F421867

General Info

Members Datasets Scaffolds Average Seq Length
360 206 720 103

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10000059|Ga0105249_10000059126
Length 126
Sequence MRTPVWKTFKAWAVRTTSNAGATMYLIRDTMYCKPGKVRAMTEKFIAMSKLSEKAGMPRMRIMTDFCAERYWTVVSEMEVADLKAFEDMMSSMPKGDDAMKEMEEIMKGYHDLVDHGKREIYKIES

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
138 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
139 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
194 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
195 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
196 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
197 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
198 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
199 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
200 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 1.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.56
Rhizosphere 99.17
Stem 0
Stem Tuber 0
Unclassified 28.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10000059 3300009553 Bacteria 154729
2 Ga0058863_11863381 3300004799 Bacteria 742
3 Ga0058863_11975220 3300004799 Bacteria 925
4 Ga0058861_12076282 3300004800 Bacteria 761
5 Ga0058862_12854672 3300004803 Unclassified 714
6 Ga0070658_10140037 3300005327 Bacteria 2021
7 Ga0070658_10410317 3300005327 Bacteria 1164
8 Ga0070683_100392305 3300005329 Bacteria 1323
9 Ga0070683_100586494 3300005329 Bacteria 1066
10 Ga0070683_100983022 3300005329 Bacteria 810
11 Ga0070670_100107977 3300005331 Bacteria 2398
12 Ga0070670_100462201 3300005331 Bacteria 1126
13 Ga0070677_10670571 3300005333 Unclassified 581
14 Ga0068869_102054412 3300005334 Unclassified 513
15 Ga0070666_10145391 3300005335 Bacteria 1653
16 Ga0070680_100002243 3300005336 Bacteria 14262
17 Ga0070680_100322542 3300005336 Unclassified 1311
18 Ga0070680_100551490 3300005336 Unclassified 988
19 Ga0070682_101818806 3300005337 Bacteria 532
20 Ga0070682_102013890 3300005337 Unclassified 508
21 Ga0068868_100122745 3300005338 Bacteria 2120
22 Ga0070660_100073712 3300005339 Bacteria 2669
23 Ga0070660_100148631 3300005339 Bacteria 1883
24 Ga0070691_10044896 3300005341 Bacteria 2096
25 Ga0070687_100043346 3300005343 Bacteria 2286
26 Ga0070661_100361476 3300005344 Unclassified 1141
27 Ga0070661_100991606 3300005344 Bacteria 696
28 Ga0070692_11228320 3300005345 Unclassified 535
29 Ga0070668_100006799 3300005347 Bacteria 8481
30 Ga0070669_100000619 3300005353 Bacteria 26250
31 Ga0070669_100152150 3300005353 Bacteria 1792
32 Ga0070675_100139290 3300005354 Bacteria 2073
33 Ga0070673_100273113 3300005364 Bacteria 1480
34 Ga0070688_100047880 3300005365 Unclassified 2654
35 Ga0070688_100842660 3300005365 Bacteria 720
36 Ga0070659_100760514 3300005366 Unclassified 841
37 Ga0070659_101598181 3300005366 Unclassified 582
38 Ga0070667_100041050 3300005367 Bacteria 3882
39 Ga0070667_100429379 3300005367 Unclassified 1205
40 Ga0070667_101760069 3300005367 Unclassified 583
41 Ga0070714_100018323 3300005435 Bacteria 5686
42 Ga0070713_100016790 3300005436 Bacteria 5513
43 Ga0070713_101230086 3300005436 Bacteria 725
44 Ga0070710_10458699 3300005437 Bacteria 865
45 Ga0070705_100209049 3300005440 Bacteria 1344
46 Ga0070694_100026851 3300005444 Bacteria 3735
47 Ga0070708_100475727 3300005445 Bacteria 1179
48 Ga0070663_100304327 3300005455 Bacteria 1277
49 Ga0070678_100541742 3300005456 Bacteria 1032
50 Ga0070662_100642953 3300005457 Bacteria 894
51 Ga0070681_10005714 3300005458 Bacteria 12023
52 Ga0070681_10025640 3300005458 Bacteria 5930
