F421787

General Info

Members Datasets Scaffolds Average Seq Length
360 170 360 311

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10009519|Ga0070709_100095193
Length 359
Sequence VFLACQTGSDVSHEIVGRLCETPIQVHQLIKTFLKIEAAGAEQHEWVGQTSERAAAIKSKPLQLAAILLLMSFLQANPSLAGDTKIWEEFSGEKALAHVQRLVDLGPHPGGSAAIEKARDYIEEQLRHSGWQVTRQAFTDDTPRGKIHFVNLIARFPGDANAASPSFLLCSHYDTKLFDTIRFVGANDGGSSTGLLLELARVIGQHPSLARKLELAFFDGEEAYENFSDTDGLYGSRYFARRLQGEGAKQFRGGILFDMVGDRSLGITLPADSPAAMARDVFAAAEALKLRKYFSYLDRDLIDDHAPLNAIGIPTIDIIDFDYPWWHTADDTMDKISAQSLQIVGSVAVYYLSEFGLKR

Samples

Sample ID Description Type Environment
1 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.89
Rhizosphere 90.56
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24035J26624_1000559 3300002126 Unclassified 3452
2 JGI25405J52794_10000506 3300003911 Bacteria 5626
3 Ga0065704_10024117 3300005289 Bacteria 1644
4 Ga0065704_10030013 3300005289 Bacteria 1394
5 Ga0065704_10175728 3300005289 Bacteria 1265
6 Ga0065712_10002140 3300005290 Bacteria 5131
7 Ga0065712_10003323 3300005290 Bacteria 6665
8 Ga0065712_10008756 3300005290 Unclassified 3011
9 Ga0065715_10004108 3300005293 Bacteria 5129
10 Ga0065715_10017548 3300005293 Bacteria 3466
11 Ga0065715_10091062 3300005293 Bacteria 6158
12 Ga0065707_10009213 3300005295 Bacteria 2265
13 Ga0070676_10029872 3300005328 Bacteria 3103
14 Ga0070676_10032258 3300005328 Bacteria 3000
15 Ga0070676_10035739 3300005328 Bacteria 2859
16 Ga0070683_100013209 3300005329 Bacteria 7193
17 Ga0070683_100054928 3300005329 Unclassified 3694
18 Ga0070690_100009320 3300005330 Bacteria 5684
19 Ga0070690_100075820 3300005330 Bacteria 2193
20 Ga0070690_100143022 3300005330 Unclassified 1625
21 Ga0070670_100072432 3300005331 Unclassified 2959
22 Ga0070670_100115771 3300005331 Bacteria 2311
23 Ga0070677_10051399 3300005333 Bacteria 1668
24 Ga0068869_100115735 3300005334 Unclassified 2045
25 Ga0070666_10056050 3300005335 Unclassified 2661
26 Ga0068868_100061475 3300005338 Unclassified 2976
27 Ga0068868_100209182 3300005338 Unclassified 1630
28 Ga0070660_100049190 3300005339 Bacteria 3240
29 Ga0070660_100052922 3300005339 Bacteria 3131
30 Ga0070660_100264818 3300005339 Bacteria 1404
31 Ga0070660_100405366 3300005339 Unclassified 1128
32 Ga0070689_100023759 3300005340 Bacteria 4594
33 Ga0070668_100011618 3300005347 Bacteria 6555
34 Ga0070668_100130278 3300005347 Bacteria 2018
35 Ga0070668_100361117 3300005347 Bacteria 1231
36 Ga0070669_100011495 3300005353 Bacteria 6282
37 Ga0070669_100058417 3300005353 Bacteria 2831
38 Ga0070669_100162423 3300005353 Bacteria 1737
39 Ga0070669_100419966 3300005353 Unclassified 1097
40 Ga0070675_100019035 3300005354 Bacteria 5470
41 Ga0070675_100020910 3300005354 Bacteria 5225
42 Ga0070675_100114447 3300005354 Unclassified 2286
43 Ga0070675_100205525 3300005354 Bacteria 1710
44 Ga0070671_100078121 3300005355 Bacteria 2766
45 Ga0070671_100114700 3300005355 Bacteria 2264
46 Ga0070671_100117595 3300005355 Bacteria 2235
47 Ga0070674_100040587 3300005356 Bacteria 3149
48 Ga0070674_100103290 3300005356 Bacteria 2080
49 Ga0070673_100020062 3300005364 Unclassified 4812
50 Ga0070673_100023764 3300005364 Bacteria 4483
51 Ga0070673_100062491 3300005364 Bacteria 2958
52 Ga0070673_100355269 3300005364 Unclassified 1301
53 Ga0070688_100017104 3300005365 Bacteria 4160
54 Ga0070688_100027672 3300005365 Bacteria 3377
55 Ga0070688_100060734 3300005365 Bacteria 2388
56 Ga0070667_100056202 3300005367 Unclassified 3324
57 Ga0070667_100212952 3300005367 Unclassified 1718
58 Ga0070709_10009519 3300005434 Bacteria 5362
59 Ga0070709_10095043 3300005434 Bacteria 1973
60 Ga0070713_100100177 3300005436 Bacteria 2508
61 Ga0070711_100012653 3300005439 Bacteria 5278
62 Ga0070711_100025078 3300005439 Unclassified 3897
63 Ga0070711_100054863 3300005439 Bacteria 2751
64 Ga0070711_100170933 3300005439 Bacteria 1656
65 Ga0070705_100029361 3300005440 Bacteria 3023
66 Ga0070700_100014268 3300005441 Unclassified 4483
67 Ga0070708_100010150 3300005445 Bacteria 7620
68 Ga0070708_100078043 3300005445 Bacteria 2993
69 Ga0070708_100096640 3300005445 Bacteria 2699
70 Ga0070708_100118878 3300005445 Bacteria 2435
71 Ga0070663_100010333 3300005455 Bacteria 5818
72 Ga0070678_100029155 3300005456 Unclassified 3776
73 Ga0070678_100061706 3300005456 Bacteria 2764
74 Ga0070662_100115818 3300005457 Bacteria 2048
75 Ga0070662_100130983 3300005457 Unclassified 1933
76 Ga0070662_100328560 3300005457 Bacteria 1249
77 Ga0070681_10021010 3300005458 Bacteria 6540
78 Ga0070685_10053357 3300005466 Bacteria 2342
79 Ga0070706_100000100 3300005467 Bacteria 104971
80 Ga0070706_100001631 3300005467 Bacteria 23400
81 Ga0070706_100025395 3300005467 Bacteria 5451
82 Ga0070706_100120572 3300005467 Bacteria 2445
83 Ga0070706_100124179 3300005467 Bacteria 2407
84 Ga0070706_100137838 3300005467 Unclassified 2277
85 Ga0070706_100183042 3300005467 Bacteria 1957
86 Ga0070707_100007577 3300005468 Bacteria 10080
87 Ga0070707_100017172 3300005468 Bacteria 6801
88 Ga0070707_100017700 3300005468 Bacteria 6701
89 Ga0070707_100041159 3300005468 Unclassified 4422
90 Ga0070707_100091744 3300005468 Bacteria 2941
91 Ga0070707_100121473 3300005468 Unclassified 2536
92 Ga0070707_100602767 3300005468 Bacteria 1061
93 Ga0070698_100208223 3300005471 Bacteria 1891
