F421787
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 360 | 170 | 360 | 311 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10009519|Ga0070709_100095193 |
| Length | 359 |
| Sequence | VFLACQTGSDVSHEIVGRLCETPIQVHQLIKTFLKIEAAGAEQHEWVGQTSERAAAIKSKPLQLAAILLLMSFLQANPSLAGDTKIWEEFSGEKALAHVQRLVDLGPHPGGSAAIEKARDYIEEQLRHSGWQVTRQAFTDDTPRGKIHFVNLIARFPGDANAASPSFLLCSHYDTKLFDTIRFVGANDGGSSTGLLLELARVIGQHPSLARKLELAFFDGEEAYENFSDTDGLYGSRYFARRLQGEGAKQFRGGILFDMVGDRSLGITLPADSPAAMARDVFAAAEALKLRKYFSYLDRDLIDDHAPLNAIGIPTIDIIDFDYPWWHTADDTMDKISAQSLQIVGSVAVYYLSEFGLKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 2 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 125 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 126 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 127 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 128 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 129 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 130 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 133 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 134 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 135 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 136 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 137 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 138 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 139 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 140 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 154 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 155 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 156 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 157 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 158 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 159 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 161 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 162 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 163 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 164 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 165 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 166 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.89 |
| Rhizosphere | 90.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24035J26624_1000559 | 3300002126 | Unclassified | 3452 |
| 2 | JGI25405J52794_10000506 | 3300003911 | Bacteria | 5626 |
| 3 | Ga0065704_10024117 | 3300005289 | Bacteria | 1644 |
| 4 | Ga0065704_10030013 | 3300005289 | Bacteria | 1394 |
| 5 | Ga0065704_10175728 | 3300005289 | Bacteria | 1265 |
| 6 | Ga0065712_10002140 | 3300005290 | Bacteria | 5131 |
| 7 | Ga0065712_10003323 | 3300005290 | Bacteria | 6665 |
| 8 | Ga0065712_10008756 | 3300005290 | Unclassified | 3011 |
| 9 | Ga0065715_10004108 | 3300005293 | Bacteria | 5129 |
| 10 | Ga0065715_10017548 | 3300005293 | Bacteria | 3466 |
| 11 | Ga0065715_10091062 | 3300005293 | Bacteria | 6158 |
| 12 | Ga0065707_10009213 | 3300005295 | Bacteria | 2265 |
| 13 | Ga0070676_10029872 | 3300005328 | Bacteria | 3103 |
| 14 | Ga0070676_10032258 | 3300005328 | Bacteria | 3000 |
| 15 | Ga0070676_10035739 | 3300005328 | Bacteria | 2859 |
| 16 | Ga0070683_100013209 | 3300005329 | Bacteria | 7193 |
| 17 | Ga0070683_100054928 | 3300005329 | Unclassified | 3694 |
| 18 | Ga0070690_100009320 | 3300005330 | Bacteria | 5684 |
| 19 | Ga0070690_100075820 | 3300005330 | Bacteria | 2193 |
| 20 | Ga0070690_100143022 | 3300005330 | Unclassified | 1625 |
| 21 | Ga0070670_100072432 | 3300005331 | Unclassified | 2959 |
| 22 | Ga0070670_100115771 | 3300005331 | Bacteria | 2311 |
| 23 | Ga0070677_10051399 | 3300005333 | Bacteria | 1668 |
| 24 | Ga0068869_100115735 | 3300005334 | Unclassified | 2045 |
| 25 | Ga0070666_10056050 | 3300005335 | Unclassified | 2661 |
| 26 | Ga0068868_100061475 | 3300005338 | Unclassified | 2976 |
| 27 | Ga0068868_100209182 | 3300005338 | Unclassified | 1630 |
| 28 | Ga0070660_100049190 | 3300005339 | Bacteria | 3240 |
| 29 | Ga0070660_100052922 | 3300005339 | Bacteria | 3131 |
| 30 | Ga0070660_100264818 | 3300005339 | Bacteria | 1404 |
| 31 | Ga0070660_100405366 | 3300005339 | Unclassified | 1128 |
| 32 | Ga0070689_100023759 | 3300005340 | Bacteria | 4594 |
| 33 | Ga0070668_100011618 | 3300005347 | Bacteria | 6555 |
| 34 | Ga0070668_100130278 | 3300005347 | Bacteria | 2018 |
| 35 | Ga0070668_100361117 | 3300005347 | Bacteria | 1231 |
| 36 | Ga0070669_100011495 | 3300005353 | Bacteria | 6282 |
| 37 | Ga0070669_100058417 | 3300005353 | Bacteria | 2831 |
| 38 | Ga0070669_100162423 | 3300005353 | Bacteria | 1737 |
| 39 | Ga0070669_100419966 | 3300005353 | Unclassified | 1097 |
| 40 | Ga0070675_100019035 | 3300005354 | Bacteria | 5470 |
| 41 | Ga0070675_100020910 | 3300005354 | Bacteria | 5225 |
| 42 | Ga0070675_100114447 | 3300005354 | Unclassified | 2286 |
| 43 | Ga0070675_100205525 | 3300005354 | Bacteria | 1710 |
| 44 | Ga0070671_100078121 | 3300005355 | Bacteria | 2766 |
| 45 | Ga0070671_100114700 | 3300005355 | Bacteria | 2264 |
| 46 | Ga0070671_100117595 | 3300005355 | Bacteria | 2235 |
| 47 | Ga0070674_100040587 | 3300005356 | Bacteria | 3149 |
| 48 | Ga0070674_100103290 | 3300005356 | Bacteria | 2080 |
| 49 | Ga0070673_100020062 | 3300005364 | Unclassified | 4812 |
| 50 | Ga0070673_100023764 | 3300005364 | Bacteria | 4483 |
| 51 | Ga0070673_100062491 | 3300005364 | Bacteria | 2958 |
| 52 | Ga0070673_100355269 | 3300005364 | Unclassified | 1301 |
| 53 | Ga0070688_100017104 | 3300005365 | Bacteria | 4160 |
| 54 | Ga0070688_100027672 | 3300005365 | Bacteria | 3377 |
| 55 | Ga0070688_100060734 | 3300005365 | Bacteria | 2388 |
| 56 | Ga0070667_100056202 | 3300005367 | Unclassified | 3324 |