53 Ga0070681_10032455 3300005458 Bacteria 5240
54 Ga0070681_10112242 3300005458 Bacteria 2665
55 Ga0070681_11552009 3300005458 Bacteria 587
56 Ga0070685_10027973 3300005466 Bacteria 3121
57 Ga0070699_100014707 3300005518 Bacteria 6729
58 Ga0070699_100070699 3300005518 Unclassified 3034
59 Ga0070699_100467933 3300005518 Bacteria 1143
60 Ga0070679_100006246 3300005530 Bacteria 11101
61 Ga0070679_100007865 3300005530 Bacteria 9997
62 Ga0070679_100022784 3300005530 Bacteria 6126
63 Ga0070679_100360687 3300005530 Bacteria 1401
64 Ga0070679_100495583 3300005530 Unclassified 1166
65 Ga0070684_100006002 3300005535 Bacteria 9358
66 Ga0070684_100133434 3300005535 Unclassified 2241
67 Ga0070684_100224786 3300005535 Bacteria 1713
68 Ga0070684_100251076 3300005535 Bacteria 1617
69 Ga0070684_100275276 3300005535 Bacteria 1541
70 Ga0070684_101001268 3300005535 Unclassified 784
71 Ga0070684_101025320 3300005535 Bacteria 775
72 Ga0070684_101680170 3300005535 Unclassified 599
73 Ga0070697_100362398 3300005536 Bacteria 1253
74 Ga0070697_101105410 3300005536 Unclassified 706
75 Ga0068853_100740456 3300005539 Bacteria 939
76 Ga0070672_100344567 3300005543 Bacteria 1269
77 Ga0070695_100036630 3300005545 Bacteria 3088
78 Ga0070696_100010957 3300005546 Bacteria 6074
79 Ga0070696_100127282 3300005546 Unclassified 1849
80 Ga0070696_100155719 3300005546 Bacteria 1680
81 Ga0070693_100302711 3300005547 Unclassified 1078
82 Ga0070665_100025459 3300005548 Bacteria 5961
83 Ga0068855_100220094 3300005563 Unclassified 2129
84 Ga0068855_101122559 3300005563 Unclassified 821
85 Ga0068855_101912918 3300005563 Unclassified 601
86 Ga0070664_100012855 3300005564 Bacteria 6810
87 Ga0070664_100037432 3300005564 Bacteria 4080
88 Ga0070664_100057805 3300005564 Unclassified 3297
89 Ga0070664_100109966 3300005564 Bacteria 2404
90 Ga0068857_100246088 3300005577 Bacteria 1638
91 Ga0068852_100148712 3300005616 Bacteria 2176
92 Ga0068852_102551732 3300005616 Bacteria 531
93 Ga0068859_100013005 3300005617 Bacteria 8362
94 Ga0068859_100219673 3300005617 Bacteria 1988
95 Ga0068864_101217283 3300005618 Unclassified 752
96 Ga0068870_10043417 3300005840 Bacteria 2345
97 Ga0068863_100058109 3300005841 Bacteria 3661
98 Ga0068858_100392972 3300005842 Unclassified 1332
99 Ga0068860_102306151 3300005843 Unclassified 559
100 Ga0068862_100178971 3300005844 Unclassified 1902
101 Ga0070712_100955583 3300006175 Unclassified 740
102 Ga0075430_100463117 3300006846 Unclassified 1046
103 Ga0075430_101670040 3300006846 Unclassified 523
104 Ga0075431_100536455 3300006847 Unclassified 1158
105 Ga0075429_101456144 3300006880 Unclassified 596
106 Ga0068865_100966178 3300006881 Bacteria 744
107 Ga0075436_100340748 3300006914 Bacteria 1079
108 Ga0075436_101030329 3300006914 Bacteria 618
109 Ga0097620_100013005 3300006931 Bacteria 8362
110 Ga0097620_100219691 3300006931 Bacteria 1988
111 Ga0075435_100103947 3300007076 Bacteria 2356
112 Ga0075435_100515883 3300007076 Bacteria 1034
113 Ga0105240_10036364 3300009093 Bacteria 6336
114 Ga0105242_11624865 3300009176 Bacteria 680
115 Ga0105248_10306073 3300009177 Bacteria 1790
116 Ga0105238_10936078 3300009551 Bacteria 886
117 Ga0105249_10701626 3300009553 Bacteria 1072
118 Ga0105246_10286421 3300011119 Bacteria 1324
119 Ga0157373_11582678 3300013100 Unclassified 502
120 Ga0157370_10025959 3300013104 Bacteria 5791
121 Ga0157370_10037247 3300013104 Bacteria 4715
122 Ga0157370_10251534 3300013104 Unclassified 1634
123 Ga0157370_11889432 3300013104 Bacteria 536
124 Ga0157369_10320748 3300013105 Bacteria 1611