94 Ga0070698_100225832 3300005471 Unclassified 1806
95 Ga0070699_100462426 3300005518 Unclassified 1151
96 Ga0070679_100007098 3300005530 Bacteria 10452
97 Ga0070679_100434362 3300005530 Unclassified 1258
98 Ga0070684_100023359 3300005535 Bacteria 5170
99 Ga0070684_100024720 3300005535 Bacteria 5041
100 Ga0070697_100003578 3300005536 Bacteria 11939
101 Ga0070697_100013694 3300005536 Bacteria 6364
102 Ga0070697_100016257 3300005536 Bacteria 5849
103 Ga0070697_100058976 3300005536 Unclassified 3124
104 Ga0070697_100127039 3300005536 Bacteria 2136
105 Ga0070697_100131643 3300005536 Bacteria 2098
106 Ga0070697_100448397 3300005536 Bacteria 1124
107 Ga0070672_100009390 3300005543 Bacteria 6741
108 Ga0070672_100028539 3300005543 Unclassified 4175
109 Ga0070672_100055131 3300005543 Unclassified 3113
110 Ga0070696_100008386 3300005546 Bacteria 6913
111 Ga0070665_100030877 3300005548 Bacteria 5392
112 Ga0070665_100133179 3300005548 Bacteria 2487
113 Ga0070665_100192278 3300005548 Bacteria 2041
114 Ga0070664_100117196 3300005564 Bacteria 2329
115 Ga0070664_100301160 3300005564 Bacteria 1449
116 Ga0068854_100233081 3300005578 Bacteria 1462
117 Ga0068856_100038980 3300005614 Unclassified 4665
118 Ga0068856_100517844 3300005614 Unclassified 1214
119 Ga0070702_100163025 3300005615 Bacteria 1443
120 Ga0068861_100123686 3300005719 Bacteria 2090
121 Ga0068863_100037243 3300005841 Unclassified 4632
122 Ga0068863_100055153 3300005841 Bacteria 3764
123 Ga0068863_100199972 3300005841 Bacteria 1922
124 Ga0068858_100310861 3300005842 Unclassified 1505
125 Ga0081455_10002038 3300005937 Bacteria 24159
126 Ga0081455_10003953 3300005937 Bacteria 16831
127 Ga0081455_10038275 3300005937 Unclassified 4248
128 Ga0081455_10074782 3300005937 Bacteria 2797
129 Ga0081455_10139368 3300005937 Bacteria 1886
130 Ga0081539_10002356 3300005985 Bacteria 27128
131 Ga0081539_10011057 3300005985 Bacteria 7214
132 Ga0070717_10000353 3300006028 Bacteria 29605
133 Ga0070717_10243584 3300006028 Bacteria 1586
134 Ga0070715_10045846 3300006163 Unclassified 1856
135 Ga0070716_100080851 3300006173 Bacteria 1939
136 Ga0070716_100104113 3300006173 Bacteria 1746
137 Ga0070716_100217200 3300006173 Unclassified 1282
138 Ga0070712_100026755 3300006175 Unclassified 3847
139 Ga0070712_100045258 3300006175 Bacteria 3038
140 Ga0070712_100105655 3300006175 Unclassified 2092
141 Ga0070712_100192084 3300006175 Bacteria 1598
142 Ga0097621_100185773 3300006237 Bacteria 1798
143 Ga0097621_100193243 3300006237 Bacteria 1763
144 Ga0075428_100193432 3300006844 Bacteria 2200
145 Ga0105240_10202841 3300009093 Unclassified 2323
146 Ga0105245_10037275 3300009098 Unclassified 4323
147 Ga0105245_10109177 3300009098 Bacteria 2571
148 Ga0114129_10000103 3300009147 Bacteria 83612
149 Ga0114129_10185484 3300009147 Bacteria 2828
150 Ga0114129_10241310 3300009147 Unclassified 2429
151 Ga0114129_10457497 3300009147 Bacteria 1673
152 Ga0105242_10041020 3300009176 Bacteria 3731
153 Ga0105242_10237035 3300009176 Unclassified 1638
154 Ga0105249_10072092 3300009553 Unclassified 3193
155 Ga0105249_10416627 3300009553 Bacteria 1376
156 Ga0105239_10048141 3300010375 Unclassified 4674
157 Ga0105239_10069390 3300010375 Bacteria 3872
158 Ga0105239_10413019 3300010375 Bacteria 1528
159 Ga0105239_10533582 3300010375 Bacteria 1336
160 Ga0105246_10089108 3300011119 Bacteria 2219
161 Ga0157371_10070765 3300013102 Bacteria 2470
162 Ga0157369_10011063 3300013105 Bacteria 10266
163 Ga0157374_10075899 3300013296 Unclassified 3177
164 Ga0157374_10219897 3300013296 Bacteria 1864
165 Ga0157378_10030092 3300013297 Bacteria 4797
166 Ga0163162_10066883 3300013306 Bacteria 3643
167 Ga0163162_10154105 3300013306 Bacteria 2417
168 Ga0163162_10481265 3300013306 Unclassified 1373
169 Ga0157372_10024418 3300013307 Bacteria 6565
170 Ga0157372_10037187 3300013307 Bacteria 5367
171 Ga0157372_10255660 3300013307 Unclassified 2034
172 Ga0157372_10302385 3300013307 Bacteria 1861
173 Ga0157372_10322611 3300013307 Unclassified 1798
174 Ga0157375_10015060 3300013308 Bacteria 6916
175 Ga0157375_10509710 3300013308 Unclassified 1367
176 Ga0163163_10219045 3300014325 Bacteria 1952
177 Ga0163163_10294461 3300014325 Bacteria 1675
178 Ga0163163_10708181 3300014325 Unclassified 1070
179 Ga0157379_10328223 3300014968 Unclassified 1398
180 Ga0157376_10230467 3300014969 Unclassified 1720
181 Ga0207666_1001110 3300025271 Bacteria 3184
182 Ga0207673_1000285 3300025290 Bacteria 5142
183 Ga0207697_10000361 3300025315 Bacteria 25436
184 Ga0207697_10000391 3300025315 Bacteria 24629
185 Ga0207697_10001610 3300025315 Bacteria 12182
186 Ga0207697_10001716 3300025315 Bacteria 11781
187 Ga0207697_10002578 3300025315 Bacteria 9335
188 Ga0207697_10016546 3300025315 Bacteria 3037
189 Ga0207697_10020385 3300025315 Bacteria 2714
190 Ga0207697_10040265 3300025315 Bacteria 1919
191 Ga0207682_10055961 3300025893 Bacteria 1641
192 Ga0207642_10020287 3300025899 Bacteria 2591
193 Ga0207688_10000772 3300025901 Bacteria 15940
194 Ga0207688_10035120 3300025901 Bacteria 2777
195 Ga0207688_10193920 3300025901 Bacteria 1216
196 Ga0207680_10028958 3300025903 Bacteria 3106
197 Ga0207680_10076411 3300025903 Unclassified 2091
198 Ga0207647_10036701 3300025904 Bacteria 3112