| 57 | Ga0070667_100212952 | 3300005367 | Unclassified | 1718 |
| 58 | Ga0070709_10009519 | 3300005434 | Bacteria | 5362 |
| 59 | Ga0070709_10095043 | 3300005434 | Bacteria | 1973 |
| 60 | Ga0070713_100100177 | 3300005436 | Bacteria | 2508 |
| 61 | Ga0070711_100012653 | 3300005439 | Bacteria | 5278 |
| 62 | Ga0070711_100025078 | 3300005439 | Unclassified | 3897 |
| 63 | Ga0070711_100054863 | 3300005439 | Bacteria | 2751 |
| 64 | Ga0070711_100170933 | 3300005439 | Bacteria | 1656 |
| 65 | Ga0070705_100029361 | 3300005440 | Bacteria | 3023 |
| 66 | Ga0070700_100014268 | 3300005441 | Unclassified | 4483 |
| 67 | Ga0070708_100010150 | 3300005445 | Bacteria | 7620 |
| 68 | Ga0070708_100078043 | 3300005445 | Bacteria | 2993 |
| 69 | Ga0070708_100096640 | 3300005445 | Bacteria | 2699 |
| 70 | Ga0070708_100118878 | 3300005445 | Bacteria | 2435 |
| 71 | Ga0070663_100010333 | 3300005455 | Bacteria | 5818 |
| 72 | Ga0070678_100029155 | 3300005456 | Unclassified | 3776 |
| 73 | Ga0070678_100061706 | 3300005456 | Bacteria | 2764 |
| 74 | Ga0070662_100115818 | 3300005457 | Bacteria | 2048 |
| 75 | Ga0070662_100130983 | 3300005457 | Unclassified | 1933 |
| 76 | Ga0070662_100328560 | 3300005457 | Bacteria | 1249 |
| 77 | Ga0070681_10021010 | 3300005458 | Bacteria | 6540 |
| 78 | Ga0070685_10053357 | 3300005466 | Bacteria | 2342 |
| 79 | Ga0070706_100000100 | 3300005467 | Bacteria | 104971 |
| 80 | Ga0070706_100001631 | 3300005467 | Bacteria | 23400 |
| 81 | Ga0070706_100025395 | 3300005467 | Bacteria | 5451 |
| 82 | Ga0070706_100120572 | 3300005467 | Bacteria | 2445 |
| 83 | Ga0070706_100124179 | 3300005467 | Bacteria | 2407 |
| 84 | Ga0070706_100137838 | 3300005467 | Unclassified | 2277 |
| 85 | Ga0070706_100183042 | 3300005467 | Bacteria | 1957 |
| 86 | Ga0070707_100007577 | 3300005468 | Bacteria | 10080 |
| 87 | Ga0070707_100017172 | 3300005468 | Bacteria | 6801 |
| 88 | Ga0070707_100017700 | 3300005468 | Bacteria | 6701 |
| 89 | Ga0070707_100041159 | 3300005468 | Unclassified | 4422 |
| 90 | Ga0070707_100091744 | 3300005468 | Bacteria | 2941 |
| 91 | Ga0070707_100121473 | 3300005468 | Unclassified | 2536 |
| 92 | Ga0070707_100602767 | 3300005468 | Bacteria | 1061 |
| 93 | Ga0070698_100208223 | 3300005471 | Bacteria | 1891 |
| 94 | Ga0070698_100225832 | 3300005471 | Unclassified | 1806 |
| 95 | Ga0070699_100462426 | 3300005518 | Unclassified | 1151 |
| 96 | Ga0070679_100007098 | 3300005530 | Bacteria | 10452 |
| 97 | Ga0070679_100434362 | 3300005530 | Unclassified | 1258 |
| 98 | Ga0070684_100023359 | 3300005535 | Bacteria | 5170 |
| 99 | Ga0070684_100024720 | 3300005535 | Bacteria | 5041 |
| 100 | Ga0070697_100003578 | 3300005536 | Bacteria | 11939 |
| 101 | Ga0070697_100013694 | 3300005536 | Bacteria | 6364 |
| 102 | Ga0070697_100016257 | 3300005536 | Bacteria | 5849 |
| 103 | Ga0070697_100058976 | 3300005536 | Unclassified | 3124 |
| 104 | Ga0070697_100127039 | 3300005536 | Bacteria | 2136 |
| 105 | Ga0070697_100131643 | 3300005536 | Bacteria | 2098 |
| 106 | Ga0070697_100448397 | 3300005536 | Bacteria | 1124 |
| 107 | Ga0070672_100009390 | 3300005543 | Bacteria | 6741 |
| 108 | Ga0070672_100028539 | 3300005543 | Unclassified | 4175 |
| 109 | Ga0070672_100055131 | 3300005543 | Unclassified | 3113 |
| 110 | Ga0070696_100008386 | 3300005546 | Bacteria | 6913 |
| 111 | Ga0070665_100030877 | 3300005548 | Bacteria | 5392 |
| 112 | Ga0070665_100133179 | 3300005548 | Bacteria | 2487 |
| 113 | Ga0070665_100192278 | 3300005548 | Bacteria | 2041 |
| 114 | Ga0070664_100117196 | 3300005564 | Bacteria | 2329 |
| 115 | Ga0070664_100301160 | 3300005564 | Bacteria | 1449 |
| 116 | Ga0068854_100233081 | 3300005578 | Bacteria | 1462 |
| 117 | Ga0068856_100038980 | 3300005614 | Unclassified | 4665 |
| 118 | Ga0068856_100517844 | 3300005614 | Unclassified | 1214 |
| 119 | Ga0070702_100163025 | 3300005615 | Bacteria | 1443 |
| 120 | Ga0068861_100123686 | 3300005719 | Bacteria | 2090 |
| 121 | Ga0068863_100037243 | 3300005841 | Unclassified | 4632 |
| 122 | Ga0068863_100055153 | 3300005841 | Bacteria | 3764 |
| 123 | Ga0068863_100199972 | 3300005841 | Bacteria | 1922 |
| 124 | Ga0068858_100310861 | 3300005842 | Unclassified | 1505 |
| 125 | Ga0081455_10002038 | 3300005937 | Bacteria | 24159 |
| 126 | Ga0081455_10003953 | 3300005937 | Bacteria | 16831 |
| 127 | Ga0081455_10038275 | 3300005937 | Unclassified | 4248 |
| 128 | Ga0081455_10074782 | 3300005937 | Bacteria | 2797 |
| 129 | Ga0081455_10139368 | 3300005937 | Bacteria | 1886 |
| 130 | Ga0081539_10002356 | 3300005985 | Bacteria | 27128 |
| 131 | Ga0081539_10011057 | 3300005985 | Bacteria | 7214 |
| 132 | Ga0070717_10000353 | 3300006028 | Bacteria | 29605 |
| 133 | Ga0070717_10243584 | 3300006028 | Bacteria | 1586 |
| 134 | Ga0070715_10045846 | 3300006163 | Unclassified | 1856 |
| 135 | Ga0070716_100080851 | 3300006173 | Bacteria | 1939 |
| 136 | Ga0070716_100104113 | 3300006173 | Bacteria | 1746 |
| 137 | Ga0070716_100217200 | 3300006173 | Unclassified | 1282 |
| 138 | Ga0070712_100026755 | 3300006175 | Unclassified | 3847 |
| 139 | Ga0070712_100045258 | 3300006175 | Bacteria | 3038 |
| 140 | Ga0070712_100105655 | 3300006175 | Unclassified | 2092 |
| 141 | Ga0070712_100192084 | 3300006175 | Bacteria | 1598 |
| 142 | Ga0097621_100185773 | 3300006237 | Bacteria | 1798 |
| 143 | Ga0097621_100193243 | 3300006237 | Bacteria | 1763 |
| 144 | Ga0075428_100193432 | 3300006844 | Bacteria | 2200 |
| 145 | Ga0105240_10202841 | 3300009093 | Unclassified | 2323 |
| 146 | Ga0105245_10037275 | 3300009098 | Unclassified | 4323 |
| 147 | Ga0105245_10109177 | 3300009098 | Bacteria | 2571 |
| 148 | Ga0114129_10000103 | 3300009147 | Bacteria | 83612 |