125 Ga0157369_11521878 3300013105 Unclassified 680
126 Ga0163162_10005310 3300013306 Bacteria 12436
127 Ga0163162_10298613 3300013306 Bacteria 1742
128 Ga0157372_10036335 3300013307 Bacteria 5429
129 Ga0157372_10178285 3300013307 Bacteria 2460
130 Ga0157372_10607919 3300013307 Bacteria 1274
131 Ga0157375_10018747 3300013308 Bacteria 6279
132 Ga0163163_10009932 3300014325 Bacteria 8534
133 Ga0163163_10271334 3300014325 Bacteria 1748
134 Ga0163163_10756453 3300014325 Bacteria 1035
135 Ga0163163_11261872 3300014325 Unclassified 801
136 Ga0157380_12984203 3300014326 Unclassified 539
137 Ga0157376_10002620 3300014969 Bacteria 12232
138 Ga0197907_11343472 3300020069 Bacteria 1144
139 Ga0206356_11314931 3300020070 Unclassified 599
140 Ga0206350_10816124 3300020080 Bacteria 1047
141 Ga0207682_10055931 3300025893 Unclassified 1642
142 Ga0207682_10273009 3300025893 Unclassified 790
143 Ga0207682_10307552 3300025893 Bacteria 744
144 Ga0207642_11024981 3300025899 Bacteria 532
145 Ga0207647_10324212 3300025904 Bacteria 874
146 Ga0207699_10048824 3300025906 Bacteria 2488
147 Ga0207643_10003723 3300025908 Bacteria 8195
148 Ga0207705_10365085 3300025909 Bacteria 1114
149 Ga0207705_10398177 3300025909 Bacteria 1065
150 Ga0207707_10011015 3300025912 Bacteria 7867
151 Ga0207707_10015273 3300025912 Bacteria 6687
152 Ga0207707_10039475 3300025912 Bacteria 4126
153 Ga0207707_10041576 3300025912 Bacteria 4014
154 Ga0207707_10057114 3300025912 Bacteria 3397
155 Ga0207695_10020679 3300025913 Bacteria 7531
156 Ga0207695_11739407 3300025913 Bacteria 504
157 Ga0207693_10766300 3300025915 Unclassified 745
158 Ga0207660_10020559 3300025917 Bacteria 4431
159 Ga0207660_10078914 3300025917 Bacteria 2414
160 Ga0207660_10242930 3300025917 Unclassified 1419
161 Ga0207660_10592984 3300025917 Unclassified 902
162 Ga0207660_11498332 3300025917 Unclassified 545
163 Ga0207662_10000878 3300025918 Bacteria 13901
164 Ga0207657_10035924 3300025919 Bacteria 4439
165 Ga0207649_10105653 3300025920 Bacteria 1872
166 Ga0207649_10329592 3300025920 Bacteria 1124
167 Ga0207649_10535598 3300025920 Bacteria 894
168 Ga0207652_10004616 3300025921 Bacteria 11161
169 Ga0207652_10009773 3300025921 Bacteria 7721
170 Ga0207652_10034346 3300025921 Bacteria 4273
171 Ga0207652_10320870 3300025921 Bacteria 1398
172 Ga0207652_10345901 3300025921 Bacteria 1342
173 Ga0207652_10739785 3300025921 Bacteria 876
174 Ga0207681_10155656 3300025923 Bacteria 1717
175 Ga0207694_10533820 3300025924 Bacteria 984
176 Ga0207650_10047445 3300025925 Bacteria 3165
177 Ga0207659_10257942 3300025926 Bacteria 1417
178 Ga0207659_10370080 3300025926 Unclassified 1193
179 Ga0207700_10023364 3300025928 Bacteria 4261
180 Ga0207644_10087764 3300025931 Unclassified 2312
181 Ga0207690_10416953 3300025932 Bacteria 1073
182 Ga0207706_10122740 3300025933 Unclassified 2285
183 Ga0207691_10100414 3300025940 Bacteria 2583
184 Ga0207661_10000780 3300025944 Bacteria 20734
185 Ga0207661_10041672 3300025944 Bacteria 3615
186 Ga0207661_10108377 3300025944 Unclassified 2345
187 Ga0207661_10183094 3300025944 Bacteria 1831
188 Ga0207661_10205603 3300025944 Unclassified 1733
189 Ga0207661_10366113 3300025944 Bacteria 1303
190 Ga0207661_10380928 3300025944 Bacteria 1277
191 Ga0207661_10416704 3300025944 Unclassified 1219
192 Ga0207661_11122516 3300025944 Unclassified 724
193 Ga0207661_11980974 3300025944 Unclassified 528
194 Ga0207679_10030781 3300025945 Unclassified 3751
195 Ga0207679_10046525 3300025945 Bacteria 3146
196 Ga0207679_10103523 3300025945 Bacteria 2231