199 Ga0207685_10052994 3300025905 Unclassified 1574
200 Ga0207699_10039033 3300025906 Bacteria 2725
201 Ga0207699_10055158 3300025906 Bacteria 2364
202 Ga0207645_10001615 3300025907 Bacteria 18377
203 Ga0207684_10000128 3300025910 Bacteria 139233
204 Ga0207684_10004361 3300025910 Bacteria 13367
205 Ga0207684_10014170 3300025910 Bacteria 6881
206 Ga0207684_10162335 3300025910 Bacteria 1924
207 Ga0207707_10007556 3300025912 Bacteria 9470
208 Ga0207693_10007666 3300025915 Bacteria 8865
209 Ga0207693_10012851 3300025915 Bacteria 6756
210 Ga0207693_10020250 3300025915 Bacteria 5292
211 Ga0207663_10084704 3300025916 Bacteria 2085
212 Ga0207663_10161494 3300025916 Bacteria 1582
213 Ga0207662_10001771 3300025918 Bacteria 10599
214 Ga0207662_10058898 3300025918 Bacteria 2301
215 Ga0207662_10222767 3300025918 Bacteria 1229
216 Ga0207657_10131966 3300025919 Bacteria 2047
217 Ga0207657_10193295 3300025919 Unclassified 1640
218 Ga0207657_10299752 3300025919 Unclassified 1273
219 Ga0207649_10026090 3300025920 Unclassified 3415
220 Ga0207649_10118820 3300025920 Bacteria 1779
221 Ga0207652_10040386 3300025921 Unclassified 3962
222 Ga0207646_10004673 3300025922 Bacteria 14758
223 Ga0207646_10025509 3300025922 Bacteria 5407
224 Ga0207646_10033268 3300025922 Unclassified 4665
225 Ga0207646_10061732 3300025922 Bacteria 3345
226 Ga0207646_10077293 3300025922 Unclassified 2975
227 Ga0207646_10182597 3300025922 Bacteria 1895
228 Ga0207646_10263615 3300025922 Unclassified 1557
229 Ga0207681_10237005 3300025923 Bacteria 1418
230 Ga0207659_10007222 3300025926 Bacteria 6825
231 Ga0207659_10020822 3300025926 Bacteria 4342
232 Ga0207659_10029833 3300025926 Bacteria 3721
233 Ga0207659_10163598 3300025926 Bacteria 1749
234 Ga0207659_10376507 3300025926 Bacteria 1183
235 Ga0207700_10025274 3300025928 Unclassified 4122
236 Ga0207644_10019233 3300025931 Bacteria 4629
237 Ga0207644_10208558 3300025931 Bacteria 1544
238 Ga0207690_10045637 3300025932 Bacteria 2896
239 Ga0207690_10070228 3300025932 Bacteria 2412
240 Ga0207690_10254038 3300025932 Bacteria 1359
241 Ga0207706_10001926 3300025933 Bacteria 20387
242 Ga0207706_10034903 3300025933 Bacteria 4474
243 Ga0207706_10087092 3300025933 Bacteria 2746
244 Ga0207706_10171663 3300025933 Bacteria 1905
245 Ga0207706_10350287 3300025933 Bacteria 1284
246 Ga0207686_10028249 3300025934 Bacteria 3295
247 Ga0207686_10038064 3300025934 Bacteria 2908
248 Ga0207670_10111387 3300025936 Bacteria 1973
249 Ga0207669_10038991 3300025937 Bacteria 2741
250 Ga0207669_10061099 3300025937 Bacteria 2313
251 Ga0207665_10060233 3300025939 Unclassified 2570
252 Ga0207665_10115642 3300025939 Unclassified 1890
253 Ga0207665_10305854 3300025939 Unclassified 1190
254 Ga0207691_10007521 3300025940 Bacteria 10485
255 Ga0207691_10017306 3300025940 Bacteria 6836
256 Ga0207689_10153533 3300025942 Unclassified 1898
257 Ga0207661_10045536 3300025944 Bacteria 3473
258 Ga0207661_10100030 3300025944 Bacteria 2433
259 Ga0207661_10123936 3300025944 Bacteria 2204
260 Ga0207661_10377704 3300025944 Bacteria 1282
261 Ga0207679_10108834 3300025945 Bacteria 2183
262 Ga0207651_10022092 3300025960 Unclassified 3882
263 Ga0207651_10138542 3300025960 Unclassified 1875
264 Ga0207651_10200329 3300025960 Bacteria 1599
265 Ga0207668_10011867 3300025972 Bacteria 5312
266 Ga0207668_10059961 3300025972 Bacteria 2669
267 Ga0207668_10324866 3300025972 Bacteria 1278
268 Ga0207640_10202803 3300025981 Bacteria 1504
269 Ga0207658_10025145 3300025986 Unclassified 4168
270 Ga0207658_10343347 3300025986 Unclassified 1298
271 Ga0207677_10031369 3300026023 Bacteria 3403
272 Ga0207677_10140968 3300026023 Bacteria 1845
273 Ga0207703_10025206 3300026035 Unclassified 4678
274 Ga0207703_10396398 3300026035 Unclassified 1280
275 Ga0207702_10192513 3300026078 Bacteria 1885
276 Ga0207641_10056210 3300026088 Bacteria 3343
277 Ga0207641_10119562 3300026088 Unclassified 2349
278 Ga0207675_100164176 3300026118 Bacteria 2120
279 Ga0207683_10008431 3300026121 Bacteria 8822
280 Ga0207683_10014342 3300026121 Bacteria 6752
281 Ga0207683_10070402 3300026121 Bacteria 3090
282 Ga0268266_10017633 3300028379 Bacteria 6087
283 Ga0268266_10073478 3300028379 Bacteria 2967
284 Ga0268264_10042179 3300028381 Bacteria 3777
285 Ga0268264_10165266 3300028381 Unclassified 1997
286 Ga0268264_10350209 3300028381 Bacteria 1406
287 Ga0373945_0034120 3300035116 Bacteria 1812
288 Ga0373953_0040848 3300035117 Bacteria 1844
289 Ga0373943_0017088 3300035170 Bacteria 3318
290 Ga0373955_0050341 3300035172 Bacteria 2265
291 Ga0373935_0005347 3300035692 Bacteria 7562
292 Ga0373947_0008594 3300035725 Bacteria 5880
293 Ga0373947_0037367 3300035725 Unclassified 2882
294 Ga0373937_0198308 3300036401 Bacteria 1887
295 Ga0373937_0220177 3300036401 Bacteria 1787
296 Ga0373925_0131736 3300037068 Bacteria 1950
297 Ga0373925_0181772 3300037068 Unclassified 1665
298 Ga0395899_0088825 3300037312 Unclassified 2242
299 Ga0395900_0058207 3300037418 Unclassified 3978
300 Ga0395900_0235823 3300037418 Unclassified 1838
301 Ga0395898_0026807 3300037466 Bacteria 5792
302 Ga0395898_0316555 3300037466 Bacteria 1489
303 Ga0395905_0004291 3300037471 Bacteria 14863
304 Ga0395901_0000939 3300038443 Bacteria 31708
305 Ga0451853_1182859 3300041512 Unclassified 2099