| 149 | Ga0114129_10185484 | 3300009147 | Bacteria | 2828 |
| 150 | Ga0114129_10241310 | 3300009147 | Unclassified | 2429 |
| 151 | Ga0114129_10457497 | 3300009147 | Bacteria | 1673 |
| 152 | Ga0105242_10041020 | 3300009176 | Bacteria | 3731 |
| 153 | Ga0105242_10237035 | 3300009176 | Unclassified | 1638 |
| 154 | Ga0105249_10072092 | 3300009553 | Unclassified | 3193 |
| 155 | Ga0105249_10416627 | 3300009553 | Bacteria | 1376 |
| 156 | Ga0105239_10048141 | 3300010375 | Unclassified | 4674 |
| 157 | Ga0105239_10069390 | 3300010375 | Bacteria | 3872 |
| 158 | Ga0105239_10413019 | 3300010375 | Bacteria | 1528 |
| 159 | Ga0105239_10533582 | 3300010375 | Bacteria | 1336 |
| 160 | Ga0105246_10089108 | 3300011119 | Bacteria | 2219 |
| 161 | Ga0157371_10070765 | 3300013102 | Bacteria | 2470 |
| 162 | Ga0157369_10011063 | 3300013105 | Bacteria | 10266 |
| 163 | Ga0157374_10075899 | 3300013296 | Unclassified | 3177 |
| 164 | Ga0157374_10219897 | 3300013296 | Bacteria | 1864 |
| 165 | Ga0157378_10030092 | 3300013297 | Bacteria | 4797 |
| 166 | Ga0163162_10066883 | 3300013306 | Bacteria | 3643 |
| 167 | Ga0163162_10154105 | 3300013306 | Bacteria | 2417 |
| 168 | Ga0163162_10481265 | 3300013306 | Unclassified | 1373 |
| 169 | Ga0157372_10024418 | 3300013307 | Bacteria | 6565 |
| 170 | Ga0157372_10037187 | 3300013307 | Bacteria | 5367 |
| 171 | Ga0157372_10255660 | 3300013307 | Unclassified | 2034 |
| 172 | Ga0157372_10302385 | 3300013307 | Bacteria | 1861 |
| 173 | Ga0157372_10322611 | 3300013307 | Unclassified | 1798 |
| 174 | Ga0157375_10015060 | 3300013308 | Bacteria | 6916 |
| 175 | Ga0157375_10509710 | 3300013308 | Unclassified | 1367 |
| 176 | Ga0163163_10219045 | 3300014325 | Bacteria | 1952 |
| 177 | Ga0163163_10294461 | 3300014325 | Bacteria | 1675 |
| 178 | Ga0163163_10708181 | 3300014325 | Unclassified | 1070 |
| 179 | Ga0157379_10328223 | 3300014968 | Unclassified | 1398 |
| 180 | Ga0157376_10230467 | 3300014969 | Unclassified | 1720 |
| 181 | Ga0207666_1001110 | 3300025271 | Bacteria | 3184 |
| 182 | Ga0207673_1000285 | 3300025290 | Bacteria | 5142 |
| 183 | Ga0207697_10000361 | 3300025315 | Bacteria | 25436 |
| 184 | Ga0207697_10000391 | 3300025315 | Bacteria | 24629 |
| 185 | Ga0207697_10001610 | 3300025315 | Bacteria | 12182 |
| 186 | Ga0207697_10001716 | 3300025315 | Bacteria | 11781 |
| 187 | Ga0207697_10002578 | 3300025315 | Bacteria | 9335 |
| 188 | Ga0207697_10016546 | 3300025315 | Bacteria | 3037 |
| 189 | Ga0207697_10020385 | 3300025315 | Bacteria | 2714 |
| 190 | Ga0207697_10040265 | 3300025315 | Bacteria | 1919 |
| 191 | Ga0207682_10055961 | 3300025893 | Bacteria | 1641 |
| 192 | Ga0207642_10020287 | 3300025899 | Bacteria | 2591 |
| 193 | Ga0207688_10000772 | 3300025901 | Bacteria | 15940 |
| 194 | Ga0207688_10035120 | 3300025901 | Bacteria | 2777 |
| 195 | Ga0207688_10193920 | 3300025901 | Bacteria | 1216 |
| 196 | Ga0207680_10028958 | 3300025903 | Bacteria | 3106 |
| 197 | Ga0207680_10076411 | 3300025903 | Unclassified | 2091 |
| 198 | Ga0207647_10036701 | 3300025904 | Bacteria | 3112 |
| 199 | Ga0207685_10052994 | 3300025905 | Unclassified | 1574 |
| 200 | Ga0207699_10039033 | 3300025906 | Bacteria | 2725 |
| 201 | Ga0207699_10055158 | 3300025906 | Bacteria | 2364 |
| 202 | Ga0207645_10001615 | 3300025907 | Bacteria | 18377 |
| 203 | Ga0207684_10000128 | 3300025910 | Bacteria | 139233 |
| 204 | Ga0207684_10004361 | 3300025910 | Bacteria | 13367 |
| 205 | Ga0207684_10014170 | 3300025910 | Bacteria | 6881 |
| 206 | Ga0207684_10162335 | 3300025910 | Bacteria | 1924 |
| 207 | Ga0207707_10007556 | 3300025912 | Bacteria | 9470 |
| 208 | Ga0207693_10007666 | 3300025915 | Bacteria | 8865 |
| 209 | Ga0207693_10012851 | 3300025915 | Bacteria | 6756 |
| 210 | Ga0207693_10020250 | 3300025915 | Bacteria | 5292 |
| 211 | Ga0207663_10084704 | 3300025916 | Bacteria | 2085 |
| 212 | Ga0207663_10161494 | 3300025916 | Bacteria | 1582 |
| 213 | Ga0207662_10001771 | 3300025918 | Bacteria | 10599 |
| 214 | Ga0207662_10058898 | 3300025918 | Bacteria | 2301 |
| 215 | Ga0207662_10222767 | 3300025918 | Bacteria | 1229 |
| 216 | Ga0207657_10131966 | 3300025919 | Bacteria | 2047 |
| 217 | Ga0207657_10193295 | 3300025919 | Unclassified | 1640 |
| 218 | Ga0207657_10299752 | 3300025919 | Unclassified | 1273 |
| 219 | Ga0207649_10026090 | 3300025920 | Unclassified | 3415 |
| 220 | Ga0207649_10118820 | 3300025920 | Bacteria | 1779 |
| 221 | Ga0207652_10040386 | 3300025921 | Unclassified | 3962 |
| 222 | Ga0207646_10004673 | 3300025922 | Bacteria | 14758 |
| 223 | Ga0207646_10025509 | 3300025922 | Bacteria | 5407 |
| 224 | Ga0207646_10033268 | 3300025922 | Unclassified | 4665 |
| 225 | Ga0207646_10061732 | 3300025922 | Bacteria | 3345 |
| 226 | Ga0207646_10077293 | 3300025922 | Unclassified | 2975 |
| 227 | Ga0207646_10182597 | 3300025922 | Bacteria | 1895 |
| 228 | Ga0207646_10263615 | 3300025922 | Unclassified | 1557 |
| 229 | Ga0207681_10237005 | 3300025923 | Bacteria | 1418 |
| 230 | Ga0207659_10007222 | 3300025926 | Bacteria | 6825 |
| 231 | Ga0207659_10020822 | 3300025926 | Bacteria | 4342 |
| 232 | Ga0207659_10029833 | 3300025926 | Bacteria | 3721 |
| 233 | Ga0207659_10163598 | 3300025926 | Bacteria | 1749 |
| 234 | Ga0207659_10376507 | 3300025926 | Bacteria | 1183 |
| 235 | Ga0207700_10025274 | 3300025928 | Unclassified | 4122 |
| 236 | Ga0207644_10019233 | 3300025931 | Bacteria | 4629 |
| 237 | Ga0207644_10208558 | 3300025931 | Bacteria | 1544 |
| 238 | Ga0207690_10045637 | 3300025932 | Bacteria | 2896 |
| 239 | Ga0207690_10070228 | 3300025932 | Bacteria | 2412 |
| 240 | Ga0207690_10254038 | 3300025932 | Bacteria | 1359 |
| 241 | Ga0207706_10001926 | 3300025933 | Bacteria | 20387 |