197 Ga0207679_10341961 3300025945 Unclassified 1301
198 Ga0207679_10573780 3300025945 Bacteria 1014
199 Ga0207667_10019517 3300025949 Bacteria 7564
200 Ga0207667_10898962 3300025949 Unclassified 877
201 Ga0207712_10000047 3300025961 Bacteria 161425
202 Ga0207668_10010575 3300025972 Bacteria 5580
203 Ga0207668_10356243 3300025972 Unclassified 1225
204 Ga0207640_10199830 3300025981 Bacteria 1514
205 Ga0207658_10176264 3300025986 Unclassified 1766
206 Ga0207658_11159701 3300025986 Unclassified 706
207 Ga0207677_10100449 3300026023 Bacteria 2127
208 Ga0207678_10078178 3300026067 Bacteria 2833
209 Ga0207678_10427658 3300026067 Bacteria 1149
210 Ga0207678_10950356 3300026067 Bacteria 760
211 Ga0207702_10841837 3300026078 Bacteria 908
212 Ga0207641_10579731 3300026088 Unclassified 1096
213 Ga0207676_10294638 3300026095 Unclassified 1479
214 Ga0207674_10006442 3300026116 Bacteria 13805
215 Ga0207674_10795795 3300026116 Bacteria 912
216 Ga0207683_10359891 3300026121 Bacteria 1336
217 Ga0207683_11377637 3300026121 Unclassified 652
218 Ga0207698_10009259 3300026142 Bacteria 6267
219 Ga0207698_10800928 3300026142 Bacteria 944
220 Ga0207428_10820538 3300027907 Unclassified 660
221 Ga0268266_10017763 3300028379 Bacteria 6061
222 Ga0268266_10335882 3300028379 Bacteria 1417
223 Ga0268264_11833024 3300028381 Unclassified 617
224 Ga0307408_100475893 3300031548 Bacteria 1088
225 Ga0307408_100968211 3300031548 Bacteria 783
226 Ga0307405_10070060 3300031731 Bacteria 2250
227 Ga0307405_10195473 3300031731 Bacteria 1464
228 Ga0307413_10155943 3300031824 Bacteria 1597
229 Ga0307413_10282355 3300031824 Bacteria 1249
230 Ga0307413_11977068 3300031824 Bacteria 525
231 Ga0307410_10001208 3300031852 Bacteria 11471
232 Ga0307410_10036988 3300031852 Bacteria 3184
233 Ga0307410_10092172 3300031852 Bacteria 2153
234 Ga0307410_10117999 3300031852 Bacteria 1930
235 Ga0307406_10007971 3300031901 Bacteria 5900
236 Ga0307406_10084415 3300031901 Bacteria 2120
237 Ga0307406_11437772 3300031901 Bacteria 605
238 Ga0307407_10003041 3300031903 Bacteria 6751
239 Ga0307407_10005702 3300031903 Bacteria 5438
240 Ga0307407_10028968 3300031903 Bacteria 2967
241 Ga0307407_10671997 3300031903 Unclassified 778
242 Ga0307407_11013606 3300031903 Bacteria 642
243 Ga0307412_10044087 3300031911 Bacteria 2909
244 Ga0307412_10078988 3300031911 Bacteria 2268
245 Ga0307412_10241444 3300031911 Bacteria 1397
246 Ga0307409_100000231 3300031995 Bacteria 22493
247 Ga0307409_100063984 3300031995 Bacteria 2887
248 Ga0307409_100463604 3300031995 Bacteria 1225
249 Ga0307409_100590527 3300031995 Bacteria 1096
250 Ga0307416_100006293 3300032002 Bacteria 7417
251 Ga0307416_100300778 3300032002 Bacteria 1594
252 Ga0307416_100396738 3300032002 Bacteria 1416
253 Ga0307416_100756722 3300032002 Bacteria 1064
254 Ga0307414_10002624 3300032004 Bacteria 9458
255 Ga0307414_10178153 3300032004 Bacteria 1707
256 Ga0307411_10005223 3300032005 Bacteria 6357
257 Ga0307411_10042470 3300032005 Bacteria 2901
258 Ga0307411_10104117 3300032005 Bacteria 2014
259 Ga0307415_100026567 3300032126 Bacteria 3654
260 Ga0307415_100037545 3300032126 Bacteria 3184
261 Ga0307415_100047371 3300032126 Bacteria 2893
262 Ga0307415_100162824 3300032126 Bacteria 1731
263 Ga0307415_101113293 3300032126 Bacteria 740
264 Ga0373936_0189543 3300035113 Bacteria 905
265 Ga0373945_0591122 3300035116 Unclassified 501
266 Ga0373953_0046246 3300035117 Unclassified 1747
267 Ga0373954_0026248 3300035118 Unclassified 2670
268 Ga0373956_0119439 3300035119 Unclassified 1231
269 Ga0373957_0017520 3300035120 Bacteria 2496