306 Ga0451853_3501839 3300041512 Bacteria 1224
307 Ga0451576_0168791 3300045051 Unclassified 2284
308 Ga0466967_0060749 3300045976 Unclassified 3351
309 Ga0466967_0174742 3300045976 Bacteria 2023
310 Ga0495592_0006457 3300046454 Bacteria 8730
311 Ga0495592_0256719 3300046454 Bacteria 1153
312 Ga0495629_0397514 3300046459 Unclassified 937
313 Ga0495653_0072010 3300046463 Bacteria 2582
314 Ga0495628_0138054 3300046516 Unclassified 1862
315 Ga0495666_0167050 3300046526 Unclassified 1019
316 Ga0495645_0001591 3300046543 Bacteria 15353
317 Ga0495623_0008269 3300046679 Bacteria 6767
318 Ga0495647_0078459 3300046681 Unclassified 1335
319 Ga0495669_0057476 3300046684 Bacteria 1755
320 Ga0495675_0008517 3300047444 Bacteria 6354
321 Ga0495602_0014474 3300048088 Bacteria 8008
322 Ga0496100_0029300 3300048903 Bacteria 3403
323 Ga0496101_0019309 3300048904 Bacteria 4651
324 Ga0496102_0157217 3300048905 Bacteria 2137
325 Ga0496102_0191064 3300048905 Bacteria 1929
326 Ga0496102_0197130 3300048905 Bacteria 1898
327 Ga0496103_0032995 3300048906 Bacteria 3162
328 Ga0496104_0053814 3300048907 Bacteria 3804
329 Ga0496104_0064790 3300048907 Bacteria 3466
330 Ga0496104_0114181 3300048907 Unclassified 2590
331 Ga0496105_0030462 3300048908 Unclassified 4421
332 Ga0496105_0375574 3300048908 Unclassified 1132
333 Ga0496106_0010413 3300048909 Bacteria 6866
334 Ga0496107_0004833 3300048910 Bacteria 9148
335 Ga0496109_0079015 3300048912 Bacteria 3030
336 Ga0496109_0140315 3300048912 Bacteria 2260
337 Ga0496109_0179267 3300048912 Unclassified 1989
338 Ga0496109_0576517 3300048912 Unclassified 1061
339 Ga0496110_0041468 3300048913 Unclassified 4017
340 Ga0496110_0096067 3300048913 Bacteria 2655
341 Ga0496111_0176540 3300048914 Bacteria 1588
342 Ga0496112_0012303 3300048915 Bacteria 7859
343 Ga0496112_0038196 3300048915 Unclassified 4689
344 Ga0496112_0058268 3300048915 Bacteria 3803
345 Ga0496113_0012262 3300048916 Bacteria 5755
346 Ga0496113_0099257 3300048916 Bacteria 2255
347 Ga0496113_0163430 3300048916 Bacteria 1761
348 Ga0496114_0035302 3300048917 Bacteria 4128
349 Ga0496115_0012099 3300048918 Bacteria 6489
350 Ga0496115_0016726 3300048918 Bacteria 5589
351 Ga0496115_0053726 3300048918 Unclassified 3233
352 Ga0496115_0072374 3300048918 Bacteria 2797
353 Ga0496115_0189929 3300048918 Unclassified 1697
354 nmdc:mga05p37_12758_c1 3300050507 Bacteria 10044
355 nmdc:mga05p37_187088_c1 3300050507 Unclassified 2517
356 nmdc:mga05p37_620706_c1 3300050507 Unclassified 1216
357 nmdc:mga08x19_262782_c1 3300050514 Bacteria 1193
358 nmdc:mga0a205_488277_c1 3300050515 Unclassified 1089
359 Ga0495601_0048391 3300053077 Bacteria 2677
360 Ga0495619_0191796 3300053085 Bacteria 1414

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035170 Ga0373943_0017088 Ga0373943_0017088_2333_3178 281
2 3300035725 Ga0373947_0008594 Ga0373947_0008594_1432_2277 281
3 3300037068 Ga0373925_0181772 Ga0373925_0181772_502_1347 281
4 3300046681 Ga0495647_0078459 Ga0495647_0078459_13_858 281
5 3300045976 Ga0466967_0060749 Ga0466967_0060749_303_1157 283
6 3300025315 Ga0207697_10001610 Ga0207697_100016103 286
7 3300025944 Ga0207661_10045536 Ga0207661_100455362 286
8 3300026035 Ga0207703_10025206 Ga0207703_100252062 286
9 3300028381 Ga0268264_10042179 Ga0268264_100421792 286
10 3300009093 Ga0105240_10202841 Ga0105240_102028412 287
11 3300009147 Ga0114129_10457497 Ga0114129_104574972 287
12 3300013307 Ga0157372_10024418 Ga0157372_100244186 287
13 3300005536 Ga0070697_100003578 Ga0070697_1000035782 288
14 3300048916 Ga0496113_0099257 Ga0496113_0099257_267_1172 288
15 3300006844 Ga0075428_100193432 Ga0075428_1001934322 289
16 3300013105 Ga0157369_10011063 Ga0157369_100110638 289
17 3300013296 Ga0157374_10075899 Ga0157374_100758993 289
18 3300013307 Ga0157372_10037187 Ga0157372_100371872 289
19 3300014325 Ga0163163_10708181 Ga0163163_107081811 289
20 3300046454 Ga0495592_0006457 Ga0495592_0006457_1102_1974 289
21 3300046543 Ga0495645_0001591 Ga0495645_0001591_960_1832 289
22 3300036401 Ga0373937_0220177 Ga0373937_0220177_131_1006 290
23 3300046459 Ga0495629_0397514 Ga0495629_0397514_37_912 290
24 3300050515 nmdc:mga0a205_488277_c1 nmdc:mga0a205_488277_c1_52_924 290
25 3300010375 Ga0105239_10069390 Ga0105239_100693903 291
26 3300048918 Ga0496115_0072374 Ga0496115_0072374_1886_2764 291
27 3300005467 Ga0070706_100120572 Ga0070706_1001205722 292
28 3300048912 Ga0496109_0576517 Ga0496109_0576517_51_929 292
29 3300048907 Ga0496104_0114181 Ga0496104_0114181_134_1030 294
30 3300048908 Ga0496105_0030462 Ga0496105_0030462_2887_3783 294
31 3300048915 Ga0496112_0038196 Ga0496112_0038196_568_1464 294
32 3300048916 Ga0496113_0163430 Ga0496113_0163430_205_1101 294
33 3300048918 Ga0496115_0189929 Ga0496115_0189929_10_906 294
34 3300005467 Ga0070706_100137838 Ga0070706_1001378382 296
35 3300005468 Ga0070707_100091744 Ga0070707_1000917444 296
36 3300005985 Ga0081539_10002356 Ga0081539_1000235620 296
37 3300041512 Ga0451853_3501839 Ga0451853_3501839_124_1041 296
38 3300005468 Ga0070707_100041159 Ga0070707_1000411592 297
39 3300005536 Ga0070697_100016257 Ga0070697_1000162574 297
40 3300025915 Ga0207693_10012851 Ga0207693_100128513 297
41 3300025922 Ga0207646_10033268 Ga0207646_100332683 297
42 3300036401 Ga0373937_0198308 Ga0373937_0198308_375_1298 298