| 242 | Ga0207706_10034903 | 3300025933 | Bacteria | 4474 |
| 243 | Ga0207706_10087092 | 3300025933 | Bacteria | 2746 |
| 244 | Ga0207706_10171663 | 3300025933 | Bacteria | 1905 |
| 245 | Ga0207706_10350287 | 3300025933 | Bacteria | 1284 |
| 246 | Ga0207686_10028249 | 3300025934 | Bacteria | 3295 |
| 247 | Ga0207686_10038064 | 3300025934 | Bacteria | 2908 |
| 248 | Ga0207670_10111387 | 3300025936 | Bacteria | 1973 |
| 249 | Ga0207669_10038991 | 3300025937 | Bacteria | 2741 |
| 250 | Ga0207669_10061099 | 3300025937 | Bacteria | 2313 |
| 251 | Ga0207665_10060233 | 3300025939 | Unclassified | 2570 |
| 252 | Ga0207665_10115642 | 3300025939 | Unclassified | 1890 |
| 253 | Ga0207665_10305854 | 3300025939 | Unclassified | 1190 |
| 254 | Ga0207691_10007521 | 3300025940 | Bacteria | 10485 |
| 255 | Ga0207691_10017306 | 3300025940 | Bacteria | 6836 |
| 256 | Ga0207689_10153533 | 3300025942 | Unclassified | 1898 |
| 257 | Ga0207661_10045536 | 3300025944 | Bacteria | 3473 |
| 258 | Ga0207661_10100030 | 3300025944 | Bacteria | 2433 |
| 259 | Ga0207661_10123936 | 3300025944 | Bacteria | 2204 |
| 260 | Ga0207661_10377704 | 3300025944 | Bacteria | 1282 |
| 261 | Ga0207679_10108834 | 3300025945 | Bacteria | 2183 |
| 262 | Ga0207651_10022092 | 3300025960 | Unclassified | 3882 |
| 263 | Ga0207651_10138542 | 3300025960 | Unclassified | 1875 |
| 264 | Ga0207651_10200329 | 3300025960 | Bacteria | 1599 |
| 265 | Ga0207668_10011867 | 3300025972 | Bacteria | 5312 |
| 266 | Ga0207668_10059961 | 3300025972 | Bacteria | 2669 |
| 267 | Ga0207668_10324866 | 3300025972 | Bacteria | 1278 |
| 268 | Ga0207640_10202803 | 3300025981 | Bacteria | 1504 |
| 269 | Ga0207658_10025145 | 3300025986 | Unclassified | 4168 |
| 270 | Ga0207658_10343347 | 3300025986 | Unclassified | 1298 |
| 271 | Ga0207677_10031369 | 3300026023 | Bacteria | 3403 |
| 272 | Ga0207677_10140968 | 3300026023 | Bacteria | 1845 |
| 273 | Ga0207703_10025206 | 3300026035 | Unclassified | 4678 |
| 274 | Ga0207703_10396398 | 3300026035 | Unclassified | 1280 |
| 275 | Ga0207702_10192513 | 3300026078 | Bacteria | 1885 |
| 276 | Ga0207641_10056210 | 3300026088 | Bacteria | 3343 |
| 277 | Ga0207641_10119562 | 3300026088 | Unclassified | 2349 |
| 278 | Ga0207675_100164176 | 3300026118 | Bacteria | 2120 |
| 279 | Ga0207683_10008431 | 3300026121 | Bacteria | 8822 |
| 280 | Ga0207683_10014342 | 3300026121 | Bacteria | 6752 |
| 281 | Ga0207683_10070402 | 3300026121 | Bacteria | 3090 |
| 282 | Ga0268266_10017633 | 3300028379 | Bacteria | 6087 |
| 283 | Ga0268266_10073478 | 3300028379 | Bacteria | 2967 |
| 284 | Ga0268264_10042179 | 3300028381 | Bacteria | 3777 |
| 285 | Ga0268264_10165266 | 3300028381 | Unclassified | 1997 |
| 286 | Ga0268264_10350209 | 3300028381 | Bacteria | 1406 |
| 287 | Ga0373945_0034120 | 3300035116 | Bacteria | 1812 |
| 288 | Ga0373953_0040848 | 3300035117 | Bacteria | 1844 |
| 289 | Ga0373943_0017088 | 3300035170 | Bacteria | 3318 |
| 290 | Ga0373955_0050341 | 3300035172 | Bacteria | 2265 |
| 291 | Ga0373935_0005347 | 3300035692 | Bacteria | 7562 |
| 292 | Ga0373947_0008594 | 3300035725 | Bacteria | 5880 |
| 293 | Ga0373947_0037367 | 3300035725 | Unclassified | 2882 |
| 294 | Ga0373937_0198308 | 3300036401 | Bacteria | 1887 |
| 295 | Ga0373937_0220177 | 3300036401 | Bacteria | 1787 |
| 296 | Ga0373925_0131736 | 3300037068 | Bacteria | 1950 |
| 297 | Ga0373925_0181772 | 3300037068 | Unclassified | 1665 |
| 298 | Ga0395899_0088825 | 3300037312 | Unclassified | 2242 |
| 299 | Ga0395900_0058207 | 3300037418 | Unclassified | 3978 |
| 300 | Ga0395900_0235823 | 3300037418 | Unclassified | 1838 |
| 301 | Ga0395898_0026807 | 3300037466 | Bacteria | 5792 |
| 302 | Ga0395898_0316555 | 3300037466 | Bacteria | 1489 |
| 303 | Ga0395905_0004291 | 3300037471 | Bacteria | 14863 |
| 304 | Ga0395901_0000939 | 3300038443 | Bacteria | 31708 |
| 305 | Ga0451853_1182859 | 3300041512 | Unclassified | 2099 |
| 306 | Ga0451853_3501839 | 3300041512 | Bacteria | 1224 |
| 307 | Ga0451576_0168791 | 3300045051 | Unclassified | 2284 |
| 308 | Ga0466967_0060749 | 3300045976 | Unclassified | 3351 |
| 309 | Ga0466967_0174742 | 3300045976 | Bacteria | 2023 |
| 310 | Ga0495592_0006457 | 3300046454 | Bacteria | 8730 |
| 311 | Ga0495592_0256719 | 3300046454 | Bacteria | 1153 |
| 312 | Ga0495629_0397514 | 3300046459 | Unclassified | 937 |
| 313 | Ga0495653_0072010 | 3300046463 | Bacteria | 2582 |
| 314 | Ga0495628_0138054 | 3300046516 | Unclassified | 1862 |
| 315 | Ga0495666_0167050 | 3300046526 | Unclassified | 1019 |
| 316 | Ga0495645_0001591 | 3300046543 | Bacteria | 15353 |
| 317 | Ga0495623_0008269 | 3300046679 | Bacteria | 6767 |
| 318 | Ga0495647_0078459 | 3300046681 | Unclassified | 1335 |
| 319 | Ga0495669_0057476 | 3300046684 | Bacteria | 1755 |
| 320 | Ga0495675_0008517 | 3300047444 | Bacteria | 6354 |
| 321 | Ga0495602_0014474 | 3300048088 | Bacteria | 8008 |
| 322 | Ga0496100_0029300 | 3300048903 | Bacteria | 3403 |
| 323 | Ga0496101_0019309 | 3300048904 | Bacteria | 4651 |
| 324 | Ga0496102_0157217 | 3300048905 | Bacteria | 2137 |
| 325 | Ga0496102_0191064 | 3300048905 | Bacteria | 1929 |
| 326 | Ga0496102_0197130 | 3300048905 | Bacteria | 1898 |
| 327 | Ga0496103_0032995 | 3300048906 | Bacteria | 3162 |
| 328 | Ga0496104_0053814 | 3300048907 | Bacteria | 3804 |
| 329 | Ga0496104_0064790 | 3300048907 | Bacteria | 3466 |
| 330 | Ga0496104_0114181 | 3300048907 | Unclassified | 2590 |
| 331 | Ga0496105_0030462 | 3300048908 | Unclassified | 4421 |
| 332 | Ga0496105_0375574 | 3300048908 | Unclassified | 1132 |
| 333 | Ga0496106_0010413 | 3300048909 | Bacteria | 6866 |
| 334 | Ga0496107_0004833 | 3300048910 | Bacteria | 9148 |