270 Ga0373955_0164395 3300035172 Unclassified 1311
271 Ga0373924_0223687 3300035410 Bacteria 832
272 Ga0373933_0030863 3300035724 Bacteria 3105
273 Ga0373937_0088870 3300036401 Bacteria 2860
274 Ga0373937_0120154 3300036401 Bacteria 2448
275 Ga0395899_0014058 3300037312 Bacteria 6111
276 Ga0395900_0305950 3300037418 Bacteria 1574
277 Ga0395898_0315865 3300037466 Bacteria 1490
278 Ga0395905_0010628 3300037471 Bacteria 8933
279 Ga0395901_0002424 3300038443 Bacteria 18930
280 Ga0451807_0002820 3300041486 Bacteria 588
281 Ga0451849_0035331 3300041505 Bacteria 551
282 Ga0466966_0777253 3300044684 Bacteria 577
283 Ga0466959_0280914 3300045049 Bacteria 1143
284 Ga0466958_0598502 3300045836 Bacteria 717
285 Ga0495592_0028390 3300046454 Bacteria 4238
286 Ga0495592_0152203 3300046454 Bacteria 1599
287 Ga0495592_0557032 3300046454 Unclassified 704
288 Ga0495651_0024852 3300046462 Bacteria 4661
289 Ga0495651_0045804 3300046462 Bacteria 3387
290 Ga0495653_0191092 3300046463 Unclassified 1397
291 Ga0495653_0347487 3300046463 Unclassified 955
292 Ga0495662_0064188 3300046476 Unclassified 1774
293 Ga0495594_0616988 3300046499 Unclassified 615
294 Ga0495608_0008855 3300046511 Bacteria 7039
295 Ga0495608_0683974 3300046511 Unclassified 611
296 Ga0495608_0933141 3300046511 Unclassified 507
297 Ga0495618_0765469 3300046514 Unclassified 564
298 Ga0495620_0261825 3300046515 Unclassified 659
299 Ga0495628_0217201 3300046516 Bacteria 1437
300 Ga0495630_0121040 3300046517 Bacteria 1985
301 Ga0495630_1464276 3300046517 Unclassified 513
302 Ga0495663_0057147 3300046525 Bacteria 1220
303 Ga0495663_0064303 3300046525 Bacteria 1158
304 Ga0495642_0306735 3300046528 Unclassified 696
305 Ga0495652_0479362 3300046529 Unclassified 866
306 Ga0495652_1027528 3300046529 Unclassified 538
307 Ga0495640_0118317 3300046533 Bacteria 1724
308 Ga0495640_0684684 3300046533 Unclassified 616
309 Ga0495587_0058774 3300046536 Bacteria 2258
310 Ga0495598_0284486 3300046537 Unclassified 622
311 Ga0495621_0031108 3300046539 Bacteria 1829
312 Ga0495621_0075394 3300046539 Bacteria 1250
313 Ga0495621_0273183 3300046539 Bacteria 695
314 Ga0495645_0814781 3300046543 Unclassified 559
315 Ga0495667_0313752 3300046559 Unclassified 992
316 Ga0495634_0225712 3300046642 Bacteria 1154
317 Ga0495635_0269999 3300046663 Unclassified 1144
318 Ga0495659_0252537 3300046664 Unclassified 735
319 Ga0495657_0064939 3300046675 Bacteria 2401
320 Ga0495599_0024880 3300046678 Bacteria 3744
321 Ga0495599_0119768 3300046678 Unclassified 1637
322 Ga0495599_0249581 3300046678 Bacteria 1080
323 Ga0495623_0086443 3300046679 Bacteria 1933
324 Ga0495646_0599434 3300046680 Unclassified 560
325 Ga0495613_0058648 3300046689 Bacteria 2824
326 Ga0495624_0169477 3300046690 Unclassified 1332
327 Ga0495600_0107949 3300046809 Bacteria 1813
328 Ga0495600_0301811 3300046809 Bacteria 1010
329 Ga0495604_0195115 3300047317 Unclassified 1408
330 Ga0495604_0505096 3300047317 Bacteria 784
331 Ga0495674_1032827 3300047319 Bacteria 628
332 Ga0495680_0016155 3300047322 Bacteria 6418
333 Ga0495680_0064896 3300047322 Bacteria 2798
334 Ga0495675_0022675 3300047444 Bacteria 4003
335 Ga0495675_0153628 3300047444 Unclassified 1421
336 Ga0495675_0203497 3300047444 Bacteria 1204
337 Ga0495675_0272169 3300047444 Bacteria 1012
338 Ga0495685_014700 3300047447 Bacteria 2662
339 Ga0495684_0040200 3300047471 Unclassified 3585
340 Ga0495684_0815459 3300047471 Unclassified 608
341 Ga0495602_0346810 3300048088 Bacteria 1073
342 Ga0496104_0351009 3300048907 Bacteria 1388
343 Ga0501198_047516 3300049649 Bacteria 758