43 3300037466 Ga0395898_0316555 Ga0395898_0316555_207_1175 298
44 3300005289 Ga0065704_10024117 Ga0065704_100241172 299
45 3300005293 Ga0065715_10017548 Ga0065715_100175483 299
46 3300005328 Ga0070676_10029872 Ga0070676_100298722 299
47 3300005331 Ga0070670_100072432 Ga0070670_1000724323 299
48 3300005333 Ga0070677_10051399 Ga0070677_100513992 299
49 3300005339 Ga0070660_100052922 Ga0070660_1000529223 299
50 3300005347 Ga0070668_100011618 Ga0070668_1000116185 299
51 3300005353 Ga0070669_100011495 Ga0070669_1000114956 299
52 3300005355 Ga0070671_100117595 Ga0070671_1001175952 299
53 3300005356 Ga0070674_100040587 Ga0070674_1000405873 299
54 3300005364 Ga0070673_100023764 Ga0070673_1000237645 299
55 3300005434 Ga0070709_10095043 Ga0070709_100950432 299
56 3300005439 Ga0070711_100170933 Ga0070711_1001709332 299
57 3300005456 Ga0070678_100061706 Ga0070678_1000617062 299
58 3300005457 Ga0070662_100115818 Ga0070662_1001158182 299
59 3300005530 Ga0070679_100434362 Ga0070679_1004343622 299
60 3300005543 Ga0070672_100009390 Ga0070672_1000093906 299
61 3300005546 Ga0070696_100008386 Ga0070696_1000083863 299
62 3300005548 Ga0070665_100192278 Ga0070665_1001922782 299
63 3300005578 Ga0068854_100233081 Ga0068854_1002330812 299
64 3300005615 Ga0070702_100163025 Ga0070702_1001630251 299
65 3300005841 Ga0068863_100199972 Ga0068863_1001999722 299
66 3300006173 Ga0070716_100104113 Ga0070716_1001041132 299
67 3300006175 Ga0070712_100045258 Ga0070712_1000452582 299
68 3300009098 Ga0105245_10109177 Ga0105245_101091772 299
69 3300009147 Ga0114129_10185484 Ga0114129_101854842 299
70 3300009176 Ga0105242_10041020 Ga0105242_100410202 299
71 3300010375 Ga0105239_10533582 Ga0105239_105335822 299
72 3300011119 Ga0105246_10089108 Ga0105246_100891082 299
73 3300013296 Ga0157374_10219897 Ga0157374_102198972 299
74 3300013306 Ga0163162_10066883 Ga0163162_100668832 299
75 3300013307 Ga0157372_10302385 Ga0157372_103023852 299
76 3300014325 Ga0163163_10294461 Ga0163163_102944612 299
77 3300025315 Ga0207697_10000391 Ga0207697_100003918 299
78 3300025893 Ga0207682_10055961 Ga0207682_100559612 299
79 3300025899 Ga0207642_10020287 Ga0207642_100202872 299
80 3300025901 Ga0207688_10000772 Ga0207688_1000077211 299
81 3300025906 Ga0207699_10039033 Ga0207699_100390332 299
82 3300025907 Ga0207645_10001615 Ga0207645_1000161514 299
83 3300025916 Ga0207663_10161494 Ga0207663_101614942 299
84 3300025919 Ga0207657_10131966 Ga0207657_101319662 299
85 3300025926 Ga0207659_10007222 Ga0207659_100072224 299
86 3300025931 Ga0207644_10019233 Ga0207644_100192333 299
87 3300025932 Ga0207690_10254038 Ga0207690_102540382 299
88 3300025933 Ga0207706_10034903 Ga0207706_100349034 299
89 3300025934 Ga0207686_10028249 Ga0207686_100282492 299
90 3300025937 Ga0207669_10061099 Ga0207669_100610992 299
91 3300025939 Ga0207665_10115642 Ga0207665_101156421 299
92 3300025940 Ga0207691_10007521 Ga0207691_100075218 299
93 3300025972 Ga0207668_10011867 Ga0207668_100118672 299
94 3300025981 Ga0207640_10202803 Ga0207640_102028032 299
95 3300026023 Ga0207677_10031369 Ga0207677_100313694 299
96 3300026078 Ga0207702_10192513 Ga0207702_101925132 299
97 3300026121 Ga0207683_10014342 Ga0207683_100143422 299
98 3300028381 Ga0268264_10350209 Ga0268264_103502092 299
99 3300037068 Ga0373925_0131736 Ga0373925_0131736_93_1001 299
100 3300048903 Ga0496100_0029300 Ga0496100_0029300_735_1643 299
101 3300048904 Ga0496101_0019309 Ga0496101_0019309_2619_3527 299
102 3300048905 Ga0496102_0191064 Ga0496102_0191064_414_1322 299
103 3300048906 Ga0496103_0032995 Ga0496103_0032995_512_1420 299
104 3300048907 Ga0496104_0053814 Ga0496104_0053814_354_1262 299
105 3300048909 Ga0496106_0010413 Ga0496106_0010413_1970_2878 299
106 3300048910 Ga0496107_0004833 Ga0496107_0004833_6947_7855 299
107 3300048912 Ga0496109_0079015 Ga0496109_0079015_889_1797 299
108 3300048913 Ga0496110_0096067 Ga0496110_0096067_543_1451 299
109 3300048914 Ga0496111_0176540 Ga0496111_0176540_354_1262 299
110 3300048915 Ga0496112_0058268 Ga0496112_0058268_1538_2446 299
111 3300048918 Ga0496115_0016726 Ga0496115_0016726_4327_5235 299
112 3300050507 nmdc:mga05p37_187088_c1 nmdc:mga05p37_187088_c1_668_1579 299
113 3300005468 Ga0070707_100017700 Ga0070707_1000177002 300
114 3300005536 Ga0070697_100131643 Ga0070697_1001316433 300
115 3300025922 Ga0207646_10025509 Ga0207646_100255092 300
116 3300025922 Ga0207646_10182597 Ga0207646_101825972 300
117 3300025972 Ga0207668_10059961 Ga0207668_100599612 300
118 3300035116 Ga0373945_0034120 Ga0373945_0034120_281_1210 300
119 3300003911 JGI25405J52794_10000506 JGI25405J52794_100005062 301
120 3300005445 Ga0070708_100096640 Ga0070708_1000966402 301
121 3300005468 Ga0070707_100121473 Ga0070707_1001214732 301
122 3300005471 Ga0070698_100208223 Ga0070698_1002082232 301
123 3300005536 Ga0070697_100058976 Ga0070697_1000589763 301
124 3300005536 Ga0070697_100127039 Ga0070697_1001270392 301
125 3300005937 Ga0081455_10003953 Ga0081455_1000395311 301
126 3300005937 Ga0081455_10074782 Ga0081455_100747822 301
127 3300025918 Ga0207662_10001771 Ga0207662_100017715 301
128 3300025922 Ga0207646_10061732 Ga0207646_100617322 301
129 3300028381 Ga0268264_10165266 Ga0268264_101652661 301
130 3300048907 Ga0496104_0064790 Ga0496104_0064790_1864_2865 301