| 335 | Ga0496109_0079015 | 3300048912 | Bacteria | 3030 |
| 336 | Ga0496109_0140315 | 3300048912 | Bacteria | 2260 |
| 337 | Ga0496109_0179267 | 3300048912 | Unclassified | 1989 |
| 338 | Ga0496109_0576517 | 3300048912 | Unclassified | 1061 |
| 339 | Ga0496110_0041468 | 3300048913 | Unclassified | 4017 |
| 340 | Ga0496110_0096067 | 3300048913 | Bacteria | 2655 |
| 341 | Ga0496111_0176540 | 3300048914 | Bacteria | 1588 |
| 342 | Ga0496112_0012303 | 3300048915 | Bacteria | 7859 |
| 343 | Ga0496112_0038196 | 3300048915 | Unclassified | 4689 |
| 344 | Ga0496112_0058268 | 3300048915 | Bacteria | 3803 |
| 345 | Ga0496113_0012262 | 3300048916 | Bacteria | 5755 |
| 346 | Ga0496113_0099257 | 3300048916 | Bacteria | 2255 |
| 347 | Ga0496113_0163430 | 3300048916 | Bacteria | 1761 |
| 348 | Ga0496114_0035302 | 3300048917 | Bacteria | 4128 |
| 349 | Ga0496115_0012099 | 3300048918 | Bacteria | 6489 |
| 350 | Ga0496115_0016726 | 3300048918 | Bacteria | 5589 |
| 351 | Ga0496115_0053726 | 3300048918 | Unclassified | 3233 |
| 352 | Ga0496115_0072374 | 3300048918 | Bacteria | 2797 |
| 353 | Ga0496115_0189929 | 3300048918 | Unclassified | 1697 |
| 354 | nmdc:mga05p37_12758_c1 | 3300050507 | Bacteria | 10044 |
| 355 | nmdc:mga05p37_187088_c1 | 3300050507 | Unclassified | 2517 |
| 356 | nmdc:mga05p37_620706_c1 | 3300050507 | Unclassified | 1216 |
| 357 | nmdc:mga08x19_262782_c1 | 3300050514 | Bacteria | 1193 |
| 358 | nmdc:mga0a205_488277_c1 | 3300050515 | Unclassified | 1089 |
| 359 | Ga0495601_0048391 | 3300053077 | Bacteria | 2677 |
| 360 | Ga0495619_0191796 | 3300053085 | Bacteria | 1414 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035170 | Ga0373943_0017088 | Ga0373943_0017088_2333_3178 | 281 |
| 2 | 3300035725 | Ga0373947_0008594 | Ga0373947_0008594_1432_2277 | 281 |
| 3 | 3300037068 | Ga0373925_0181772 | Ga0373925_0181772_502_1347 | 281 |
| 4 | 3300046681 | Ga0495647_0078459 | Ga0495647_0078459_13_858 | 281 |
| 5 | 3300045976 | Ga0466967_0060749 | Ga0466967_0060749_303_1157 | 283 |
| 6 | 3300025315 | Ga0207697_10001610 | Ga0207697_100016103 | 286 |
| 7 | 3300025944 | Ga0207661_10045536 | Ga0207661_100455362 | 286 |
| 8 | 3300026035 | Ga0207703_10025206 | Ga0207703_100252062 | 286 |
| 9 | 3300028381 | Ga0268264_10042179 | Ga0268264_100421792 | 286 |
| 10 | 3300009093 | Ga0105240_10202841 | Ga0105240_102028412 | 287 |
| 11 | 3300009147 | Ga0114129_10457497 | Ga0114129_104574972 | 287 |
| 12 | 3300013307 | Ga0157372_10024418 | Ga0157372_100244186 | 287 |
| 13 | 3300005536 | Ga0070697_100003578 | Ga0070697_1000035782 | 288 |
| 14 | 3300048916 | Ga0496113_0099257 | Ga0496113_0099257_267_1172 | 288 |
| 15 | 3300006844 | Ga0075428_100193432 | Ga0075428_1001934322 | 289 |
| 16 | 3300013105 | Ga0157369_10011063 | Ga0157369_100110638 | 289 |
| 17 | 3300013296 | Ga0157374_10075899 | Ga0157374_100758993 | 289 |
| 18 | 3300013307 | Ga0157372_10037187 | Ga0157372_100371872 | 289 |
| 19 | 3300014325 | Ga0163163_10708181 | Ga0163163_107081811 | 289 |
| 20 | 3300046454 | Ga0495592_0006457 | Ga0495592_0006457_1102_1974 | 289 |
| 21 | 3300046543 | Ga0495645_0001591 | Ga0495645_0001591_960_1832 | 289 |
| 22 | 3300036401 | Ga0373937_0220177 | Ga0373937_0220177_131_1006 | 290 |
| 23 | 3300046459 | Ga0495629_0397514 | Ga0495629_0397514_37_912 | 290 |
| 24 | 3300050515 | nmdc:mga0a205_488277_c1 | nmdc:mga0a205_488277_c1_52_924 | 290 |
| 25 | 3300010375 | Ga0105239_10069390 | Ga0105239_100693903 | 291 |
| 26 | 3300048918 | Ga0496115_0072374 | Ga0496115_0072374_1886_2764 | 291 |
| 27 | 3300005467 | Ga0070706_100120572 | Ga0070706_1001205722 | 292 |
| 28 | 3300048912 | Ga0496109_0576517 | Ga0496109_0576517_51_929 | 292 |
| 29 | 3300048907 | Ga0496104_0114181 | Ga0496104_0114181_134_1030 | 294 |
| 30 | 3300048908 | Ga0496105_0030462 | Ga0496105_0030462_2887_3783 | 294 |
| 31 | 3300048915 | Ga0496112_0038196 | Ga0496112_0038196_568_1464 | 294 |
| 32 | 3300048916 | Ga0496113_0163430 | Ga0496113_0163430_205_1101 | 294 |
| 33 | 3300048918 | Ga0496115_0189929 | Ga0496115_0189929_10_906 | 294 |
| 34 | 3300005467 | Ga0070706_100137838 | Ga0070706_1001378382 | 296 |
| 35 | 3300005468 | Ga0070707_100091744 | Ga0070707_1000917444 | 296 |
| 36 | 3300005985 | Ga0081539_10002356 | Ga0081539_1000235620 | 296 |
| 37 | 3300041512 | Ga0451853_3501839 | Ga0451853_3501839_124_1041 | 296 |
| 38 | 3300005468 | Ga0070707_100041159 | Ga0070707_1000411592 | 297 |
| 39 | 3300005536 | Ga0070697_100016257 | Ga0070697_1000162574 | 297 |
| 40 | 3300025915 | Ga0207693_10012851 | Ga0207693_100128513 | 297 |
| 41 | 3300025922 | Ga0207646_10033268 | Ga0207646_100332683 | 297 |
| 42 | 3300036401 | Ga0373937_0198308 | Ga0373937_0198308_375_1298 | 298 |
| 43 | 3300037466 | Ga0395898_0316555 | Ga0395898_0316555_207_1175 | 298 |
| 44 | 3300005289 | Ga0065704_10024117 | Ga0065704_100241172 | 299 |
| 45 | 3300005293 | Ga0065715_10017548 | Ga0065715_100175483 | 299 |
| 46 | 3300005328 | Ga0070676_10029872 | Ga0070676_100298722 | 299 |
| 47 | 3300005331 | Ga0070670_100072432 | Ga0070670_1000724323 | 299 |
| 48 | 3300005333 | Ga0070677_10051399 | Ga0070677_100513992 | 299 |
| 49 | 3300005339 | Ga0070660_100052922 | Ga0070660_1000529223 | 299 |
| 50 | 3300005347 | Ga0070668_100011618 | Ga0070668_1000116185 | 299 |
| 51 | 3300005353 | Ga0070669_100011495 | Ga0070669_1000114956 | 299 |
| 52 | 3300005355 | Ga0070671_100117595 | Ga0070671_1001175952 | 299 |
| 53 | 3300005356 | Ga0070674_100040587 | Ga0070674_1000405873 | 299 |
| 54 | 3300005364 | Ga0070673_100023764 | Ga0070673_1000237645 | 299 |
| 55 | 3300005434 | Ga0070709_10095043 | Ga0070709_100950432 | 299 |
| 56 | 3300005439 | Ga0070711_100170933 | Ga0070711_1001709332 | 299 |