344 Ga0501202_042773 3300049652 Bacteria 983
345 Ga0501214_098138 3300049659 Bacteria 513
346 Ga0501217_152953 3300049661 Bacteria 691
347 Ga0501217_340938 3300049661 Unclassified 503
348 Ga0501228_039018 3300049666 Bacteria 611
349 Ga0501241_176977 3300049758 Bacteria 504
350 Ga0501268_021557 3300049765 Bacteria 1106
351 Ga0501268_057877 3300049765 Bacteria 763
352 Ga0501283_136477 3300049779 Bacteria 501
353 nmdc:mga0qj67_316576_c1 3300050509 Unclassified 1263
354 nmdc:mga0qj67_432342_c1 3300050509 Unclassified 1061
355 nmdc:mga06r32_1083596_c1 3300050510 Bacteria 751
356 nmdc:mga06r32_904313_c1 3300050510 Bacteria 839
357 nmdc:mga0rr50_125986_c1 3300050513 Bacteria 2045
358 nmdc:mga08x19_1067538_c1 3300050514 Bacteria 573
359 Ga0495595_0637169 3300053084 Unclassified 545
360 Ga0495619_0314856 3300053085 Unclassified 1084
361 Ga0105249_10000059
362 Ga0058863_11863381
363 Ga0058863_11975220
364 Ga0058861_12076282
365 Ga0058862_12854672
366 Ga0070658_10140037
367 Ga0070658_10410317
368 Ga0070683_100392305
369 Ga0070683_100586494
370 Ga0070683_100983022
371 Ga0070670_100107977
372 Ga0070670_100462201
373 Ga0070677_10670571
374 Ga0068869_102054412
375 Ga0070666_10145391
376 Ga0070680_100002243
377 Ga0070680_100322542
378 Ga0070680_100551490
379 Ga0070682_101818806
380 Ga0070682_102013890
381 Ga0068868_100122745
382 Ga0070660_100073712
383 Ga0070660_100148631
384 Ga0070691_10044896
385 Ga0070687_100043346
386 Ga0070661_100361476
387 Ga0070661_100991606
388 Ga0070692_11228320
389 Ga0070668_100006799
390 Ga0070669_100000619
391 Ga0070669_100152150
392 Ga0070675_100139290
393 Ga0070673_100273113
394 Ga0070688_100047880
395 Ga0070688_100842660
396 Ga0070659_100760514
397 Ga0070659_101598181
398 Ga0070667_100041050
399 Ga0070667_100429379
400 Ga0070667_101760069
401 Ga0070714_100018323
402 Ga0070713_100016790
403 Ga0070713_101230086
404 Ga0070710_10458699
405 Ga0070705_100209049
406 Ga0070694_100026851
407 Ga0070708_100475727
408 Ga0070663_100304327
409 Ga0070678_100541742
410 Ga0070662_100642953
411 Ga0070681_10005714
412 Ga0070681_10025640
413 Ga0070681_10032455
414 Ga0070681_10112242
415 Ga0070681_11552009
416 Ga0070685_10027973
417 Ga0070699_100014707
418 Ga0070699_100070699
419 Ga0070699_100467933
420 Ga0070679_100006246
421 Ga0070679_100007865
422 Ga0070679_100022784
423 Ga0070679_100360687
424 Ga0070679_100495583
425 Ga0070684_100006002
426 Ga0070684_100133434
427 Ga0070684_100224786
428 Ga0070684_100251076
429 Ga0070684_100275276
430 Ga0070684_101001268
431 Ga0070684_101025320
432 Ga0070684_101680170
433 Ga0070697_100362398
434 Ga0070697_101105410
435 Ga0068853_100740456
436 Ga0070672_100344567
437 Ga0070695_100036630
438 Ga0070696_100010957
439 Ga0070696_100127282
440 Ga0070696_100155719
441 Ga0070693_100302711
442 Ga0070665_100025459
443 Ga0068855_100220094
444 Ga0068855_101122559
445 Ga0068855_101912918
446 Ga0070664_100012855
447 Ga0070664_100037432
448 Ga0070664_100057805
449 Ga0070664_100109966
450 Ga0068857_100246088
451 Ga0068852_100148712
452 Ga0068852_102551732
453 Ga0068859_100013005
454 Ga0068859_100219673
455 Ga0068864_101217283
456 Ga0068870_10043417
457 Ga0068863_100058109
458 Ga0068858_100392972
459 Ga0068860_102306151
460 Ga0068862_100178971
461 Ga0070712_100955583
462 Ga0075430_100463117
463 Ga0075430_101670040
464 Ga0075431_100536455
465 Ga0075429_101456144
466 Ga0068865_100966178
467 Ga0075436_100340748
468 Ga0075436_101030329
469 Ga0097620_100013005
470 Ga0097620_100219691
471 Ga0075435_100103947
472 Ga0075435_100515883
473 Ga0105240_10036364
474 Ga0105242_11624865