131 3300048917 Ga0496114_0035302 Ga0496114_0035302_858_1859 301
132 3300048918 Ga0496115_0053726 Ga0496115_0053726_1173_2174 301
133 3300005289 Ga0065704_10030013 Ga0065704_100300132 302
134 3300005290 Ga0065712_10002140 Ga0065712_100021403 302
135 3300005290 Ga0065712_10008756 Ga0065712_100087562 302
136 3300005293 Ga0065715_10004108 Ga0065715_100041083 302
137 3300005328 Ga0070676_10035739 Ga0070676_100357393 302
138 3300005330 Ga0070690_100009320 Ga0070690_1000093204 302
139 3300005330 Ga0070690_100075820 Ga0070690_1000758202 302
140 3300005330 Ga0070690_100143022 Ga0070690_1001430222 302
141 3300005331 Ga0070670_100115771 Ga0070670_1001157712 302
142 3300005338 Ga0068868_100209182 Ga0068868_1002091822 302
143 3300005347 Ga0070668_100130278 Ga0070668_1001302781 302
144 3300005347 Ga0070668_100361117 Ga0070668_1003611172 302
145 3300005353 Ga0070669_100162423 Ga0070669_1001624231 302
146 3300005353 Ga0070669_100419966 Ga0070669_1004199661 302
147 3300005354 Ga0070675_100019035 Ga0070675_1000190354 302
148 3300005354 Ga0070675_100020910 Ga0070675_1000209103 302
149 3300005355 Ga0070671_100078121 Ga0070671_1000781212 302
150 3300005364 Ga0070673_100062491 Ga0070673_1000624912 302
151 3300005364 Ga0070673_100355269 Ga0070673_1003552691 302
152 3300005365 Ga0070688_100027672 Ga0070688_1000276723 302
153 3300005367 Ga0070667_100056202 Ga0070667_1000562023 302
154 3300005367 Ga0070667_100212952 Ga0070667_1002129522 302
155 3300005439 Ga0070711_100012653 Ga0070711_1000126532 302
156 3300005445 Ga0070708_100118878 Ga0070708_1001188782 302
157 3300005457 Ga0070662_100130983 Ga0070662_1001309832 302
158 3300005457 Ga0070662_100328560 Ga0070662_1003285602 302
159 3300005468 Ga0070707_100007577 Ga0070707_1000075778 302
160 3300005543 Ga0070672_100028539 Ga0070672_1000285392 302
161 3300005543 Ga0070672_100055131 Ga0070672_1000551312 302
162 3300005548 Ga0070665_100133179 Ga0070665_1001331792 302
163 3300005564 Ga0070664_100301160 Ga0070664_1003011601 302
164 3300005614 Ga0068856_100517844 Ga0068856_1005178442 302
165 3300005719 Ga0068861_100123686 Ga0068861_1001236861 302
166 3300005842 Ga0068858_100310861 Ga0068858_1003108611 302
167 3300005985 Ga0081539_10011057 Ga0081539_100110575 302
168 3300006163 Ga0070715_10045846 Ga0070715_100458462 302
169 3300006175 Ga0070712_100026755 Ga0070712_1000267552 302
170 3300006237 Ga0097621_100193243 Ga0097621_1001932432 302
171 3300009176 Ga0105242_10237035 Ga0105242_102370352 302
172 3300010375 Ga0105239_10048141 Ga0105239_100481412 302
173 3300013102 Ga0157371_10070765 Ga0157371_100707652 302
174 3300013297 Ga0157378_10030092 Ga0157378_100300924 302
175 3300013307 Ga0157372_10322611 Ga0157372_103226112 302
176 3300014968 Ga0157379_10328223 Ga0157379_103282232 302
177 3300014969 Ga0157376_10230467 Ga0157376_102304672 302
178 3300025271 Ga0207666_1001110 Ga0207666_10011103 302
179 3300025290 Ga0207673_1000285 Ga0207673_10002854 302
180 3300025315 Ga0207697_10002578 Ga0207697_100025783 302
181 3300025315 Ga0207697_10020385 Ga0207697_100203852 302
182 3300025901 Ga0207688_10035120 Ga0207688_100351203 302
183 3300025901 Ga0207688_10193920 Ga0207688_101939201 302
184 3300025903 Ga0207680_10028958 Ga0207680_100289582 302
185 3300025905 Ga0207685_10052994 Ga0207685_100529942 302
186 3300025910 Ga0207684_10162335 Ga0207684_101623351 302
187 3300025915 Ga0207693_10007666 Ga0207693_100076663 302
188 3300025916 Ga0207663_10084704 Ga0207663_100847042 302
189 3300025920 Ga0207649_10118820 Ga0207649_101188202 302
190 3300025926 Ga0207659_10020822 Ga0207659_100208223 302
191 3300025926 Ga0207659_10029833 Ga0207659_100298333 302
192 3300025932 Ga0207690_10070228 Ga0207690_100702282 302
193 3300025933 Ga0207706_10087092 Ga0207706_100870922 302
194 3300025933 Ga0207706_10171663 Ga0207706_101716632 302
195 3300025934 Ga0207686_10038064 Ga0207686_100380642 302
196 3300025936 Ga0207670_10111387 Ga0207670_101113872 302
197 3300025940 Ga0207691_10017306 Ga0207691_100173064 302
198 3300025944 Ga0207661_10100030 Ga0207661_101000302 302
199 3300025960 Ga0207651_10138542 Ga0207651_101385422 302
200 3300025960 Ga0207651_10200329 Ga0207651_102003292 302
201 3300025972 Ga0207668_10324866 Ga0207668_103248662 302
202 3300025986 Ga0207658_10025145 Ga0207658_100251452 302
203 3300025986 Ga0207658_10343347 Ga0207658_103433472 302
204 3300026023 Ga0207677_10140968 Ga0207677_101409682 302
205 3300026035 Ga0207703_10396398 Ga0207703_103963981 302
206 3300026088 Ga0207641_10119562 Ga0207641_101195622 302
207 3300026118 Ga0207675_100164176 Ga0207675_1001641762 302
208 3300026121 Ga0207683_10008431 Ga0207683_100084315 302
209 3300028379 Ga0268266_10073478 Ga0268266_100734782 302
210 3300035692 Ga0373935_0005347 Ga0373935_0005347_6148_7119 302
211 3300037418 Ga0395900_0235823 Ga0395900_0235823_449_1360 302
212 3300045976 Ga0466967_0174742 Ga0466967_0174742_304_1299 302
213 3300046516 Ga0495628_0138054 Ga0495628_0138054_558_1550 302
214 3300046684 Ga0495669_0057476 Ga0495669_0057476_61_990 302
215 3300048905 Ga0496102_0157217 Ga0496102_0157217_925_1896 302
216 3300048908 Ga0496105_0375574 Ga0496105_0375574_63_1034 302
217 3300048912 Ga0496109_0140315 Ga0496109_0140315_16_987 302
218 3300048912 Ga0496109_0179267 Ga0496109_0179267_726_1697 302