| 57 | 3300005456 | Ga0070678_100061706 | Ga0070678_1000617062 | 299 |
| 58 | 3300005457 | Ga0070662_100115818 | Ga0070662_1001158182 | 299 |
| 59 | 3300005530 | Ga0070679_100434362 | Ga0070679_1004343622 | 299 |
| 60 | 3300005543 | Ga0070672_100009390 | Ga0070672_1000093906 | 299 |
| 61 | 3300005546 | Ga0070696_100008386 | Ga0070696_1000083863 | 299 |
| 62 | 3300005548 | Ga0070665_100192278 | Ga0070665_1001922782 | 299 |
| 63 | 3300005578 | Ga0068854_100233081 | Ga0068854_1002330812 | 299 |
| 64 | 3300005615 | Ga0070702_100163025 | Ga0070702_1001630251 | 299 |
| 65 | 3300005841 | Ga0068863_100199972 | Ga0068863_1001999722 | 299 |
| 66 | 3300006173 | Ga0070716_100104113 | Ga0070716_1001041132 | 299 |
| 67 | 3300006175 | Ga0070712_100045258 | Ga0070712_1000452582 | 299 |
| 68 | 3300009098 | Ga0105245_10109177 | Ga0105245_101091772 | 299 |
| 69 | 3300009147 | Ga0114129_10185484 | Ga0114129_101854842 | 299 |
| 70 | 3300009176 | Ga0105242_10041020 | Ga0105242_100410202 | 299 |
| 71 | 3300010375 | Ga0105239_10533582 | Ga0105239_105335822 | 299 |
| 72 | 3300011119 | Ga0105246_10089108 | Ga0105246_100891082 | 299 |
| 73 | 3300013296 | Ga0157374_10219897 | Ga0157374_102198972 | 299 |
| 74 | 3300013306 | Ga0163162_10066883 | Ga0163162_100668832 | 299 |
| 75 | 3300013307 | Ga0157372_10302385 | Ga0157372_103023852 | 299 |
| 76 | 3300014325 | Ga0163163_10294461 | Ga0163163_102944612 | 299 |
| 77 | 3300025315 | Ga0207697_10000391 | Ga0207697_100003918 | 299 |
| 78 | 3300025893 | Ga0207682_10055961 | Ga0207682_100559612 | 299 |
| 79 | 3300025899 | Ga0207642_10020287 | Ga0207642_100202872 | 299 |
| 80 | 3300025901 | Ga0207688_10000772 | Ga0207688_1000077211 | 299 |
| 81 | 3300025906 | Ga0207699_10039033 | Ga0207699_100390332 | 299 |
| 82 | 3300025907 | Ga0207645_10001615 | Ga0207645_1000161514 | 299 |
| 83 | 3300025916 | Ga0207663_10161494 | Ga0207663_101614942 | 299 |
| 84 | 3300025919 | Ga0207657_10131966 | Ga0207657_101319662 | 299 |
| 85 | 3300025926 | Ga0207659_10007222 | Ga0207659_100072224 | 299 |
| 86 | 3300025931 | Ga0207644_10019233 | Ga0207644_100192333 | 299 |
| 87 | 3300025932 | Ga0207690_10254038 | Ga0207690_102540382 | 299 |
| 88 | 3300025933 | Ga0207706_10034903 | Ga0207706_100349034 | 299 |
| 89 | 3300025934 | Ga0207686_10028249 | Ga0207686_100282492 | 299 |
| 90 | 3300025937 | Ga0207669_10061099 | Ga0207669_100610992 | 299 |
| 91 | 3300025939 | Ga0207665_10115642 | Ga0207665_101156421 | 299 |
| 92 | 3300025940 | Ga0207691_10007521 | Ga0207691_100075218 | 299 |
| 93 | 3300025972 | Ga0207668_10011867 | Ga0207668_100118672 | 299 |
| 94 | 3300025981 | Ga0207640_10202803 | Ga0207640_102028032 | 299 |
| 95 | 3300026023 | Ga0207677_10031369 | Ga0207677_100313694 | 299 |
| 96 | 3300026078 | Ga0207702_10192513 | Ga0207702_101925132 | 299 |
| 97 | 3300026121 | Ga0207683_10014342 | Ga0207683_100143422 | 299 |
| 98 | 3300028381 | Ga0268264_10350209 | Ga0268264_103502092 | 299 |
| 99 | 3300037068 | Ga0373925_0131736 | Ga0373925_0131736_93_1001 | 299 |
| 100 | 3300048903 | Ga0496100_0029300 | Ga0496100_0029300_735_1643 | 299 |
| 101 | 3300048904 | Ga0496101_0019309 | Ga0496101_0019309_2619_3527 | 299 |
| 102 | 3300048905 | Ga0496102_0191064 | Ga0496102_0191064_414_1322 | 299 |
| 103 | 3300048906 | Ga0496103_0032995 | Ga0496103_0032995_512_1420 | 299 |
| 104 | 3300048907 | Ga0496104_0053814 | Ga0496104_0053814_354_1262 | 299 |
| 105 | 3300048909 | Ga0496106_0010413 | Ga0496106_0010413_1970_2878 | 299 |
| 106 | 3300048910 | Ga0496107_0004833 | Ga0496107_0004833_6947_7855 | 299 |
| 107 | 3300048912 | Ga0496109_0079015 | Ga0496109_0079015_889_1797 | 299 |
| 108 | 3300048913 | Ga0496110_0096067 | Ga0496110_0096067_543_1451 | 299 |
| 109 | 3300048914 | Ga0496111_0176540 | Ga0496111_0176540_354_1262 | 299 |
| 110 | 3300048915 | Ga0496112_0058268 | Ga0496112_0058268_1538_2446 | 299 |
| 111 | 3300048918 | Ga0496115_0016726 | Ga0496115_0016726_4327_5235 | 299 |
| 112 | 3300050507 | nmdc:mga05p37_187088_c1 | nmdc:mga05p37_187088_c1_668_1579 | 299 |
| 113 | 3300005468 | Ga0070707_100017700 | Ga0070707_1000177002 | 300 |
| 114 | 3300005536 | Ga0070697_100131643 | Ga0070697_1001316433 | 300 |
| 115 | 3300025922 | Ga0207646_10025509 | Ga0207646_100255092 | 300 |
| 116 | 3300025922 | Ga0207646_10182597 | Ga0207646_101825972 | 300 |
| 117 | 3300025972 | Ga0207668_10059961 | Ga0207668_100599612 | 300 |
| 118 | 3300035116 | Ga0373945_0034120 | Ga0373945_0034120_281_1210 | 300 |
| 119 | 3300003911 | JGI25405J52794_10000506 | JGI25405J52794_100005062 | 301 |
| 120 | 3300005445 | Ga0070708_100096640 | Ga0070708_1000966402 | 301 |
| 121 | 3300005468 | Ga0070707_100121473 | Ga0070707_1001214732 | 301 |
| 122 | 3300005471 | Ga0070698_100208223 | Ga0070698_1002082232 | 301 |
| 123 | 3300005536 | Ga0070697_100058976 | Ga0070697_1000589763 | 301 |
| 124 | 3300005536 | Ga0070697_100127039 | Ga0070697_1001270392 | 301 |
| 125 | 3300005937 | Ga0081455_10003953 | Ga0081455_1000395311 | 301 |
| 126 | 3300005937 | Ga0081455_10074782 | Ga0081455_100747822 | 301 |
| 127 | 3300025918 | Ga0207662_10001771 | Ga0207662_100017715 | 301 |
| 128 | 3300025922 | Ga0207646_10061732 | Ga0207646_100617322 | 301 |
| 129 | 3300028381 | Ga0268264_10165266 | Ga0268264_101652661 | 301 |
| 130 | 3300048907 | Ga0496104_0064790 | Ga0496104_0064790_1864_2865 | 301 |
| 131 | 3300048917 | Ga0496114_0035302 | Ga0496114_0035302_858_1859 | 301 |
| 132 | 3300048918 | Ga0496115_0053726 | Ga0496115_0053726_1173_2174 | 301 |
| 133 | 3300005289 | Ga0065704_10030013 | Ga0065704_100300132 | 302 |
| 134 | 3300005290 | Ga0065712_10002140 | Ga0065712_100021403 | 302 |
| 135 | 3300005290 | Ga0065712_10008756 | Ga0065712_100087562 | 302 |