475 Ga0105248_10306073
476 Ga0105238_10936078
477 Ga0105249_10701626
478 Ga0105246_10286421
479 Ga0157373_11582678
480 Ga0157370_10025959
481 Ga0157370_10037247
482 Ga0157370_10251534
483 Ga0157370_11889432
484 Ga0157369_10320748
485 Ga0157369_11521878
486 Ga0163162_10005310
487 Ga0163162_10298613
488 Ga0157372_10036335
489 Ga0157372_10178285
490 Ga0157372_10607919
491 Ga0157375_10018747
492 Ga0163163_10009932
493 Ga0163163_10271334
494 Ga0163163_10756453
495 Ga0163163_11261872
496 Ga0157380_12984203
497 Ga0157376_10002620
498 Ga0197907_11343472
499 Ga0206356_11314931
500 Ga0206350_10816124
501 Ga0207682_10055931
502 Ga0207682_10273009
503 Ga0207682_10307552
504 Ga0207642_11024981
505 Ga0207647_10324212
506 Ga0207699_10048824
507 Ga0207643_10003723
508 Ga0207705_10365085
509 Ga0207705_10398177
510 Ga0207707_10011015
511 Ga0207707_10015273
512 Ga0207707_10039475
513 Ga0207707_10041576
514 Ga0207707_10057114
515 Ga0207695_10020679
516 Ga0207695_11739407
517 Ga0207693_10766300
518 Ga0207660_10020559
519 Ga0207660_10078914
520 Ga0207660_10242930
521 Ga0207660_10592984
522 Ga0207660_11498332
523 Ga0207662_10000878
524 Ga0207657_10035924
525 Ga0207649_10105653
526 Ga0207649_10329592
527 Ga0207649_10535598
528 Ga0207652_10004616
529 Ga0207652_10009773
530 Ga0207652_10034346
531 Ga0207652_10320870
532 Ga0207652_10345901
533 Ga0207652_10739785
534 Ga0207681_10155656
535 Ga0207694_10533820
536 Ga0207650_10047445
537 Ga0207659_10257942
538 Ga0207659_10370080
539 Ga0207700_10023364
540 Ga0207644_10087764
541 Ga0207690_10416953
542 Ga0207706_10122740
543 Ga0207691_10100414
544 Ga0207661_10000780
545 Ga0207661_10041672
546 Ga0207661_10108377
547 Ga0207661_10183094
548 Ga0207661_10205603
549 Ga0207661_10366113
550 Ga0207661_10380928
551 Ga0207661_10416704
552 Ga0207661_11122516
553 Ga0207661_11980974
554 Ga0207679_10030781
555 Ga0207679_10046525
556 Ga0207679_10103523
557 Ga0207679_10341961
558 Ga0207679_10573780
559 Ga0207667_10019517
560 Ga0207667_10898962
561 Ga0207712_10000047
562 Ga0207668_10010575
563 Ga0207668_10356243
564 Ga0207640_10199830
565 Ga0207658_10176264
566 Ga0207658_11159701
567 Ga0207677_10100449
568 Ga0207678_10078178
569 Ga0207678_10427658
570 Ga0207678_10950356
571 Ga0207702_10841837
572 Ga0207641_10579731
573 Ga0207676_10294638
574 Ga0207674_10006442
575 Ga0207674_10795795
576 Ga0207683_10359891
577 Ga0207683_11377637
578 Ga0207698_10009259
579 Ga0207698_10800928
580 Ga0207428_10820538
581 Ga0268266_10017763
582 Ga0268266_10335882
583 Ga0268264_11833024
584 Ga0307408_100475893
585 Ga0307408_100968211
586 Ga0307405_10070060
587 Ga0307405_10195473
588 Ga0307413_10155943
589 Ga0307413_10282355
590 Ga0307413_11977068
591 Ga0307410_10001208
592 Ga0307410_10036988
593 Ga0307410_10092172
594 Ga0307410_10117999
595 Ga0307406_10007971
596 Ga0307406_10084415
597 Ga0307406_11437772
598 Ga0307407_10003041
599 Ga0307407_10005702
600 Ga0307407_10028968
601 Ga0307407_10671997
602 Ga0307407_11013606
603 Ga0307412_10044087
604 Ga0307412_10078988
605 Ga0307412_10241444
606 Ga0307409_100000231
607 Ga0307409_100063984
608 Ga0307409_100463604
609 Ga0307409_100590527
610 Ga0307416_100006293
611 Ga0307416_100300778
612 Ga0307416_100396738
613 Ga0307416_100756722
614 Ga0307414_10002624
615 Ga0307414_10178153
616 Ga0307411_10005223
617 Ga0307411_10042470
618 Ga0307411_10104117
619 Ga0307415_100026567
620 Ga0307415_100037545
621 Ga0307415_100047371
622 Ga0307415_100162824
623 Ga0307415_101113293
624 Ga0373936_0189543
625 Ga0373945_0591122
626 Ga0373953_0046246
627 Ga0373954_0026248
