Ga0207667_10080931
603 Ga0207651_10964163
604 Ga0207651_11258091
605 Ga0207712_10498851
606 Ga0207677_10013698
607 Ga0207703_10117604
608 Ga0207703_11204668
609 Ga0207703_12091328
610 Ga0207639_10089162
611 Ga0207639_10245467
612 Ga0207639_10440386
613 Ga0207708_11340300
614 Ga0207702_10473370
615 Ga0207702_11859607
616 Ga0207648_10164538
617 Ga0207648_11185600
618 Ga0207675_100130673
619 Ga0207675_101451421
620 Ga0207683_10346443
621 Ga0207683_10371696
622 Ga0207698_10015160
623 Ga0207698_10083208
624 Ga0207698_10380305
625 Ga0207698_11901011
626 Ga0207698_12076466
627 Ga0268266_10050067
628 Ga0268266_10108228
629 Ga0268264_10028474
630 Ga0265330_10258587
631 Ga0265340_10076486
632 Ga0307408_100409367
633 Ga0307408_101014085
634 Ga0265314_10024870
635 Ga0265342_10155797
636 Ga0307405_10749930
637 Ga0307405_10931671
638 Ga0307410_10573536
639 Ga0307410_11232933
640 Ga0307406_11966785
641 Ga0307412_10370488
642 Ga0307416_101005413
643 Ga0307416_101839839
644 Ga0373936_0455718
645 Ga0373945_0206057
646 Ga0373953_0412416
647 Ga0373957_0033563
648 Ga0373955_0009860
649 Ga0373924_0254427
650 Ga0373924_0281094
651 Ga0373931_0332811
652 Ga0373935_0424982
653 Ga0373927_0076924
654 Ga0373933_0172381
655 Ga0373947_0724156
656 Ga0373937_0044192
657 Ga0373925_0096186
658 Ga0373925_0754188
659 Ga0395899_0124361
660 Ga0395900_0112624
661 Ga0395905_0051332
662 Ga0395905_1245029
663 Ga0395901_0238721
664 Ga0436365_0943956
665 Ga0439432_177990
666 Ga0439446_0026641
667 Ga0439434_0357956
668 Ga0466970_0320236
669 Ga0495651_0145681
670 Ga0495653_0506198
671 Ga0495608_0005328
672 Ga0495628_0071469
673 Ga0495587_0207441
674 Ga0495598_0039289
675 Ga0495598_0147072
676 Ga0495621_0001320
677 Ga0495645_0000490
678 Ga0495645_0532122
679 Ga0495667_0012132
680 Ga0495657_0096961
681 Ga0495599_0268539
682 Ga0495658_0447518
683 Ga0495604_0281073
684 Ga0495680_0481395
685 Ga0495684_0695925
686 Ga0496104_0027083
687 Ga0496109_0684490
688 Ga0501032_0488192
689 Ga0501034_0208519
690 Ga0501042_0231550
691 Ga0501043_0365766
692 Ga0501047_0003648
693 Ga0501048_0141263
694 Ga0501067_0041656
695 Ga0501069_0001230
696 Ga0501070_0001632
697 Ga0501072_0196879
698 Ga0501073_0004853
699 Ga0501074_0054948
700 Ga0501079_0010664
701 Ga0501080_0046912
702 Ga0501083_0001539
703 Ga0501035_0538941
704 Ga0501044_0067622
705 nmdc:mga03683_127665_c1
706 nmdc:mga03n38_239643_c1
707 nmdc:mga00v17_1008338_c1
708 nmdc:mga00v17_123908_c1
709 nmdc:mga00v17_154931_c1
710 nmdc:mga0k408_7678_c1
711 nmdc:mga0k408_96468_c1
712 nmdc:mga06z11_445200_c1
713 nmdc:mga08x19_199986_c1
714 nmdc:mga0sz30_25303_c1
715 Ga0495601_0003644
716 Ga0495595_0055377
717 Ga0495595_0714576
718 Ga0495619_0085361
719 Ga0501084_0029207
720 Ga0501082_0115434

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05437

AzlD

Branched-chain amino acid transport protein (AzlD)

17

114

0.97

Map