| 136 | 3300005293 | Ga0065715_10004108 | Ga0065715_100041083 | 302 |
| 137 | 3300005328 | Ga0070676_10035739 | Ga0070676_100357393 | 302 |
| 138 | 3300005330 | Ga0070690_100009320 | Ga0070690_1000093204 | 302 |
| 139 | 3300005330 | Ga0070690_100075820 | Ga0070690_1000758202 | 302 |
| 140 | 3300005330 | Ga0070690_100143022 | Ga0070690_1001430222 | 302 |
| 141 | 3300005331 | Ga0070670_100115771 | Ga0070670_1001157712 | 302 |
| 142 | 3300005338 | Ga0068868_100209182 | Ga0068868_1002091822 | 302 |
| 143 | 3300005347 | Ga0070668_100130278 | Ga0070668_1001302781 | 302 |
| 144 | 3300005347 | Ga0070668_100361117 | Ga0070668_1003611172 | 302 |
| 145 | 3300005353 | Ga0070669_100162423 | Ga0070669_1001624231 | 302 |
| 146 | 3300005353 | Ga0070669_100419966 | Ga0070669_1004199661 | 302 |
| 147 | 3300005354 | Ga0070675_100019035 | Ga0070675_1000190354 | 302 |
| 148 | 3300005354 | Ga0070675_100020910 | Ga0070675_1000209103 | 302 |
| 149 | 3300005355 | Ga0070671_100078121 | Ga0070671_1000781212 | 302 |
| 150 | 3300005364 | Ga0070673_100062491 | Ga0070673_1000624912 | 302 |
| 151 | 3300005364 | Ga0070673_100355269 | Ga0070673_1003552691 | 302 |
| 152 | 3300005365 | Ga0070688_100027672 | Ga0070688_1000276723 | 302 |
| 153 | 3300005367 | Ga0070667_100056202 | Ga0070667_1000562023 | 302 |
| 154 | 3300005367 | Ga0070667_100212952 | Ga0070667_1002129522 | 302 |
| 155 | 3300005439 | Ga0070711_100012653 | Ga0070711_1000126532 | 302 |
| 156 | 3300005445 | Ga0070708_100118878 | Ga0070708_1001188782 | 302 |
| 157 | 3300005457 | Ga0070662_100130983 | Ga0070662_1001309832 | 302 |
| 158 | 3300005457 | Ga0070662_100328560 | Ga0070662_1003285602 | 302 |
| 159 | 3300005468 | Ga0070707_100007577 | Ga0070707_1000075778 | 302 |
| 160 | 3300005543 | Ga0070672_100028539 | Ga0070672_1000285392 | 302 |
| 161 | 3300005543 | Ga0070672_100055131 | Ga0070672_1000551312 | 302 |
| 162 | 3300005548 | Ga0070665_100133179 | Ga0070665_1001331792 | 302 |
| 163 | 3300005564 | Ga0070664_100301160 | Ga0070664_1003011601 | 302 |
| 164 | 3300005614 | Ga0068856_100517844 | Ga0068856_1005178442 | 302 |
| 165 | 3300005719 | Ga0068861_100123686 | Ga0068861_1001236861 | 302 |
| 166 | 3300005842 | Ga0068858_100310861 | Ga0068858_1003108611 | 302 |
| 167 | 3300005985 | Ga0081539_10011057 | Ga0081539_100110575 | 302 |
| 168 | 3300006163 | Ga0070715_10045846 | Ga0070715_100458462 | 302 |
| 169 | 3300006175 | Ga0070712_100026755 | Ga0070712_1000267552 | 302 |
| 170 | 3300006237 | Ga0097621_100193243 | Ga0097621_1001932432 | 302 |
| 171 | 3300009176 | Ga0105242_10237035 | Ga0105242_102370352 | 302 |
| 172 | 3300010375 | Ga0105239_10048141 | Ga0105239_100481412 | 302 |
| 173 | 3300013102 | Ga0157371_10070765 | Ga0157371_100707652 | 302 |
| 174 | 3300013297 | Ga0157378_10030092 | Ga0157378_100300924 | 302 |
| 175 | 3300013307 | Ga0157372_10322611 | Ga0157372_103226112 | 302 |
| 176 | 3300014968 | Ga0157379_10328223 | Ga0157379_103282232 | 302 |
| 177 | 3300014969 | Ga0157376_10230467 | Ga0157376_102304672 | 302 |
| 178 | 3300025271 | Ga0207666_1001110 | Ga0207666_10011103 | 302 |
| 179 | 3300025290 | Ga0207673_1000285 | Ga0207673_10002854 | 302 |
| 180 | 3300025315 | Ga0207697_10002578 | Ga0207697_100025783 | 302 |
| 181 | 3300025315 | Ga0207697_10020385 | Ga0207697_100203852 | 302 |
| 182 | 3300025901 | Ga0207688_10035120 | Ga0207688_100351203 | 302 |
| 183 | 3300025901 | Ga0207688_10193920 | Ga0207688_101939201 | 302 |
| 184 | 3300025903 | Ga0207680_10028958 | Ga0207680_100289582 | 302 |
| 185 | 3300025905 | Ga0207685_10052994 | Ga0207685_100529942 | 302 |
| 186 | 3300025910 | Ga0207684_10162335 | Ga0207684_101623351 | 302 |
| 187 | 3300025915 | Ga0207693_10007666 | Ga0207693_100076663 | 302 |
| 188 | 3300025916 | Ga0207663_10084704 | Ga0207663_100847042 | 302 |
| 189 | 3300025920 | Ga0207649_10118820 | Ga0207649_101188202 | 302 |
| 190 | 3300025926 | Ga0207659_10020822 | Ga0207659_100208223 | 302 |
| 191 | 3300025926 | Ga0207659_10029833 | Ga0207659_100298333 | 302 |
| 192 | 3300025932 | Ga0207690_10070228 | Ga0207690_100702282 | 302 |
| 193 | 3300025933 | Ga0207706_10087092 | Ga0207706_100870922 | 302 |
| 194 | 3300025933 | Ga0207706_10171663 | Ga0207706_101716632 | 302 |
| 195 | 3300025934 | Ga0207686_10038064 | Ga0207686_100380642 | 302 |
| 196 | 3300025936 | Ga0207670_10111387 | Ga0207670_101113872 | 302 |
| 197 | 3300025940 | Ga0207691_10017306 | Ga0207691_100173064 | 302 |
| 198 | 3300025944 | Ga0207661_10100030 | Ga0207661_101000302 | 302 |
| 199 | 3300025960 | Ga0207651_10138542 | Ga0207651_101385422 | 302 |
| 200 | 3300025960 | Ga0207651_10200329 | Ga0207651_102003292 | 302 |
| 201 | 3300025972 | Ga0207668_10324866 | Ga0207668_103248662 | 302 |
| 202 | 3300025986 | Ga0207658_10025145 | Ga0207658_100251452 | 302 |
| 203 | 3300025986 | Ga0207658_10343347 | Ga0207658_103433472 | 302 |
| 204 | 3300026023 | Ga0207677_10140968 | Ga0207677_101409682 | 302 |
| 205 | 3300026035 | Ga0207703_10396398 | Ga0207703_103963981 | 302 |
| 206 | 3300026088 | Ga0207641_10119562 | Ga0207641_101195622 | 302 |
| 207 | 3300026118 | Ga0207675_100164176 | Ga0207675_1001641762 | 302 |
| 208 | 3300026121 | Ga0207683_10008431 | Ga0207683_100084315 | 302 |
| 209 | 3300028379 | Ga0268266_10073478 | Ga0268266_100734782 | 302 |
| 210 | 3300035692 | Ga0373935_0005347 | Ga0373935_0005347_6148_7119 | 302 |
| 211 | 3300037418 | Ga0395900_0235823 | Ga0395900_0235823_449_1360 | 302 |
| 212 | 3300045976 | Ga0466967_0174742 | Ga0466967_0174742_304_1299 | 302 |
| 213 | 3300046516 | Ga0495628_0138054 | Ga0495628_0138054_558_1550 | 302 |
| 214 | 3300046684 | Ga0495669_0057476 | Ga0495669_0057476_61_990 | 302 |
| 215 | 3300048905 | Ga0496102_0157217 | Ga0496102_0157217_925_1896 | 302 |