628 Ga0373956_0119439
629 Ga0373957_0017520
630 Ga0373955_0164395
631 Ga0373924_0223687
632 Ga0373933_0030863
633 Ga0373937_0088870
634 Ga0373937_0120154
635 Ga0395899_0014058
636 Ga0395900_0305950
637 Ga0395898_0315865
638 Ga0395905_0010628
639 Ga0395901_0002424
640 Ga0451807_0002820
641 Ga0451849_0035331
642 Ga0466966_0777253
643 Ga0466959_0280914
644 Ga0466958_0598502
645 Ga0495592_0028390
646 Ga0495592_0152203
647 Ga0495592_0557032
648 Ga0495651_0024852
649 Ga0495651_0045804
650 Ga0495653_0191092
651 Ga0495653_0347487
652 Ga0495662_0064188
653 Ga0495594_0616988
654 Ga0495608_0008855
655 Ga0495608_0683974
656 Ga0495608_0933141
657 Ga0495618_0765469
658 Ga0495620_0261825
659 Ga0495628_0217201
660 Ga0495630_0121040
661 Ga0495630_1464276
662 Ga0495663_0057147
663 Ga0495663_0064303
664 Ga0495642_0306735
665 Ga0495652_0479362
666 Ga0495652_1027528
667 Ga0495640_0118317
668 Ga0495640_0684684
669 Ga0495587_0058774
670 Ga0495598_0284486
671 Ga0495621_0031108
672 Ga0495621_0075394
673 Ga0495621_0273183
674 Ga0495645_0814781
675 Ga0495667_0313752
676 Ga0495634_0225712
677 Ga0495635_0269999
678 Ga0495659_0252537
679 Ga0495657_0064939
680 Ga0495599_0024880
681 Ga0495599_0119768
682 Ga0495599_0249581
683 Ga0495623_0086443
684 Ga0495646_0599434
685 Ga0495613_0058648
686 Ga0495624_0169477
687 Ga0495600_0107949
688 Ga0495600_0301811
689 Ga0495604_0195115
690 Ga0495604_0505096
691 Ga0495674_1032827
692 Ga0495680_0016155
693 Ga0495680_0064896
694 Ga0495675_0022675
695 Ga0495675_0153628
696 Ga0495675_0203497
697 Ga0495675_0272169
698 Ga0495685_014700
699 Ga0495684_0040200
700 Ga0495684_0815459
701 Ga0495602_0346810
702 Ga0496104_0351009
703 Ga0501198_047516
704 Ga0501202_042773
705 Ga0501214_098138
706 Ga0501217_152953
707 Ga0501217_340938
708 Ga0501228_039018
709 Ga0501241_176977
710 Ga0501268_021557
711 Ga0501268_057877
712 Ga0501283_136477
713 nmdc:mga0qj67_316576_c1
714 nmdc:mga0qj67_432342_c1
715 nmdc:mga06r32_1083596_c1
716 nmdc:mga06r32_904313_c1
717 nmdc:mga0rr50_125986_c1
718 nmdc:mga08x19_1067538_c1
719 Ga0495595_0637169
720 Ga0495619_0314856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k9f-assembly1.cif.gz_A crystal structure of a nipsnap domain protein from burkholderia xenovorans 0.8153 1 101
1xbw-assembly2.cif.gz_C 1.9a crystal structure of the protein isdg from staphylococcus aureus aureus, structural genomics, mcsg 0.7916 2 103
1iuj-assembly1.cif.gz_B the structure of tt1380 protein from thermus thermophilus 0.7774 1 102
2bbe-assembly1.cif.gz_A crystal structure of protein so0527 from shewanella oneidensis 0.7742 2 99
1xbw-assembly1.cif.gz_A 1.9a crystal structure of the protein isdg from staphylococcus aureus aureus, structural genomics, mcsg 0.7728 2 103
ID Description Score Start End Superfamily
af_F6NVH9_176_279_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8469 2 101 3.30.70.100
5k9fA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8153 1 101 3.30.70.100
af_Q54I58_127_223_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7747 1 101 3.30.70.100
2bbeA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7742 2 99 3.30.70.100
1xbwA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7728 2 103 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A1Q7EAY0-F1-model_v4 Uncharacterized protein 0.9794 1 103
AF-A0A1Q7EAY0-F1-model_v4 Uncharacterized protein 0.9702 1 103
AF-A0A2V7N1B4-F1-model_v4 EthD domain-containing protein 0.9642 1 103
AF-A0A524HLC2-F1-model_v4 Uncharacterized protein 0.8988 1 101
AF-A0A6L3C7T0-F1-model_v4 NIPSNAP domain-containing protein 0.893 2 103

Map