219 3300048916 Ga0496113_0012262 Ga0496113_0012262_3522_4493 302
220 3300005328 Ga0070676_10032258 Ga0070676_100322583 303
221 3300005334 Ga0068869_100115735 Ga0068869_1001157351 303
222 3300005338 Ga0068868_100061475 Ga0068868_1000614752 303
223 3300005339 Ga0070660_100405366 Ga0070660_1004053661 303
224 3300005354 Ga0070675_100205525 Ga0070675_1002055251 303
225 3300005436 Ga0070713_100100177 Ga0070713_1001001771 303
226 3300005467 Ga0070706_100001631 Ga0070706_10000163126 303
227 3300005467 Ga0070706_100025395 Ga0070706_1000253952 303
228 3300005467 Ga0070706_100183042 Ga0070706_1001830421 303
229 3300005468 Ga0070707_100602767 Ga0070707_1006027671 303
230 3300005471 Ga0070698_100225832 Ga0070698_1002258322 303
231 3300005536 Ga0070697_100448397 Ga0070697_1004483971 303
232 3300006028 Ga0070717_10000353 Ga0070717_1000035318 303
233 3300006028 Ga0070717_10243584 Ga0070717_102435842 303
234 3300006175 Ga0070712_100105655 Ga0070712_1001056552 303
235 3300006175 Ga0070712_100192084 Ga0070712_1001920842 303
236 3300009553 Ga0105249_10416627 Ga0105249_104166271 303
237 3300010375 Ga0105239_10413019 Ga0105239_104130191 303
238 3300013306 Ga0163162_10481265 Ga0163162_104812651 303
239 3300013307 Ga0157372_10255660 Ga0157372_102556602 303
240 3300013308 Ga0157375_10509710 Ga0157375_105097102 303
241 3300025315 Ga0207697_10000361 Ga0207697_100003611 303
242 3300025910 Ga0207684_10004361 Ga0207684_100043618 303
243 3300025915 Ga0207693_10020250 Ga0207693_100202505 303
244 3300025919 Ga0207657_10193295 Ga0207657_101932951 303
245 3300025923 Ga0207681_10237005 Ga0207681_102370051 303
246 3300025933 Ga0207706_10001926 Ga0207706_100019268 303
247 3300025942 Ga0207689_10153533 Ga0207689_101535332 303
248 3300045051 Ga0451576_0168791 Ga0451576_0168791_191_1105 303
249 3300005289 Ga0065704_10175728 Ga0065704_101757281 304
250 3300005295 Ga0065707_10009213 Ga0065707_100092132 304
251 3300005329 Ga0070683_100013209 Ga0070683_1000132093 304
252 3300005340 Ga0070689_100023759 Ga0070689_1000237593 304
253 3300005445 Ga0070708_100010150 Ga0070708_1000101508 304
254 3300005468 Ga0070707_100017172 Ga0070707_1000171725 304
255 3300005536 Ga0070697_100013694 Ga0070697_1000136947 304
256 3300005841 Ga0068863_100055153 Ga0068863_1000551533 304
257 3300005937 Ga0081455_10002038 Ga0081455_100020387 304
258 3300005937 Ga0081455_10139368 Ga0081455_101393682 304
259 3300009147 Ga0114129_10000103 Ga0114129_1000010312 304
260 3300013306 Ga0163162_10154105 Ga0163162_101541051 304
261 3300025904 Ga0207647_10036701 Ga0207647_100367012 304
262 3300025910 Ga0207684_10014170 Ga0207684_100141708 304
263 3300025918 Ga0207662_10222767 Ga0207662_102227672 304
264 3300025922 Ga0207646_10004673 Ga0207646_100046734 304
265 3300025932 Ga0207690_10045637 Ga0207690_100456373 304
266 3300026088 Ga0207641_10056210 Ga0207641_100562103 304
267 3300037312 Ga0395899_0088825 Ga0395899_0088825_210_1145 304
268 3300037418 Ga0395900_0058207 Ga0395900_0058207_988_1905 304
269 3300037466 Ga0395898_0026807 Ga0395898_0026807_2096_3031 304
270 3300037471 Ga0395905_0004291 Ga0395905_0004291_12655_13590 304
271 3300038443 Ga0395901_0000939 Ga0395901_0000939_13663_14598 304
272 3300048913 Ga0496110_0041468 Ga0496110_0041468_2925_3878 304
273 3300050507 nmdc:mga05p37_12758_c1 nmdc:mga05p37_12758_c1_287_1204 304
274 3300005339 Ga0070660_100049190 Ga0070660_1000491901 305
275 3300005434 Ga0070709_10009519 Ga0070709_100095193 305
276 3300005439 Ga0070711_100025078 Ga0070711_1000250783 305
277 3300005441 Ga0070700_100014268 Ga0070700_1000142681 305
278 3300005445 Ga0070708_100078043 Ga0070708_1000780433 305
279 3300005467 Ga0070706_100124179 Ga0070706_1001241792 305
280 3300005518 Ga0070699_100462426 Ga0070699_1004624261 305
281 3300006173 Ga0070716_100080851 Ga0070716_1000808512 305
282 3300006173 Ga0070716_100217200 Ga0070716_1002172001 305
283 3300025906 Ga0207699_10055158 Ga0207699_100551582 305
284 3300025922 Ga0207646_10077293 Ga0207646_100772932 305
285 3300025928 Ga0207700_10025274 Ga0207700_100252743 305
286 3300025939 Ga0207665_10060233 Ga0207665_100602332 305
287 3300025945 Ga0207679_10108834 Ga0207679_101088342 305
288 3300050507 nmdc:mga05p37_620706_c1 nmdc:mga05p37_620706_c1_48_968 305
289 3300005439 Ga0070711_100054863 Ga0070711_1000548632 306
290 3300005440 Ga0070705_100029361 Ga0070705_1000293613 306
291 3300005467 Ga0070706_100000100 Ga0070706_10000010057 307
292 3300025910 Ga0207684_10000128 Ga0207684_1000012859 307
293 3300025922 Ga0207646_10263615 Ga0207646_102636152 307
294 3300002126 JGI24035J26624_1000559 JGI24035J26624_10005593 308
295 3300005290 Ga0065712_10003323 Ga0065712_100033234 308
296 3300005293 Ga0065715_10091062 Ga0065715_100910624 308
297 3300005329 Ga0070683_100054928 Ga0070683_1000549283 308
298 3300005335 Ga0070666_10056050 Ga0070666_100560502 308
299 3300005339 Ga0070660_100264818 Ga0070660_1002648181 308
300 3300005353 Ga0070669_100058417 Ga0070669_1000584173 308
301 3300005354 Ga0070675_100114447 Ga0070675_1001144472 308
302 3300005355 Ga0070671_100114700 Ga0070671_1001147002 308
303 3300005356 Ga0070674_100103290 Ga0070674_1001032902 308
304 3300005364 Ga0070673_100020062 Ga0070673_1000200624 308
305 3300005365 Ga0070688_100017104 Ga0070688_1000171044 308
306 3300005365 Ga0070688_100060734 Ga0070688_1000607342 308
307 3300005455 Ga0070663_100010333 Ga0070663_1000103334 308
308 3300005456 Ga0070678_100029155 Ga0070678_1000291555 308
309 3300005458 Ga0070681_10021010 Ga0070681_100210104 308
310 3300005466 Ga0070685_10053357 Ga0070685_100533572 308
311 3300005530 Ga0070679_100007098 Ga0070679_1000070986 308
312 3300005535 Ga0070684_100023359 Ga0070684_1000233592 308
313 3300005535 Ga0070684_100024720 Ga0070684_1000247201 308
314 3300005548 Ga0070665_100030877 Ga0070665_1000308774 308
315 3300005564 Ga0070664_100117196 Ga0070664_1001171963 308
316 3300005614 Ga0068856_100038980 Ga0068856_1000389802 308
317 3300005841 Ga0068863_100037243 Ga0068863_1000372435 308
318 3300005937 Ga0081455_10038275 Ga0081455_100382752 308
319 3300006237 Ga0097621_100185773 Ga0097621_1001857732 308
320 3300009098 Ga0105245_10037275 Ga0105245_100372752 308
321 3300009147 Ga0114129_10241310 Ga0114129_102413102 308
322 3300009553 Ga0105249_10072092 Ga0105249_100720923 308
323 3300013308 Ga0157375_10015060 Ga0157375_100150603 308
324 3300014325 Ga0163163_10219045 Ga0163163_102190452 308
325 3300025315 Ga0207697_10001716 Ga0207697_100017165 308
326 3300025315 Ga0207697_10016546 Ga0207697_100165463 308
327 3300025315 Ga0207697_10040265 Ga0207697_100402652 308
328 3300025903 Ga0207680_10076411 Ga0207680_100764112 308
329 3300025912 Ga0207707_10007556 Ga0207707_100075565 308
330 3300025918 Ga0207662_10058898 Ga0207662_100588982 308
331 3300025919 Ga0207657_10299752 Ga0207657_102997522 308
332 3300025920 Ga0207649_10026090 Ga0207649_100260903 308
333 3300025921 Ga0207652_10040386 Ga0207652_100403863 308
334 3300025926 Ga0207659_10163598 Ga0207659_101635982 308
335 3300025926 Ga0207659_10376507 Ga0207659_103765071 308
336 3300025931 Ga0207644_10208558 Ga0207644_102085582 308
337 3300025933 Ga0207706_10350287 Ga0207706_103502871 308
338 3300025937 Ga0207669_10038991 Ga0207669_100389913 308
339 3300025939 Ga0207665_10305854 Ga0207665_103058542 308
340 3300025944 Ga0207661_10123936 Ga0207661_101239362 308
341 3300025944 Ga0207661_10377704 Ga0207661_103777042 308
342 3300025960 Ga0207651_10022092 Ga0207651_100220923 308
343 3300026121 Ga0207683_10070402 Ga0207683_100704022 308
344 3300028379 Ga0268266_10017633 Ga0268266_100176333 308
345 3300035117 Ga0373953_0040848 Ga0373953_0040848_76_1005 308
346 3300035172 Ga0373955_0050341 Ga0373955_0050341_999_1928 308
347 3300035725 Ga0373947_0037367 Ga0373947_0037367_1630_2556 308
348 3300041512 Ga0451853_1182859 Ga0451853_1182859_240_1166 308
349 3300046454 Ga0495592_0256719 Ga0495592_0256719_182_1114 308
350 3300046463 Ga0495653_0072010 Ga0495653_0072010_820_1749 308
351 3300046526 Ga0495666_0167050 Ga0495666_0167050_38_967 308
352 3300046679 Ga0495623_0008269 Ga0495623_0008269_997_1926 308
353 3300047444 Ga0495675_0008517 Ga0495675_0008517_92_1021 308
354 3300048088 Ga0495602_0014474 Ga0495602_0014474_411_1340 308
355 3300048905 Ga0496102_0197130 Ga0496102_0197130_418_1344 308
356 3300048915 Ga0496112_0012303 Ga0496112_0012303_2994_3920 308
357 3300048918 Ga0496115_0012099 Ga0496115_0012099_3131_4057 308
358 3300050514 nmdc:mga08x19_262782_c1 nmdc:mga08x19_262782_c1_208_1137 308
359 3300053077 Ga0495601_0048391 Ga0495601_0048391_534_1463 308
360 3300053085 Ga0495619_0191796 Ga0495619_0191796_242_1174 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04389

Peptidase_M28

Peptidase family M28

151

352

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cjg-assembly2.cif.gz_B structural and kinetic characterization of porphyromonas gingivalis glutaminyl cyclase 0.8821 40 303
6qql-assembly2.cif.gz_B crystal structure of porphyromonas gingivalis glutaminyl cyclase 0.8771 39 303
3gux-assembly1.cif.gz_A crystal structure of a putative zn-dependent exopeptidase (bvu_1317) from bacteroides vulgatus atcc 8482 at 1.80 a resolution 0.8716 39 303
3gux-assembly2.cif.gz_B crystal structure of a putative zn-dependent exopeptidase (bvu_1317) from bacteroides vulgatus atcc 8482 at 1.80 a resolution 0.8647 39 299
7d1e-assembly1.cif.gz_A crystal structure of bacteroides thetaiotaomicron glutaminyl cyclase bound to n-acetylhistamine 0.8583 39 303
ID Description Score Start End Superfamily
3guxB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8611 39 303 3.40.630.10
4fuuA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8456 39 303 3.40.630.10
af_Q9VTH7_29_337_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8366 36 304 3.40.630.10
3guxB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8345 39 303 3.40.630.10
4fwuA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8294 43 308 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A2V5K3Q2-F1-model_v4 Peptidase M28 domain-containing protein 0.9546 31 306 GO:0008270
GO:0016603
AF-A0A2V5XSA8-F1-model_v4 Peptidase M28 domain-containing protein 0.9535 31 308 GO:0008270
GO:0016603
AF-A0A2V6G9P1-F1-model_v4 Peptidase M28 domain-containing protein 0.9532 30 306 GO:0008270
GO:0016603
AF-A0A2V5M337-F1-model_v4 Peptidase M28 domain-containing protein 0.9511 30 306 GO:0008270
GO:0016603
AF-A0A2V5WNX4-F1-model_v4 Peptidase M28 domain-containing protein 0.9448 30 306 GO:0008270
GO:0016603

Feature Viewer

pLDDT pTM Quality
83.94 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map