| 216 | 3300048908 | Ga0496105_0375574 | Ga0496105_0375574_63_1034 | 302 |
| 217 | 3300048912 | Ga0496109_0140315 | Ga0496109_0140315_16_987 | 302 |
| 218 | 3300048912 | Ga0496109_0179267 | Ga0496109_0179267_726_1697 | 302 |
| 219 | 3300048916 | Ga0496113_0012262 | Ga0496113_0012262_3522_4493 | 302 |
| 220 | 3300005328 | Ga0070676_10032258 | Ga0070676_100322583 | 303 |
| 221 | 3300005334 | Ga0068869_100115735 | Ga0068869_1001157351 | 303 |
| 222 | 3300005338 | Ga0068868_100061475 | Ga0068868_1000614752 | 303 |
| 223 | 3300005339 | Ga0070660_100405366 | Ga0070660_1004053661 | 303 |
| 224 | 3300005354 | Ga0070675_100205525 | Ga0070675_1002055251 | 303 |
| 225 | 3300005436 | Ga0070713_100100177 | Ga0070713_1001001771 | 303 |
| 226 | 3300005467 | Ga0070706_100001631 | Ga0070706_10000163126 | 303 |
| 227 | 3300005467 | Ga0070706_100025395 | Ga0070706_1000253952 | 303 |
| 228 | 3300005467 | Ga0070706_100183042 | Ga0070706_1001830421 | 303 |
| 229 | 3300005468 | Ga0070707_100602767 | Ga0070707_1006027671 | 303 |
| 230 | 3300005471 | Ga0070698_100225832 | Ga0070698_1002258322 | 303 |
| 231 | 3300005536 | Ga0070697_100448397 | Ga0070697_1004483971 | 303 |
| 232 | 3300006028 | Ga0070717_10000353 | Ga0070717_1000035318 | 303 |
| 233 | 3300006028 | Ga0070717_10243584 | Ga0070717_102435842 | 303 |
| 234 | 3300006175 | Ga0070712_100105655 | Ga0070712_1001056552 | 303 |
| 235 | 3300006175 | Ga0070712_100192084 | Ga0070712_1001920842 | 303 |
| 236 | 3300009553 | Ga0105249_10416627 | Ga0105249_104166271 | 303 |
| 237 | 3300010375 | Ga0105239_10413019 | Ga0105239_104130191 | 303 |
| 238 | 3300013306 | Ga0163162_10481265 | Ga0163162_104812651 | 303 |
| 239 | 3300013307 | Ga0157372_10255660 | Ga0157372_102556602 | 303 |
| 240 | 3300013308 | Ga0157375_10509710 | Ga0157375_105097102 | 303 |
| 241 | 3300025315 | Ga0207697_10000361 | Ga0207697_100003611 | 303 |
| 242 | 3300025910 | Ga0207684_10004361 | Ga0207684_100043618 | 303 |
| 243 | 3300025915 | Ga0207693_10020250 | Ga0207693_100202505 | 303 |
| 244 | 3300025919 | Ga0207657_10193295 | Ga0207657_101932951 | 303 |
| 245 | 3300025923 | Ga0207681_10237005 | Ga0207681_102370051 | 303 |
| 246 | 3300025933 | Ga0207706_10001926 | Ga0207706_100019268 | 303 |
| 247 | 3300025942 | Ga0207689_10153533 | Ga0207689_101535332 | 303 |
| 248 | 3300045051 | Ga0451576_0168791 | Ga0451576_0168791_191_1105 | 303 |
| 249 | 3300005289 | Ga0065704_10175728 | Ga0065704_101757281 | 304 |
| 250 | 3300005295 | Ga0065707_10009213 | Ga0065707_100092132 | 304 |
| 251 | 3300005329 | Ga0070683_100013209 | Ga0070683_1000132093 | 304 |
| 252 | 3300005340 | Ga0070689_100023759 | Ga0070689_1000237593 | 304 |
| 253 | 3300005445 | Ga0070708_100010150 | Ga0070708_1000101508 | 304 |
| 254 | 3300005468 | Ga0070707_100017172 | Ga0070707_1000171725 | 304 |
| 255 | 3300005536 | Ga0070697_100013694 | Ga0070697_1000136947 | 304 |
| 256 | 3300005841 | Ga0068863_100055153 | Ga0068863_1000551533 | 304 |
| 257 | 3300005937 | Ga0081455_10002038 | Ga0081455_100020387 | 304 |
| 258 | 3300005937 | Ga0081455_10139368 | Ga0081455_101393682 | 304 |
| 259 | 3300009147 | Ga0114129_10000103 | Ga0114129_1000010312 | 304 |
| 260 | 3300013306 | Ga0163162_10154105 | Ga0163162_101541051 | 304 |
| 261 | 3300025904 | Ga0207647_10036701 | Ga0207647_100367012 | 304 |
| 262 | 3300025910 | Ga0207684_10014170 | Ga0207684_100141708 | 304 |
| 263 | 3300025918 | Ga0207662_10222767 | Ga0207662_102227672 | 304 |
| 264 | 3300025922 | Ga0207646_10004673 | Ga0207646_100046734 | 304 |
| 265 | 3300025932 | Ga0207690_10045637 | Ga0207690_100456373 | 304 |
| 266 | 3300026088 | Ga0207641_10056210 | Ga0207641_100562103 | 304 |
| 267 | 3300037312 | Ga0395899_0088825 | Ga0395899_0088825_210_1145 | 304 |
| 268 | 3300037418 | Ga0395900_0058207 | Ga0395900_0058207_988_1905 | 304 |
| 269 | 3300037466 | Ga0395898_0026807 | Ga0395898_0026807_2096_3031 | 304 |
| 270 | 3300037471 | Ga0395905_0004291 | Ga0395905_0004291_12655_13590 | 304 |
| 271 | 3300038443 | Ga0395901_0000939 | Ga0395901_0000939_13663_14598 | 304 |
| 272 | 3300048913 | Ga0496110_0041468 | Ga0496110_0041468_2925_3878 | 304 |
| 273 | 3300050507 | nmdc:mga05p37_12758_c1 | nmdc:mga05p37_12758_c1_287_1204 | 304 |
| 274 | 3300005339 | Ga0070660_100049190 | Ga0070660_1000491901 | 305 |
| 275 | 3300005434 | Ga0070709_10009519 | Ga0070709_100095193 | 305 |
| 276 | 3300005439 | Ga0070711_100025078 | Ga0070711_1000250783 | 305 |
| 277 | 3300005441 | Ga0070700_100014268 | Ga0070700_1000142681 | 305 |
| 278 | 3300005445 | Ga0070708_100078043 | Ga0070708_1000780433 | 305 |
| 279 | 3300005467 | Ga0070706_100124179 | Ga0070706_1001241792 | 305 |
| 280 | 3300005518 | Ga0070699_100462426 | Ga0070699_1004624261 | 305 |
| 281 | 3300006173 | Ga0070716_100080851 | Ga0070716_1000808512 | 305 |
| 282 | 3300006173 | Ga0070716_100217200 | Ga0070716_1002172001 | 305 |
| 283 | 3300025906 | Ga0207699_10055158 | Ga0207699_100551582 | 305 |
| 284 | 3300025922 | Ga0207646_10077293 | Ga0207646_100772932 | 305 |
| 285 | 3300025928 | Ga0207700_10025274 | Ga0207700_100252743 | 305 |
| 286 | 3300025939 | Ga0207665_10060233 | Ga0207665_100602332 | 305 |
| 287 | 3300025945 | Ga0207679_10108834 | Ga0207679_101088342 | 305 |
| 288 | 3300050507 | nmdc:mga05p37_620706_c1 | nmdc:mga05p37_620706_c1_48_968 | 305 |
| 289 | 3300005439 | Ga0070711_100054863 | Ga0070711_1000548632 | 306 |
| 290 | 3300005440 | Ga0070705_100029361 | Ga0070705_1000293613 | 306 |
| 291 | 3300005467 | Ga0070706_100000100 | Ga0070706_10000010057 | 307 |
| 292 | 3300025910 | Ga0207684_10000128 | Ga0207684_1000012859 | 307 |
| 293 | 3300025922 | Ga0207646_10263615 | Ga0207646_102636152 | 307 |
| 294 | 3300002126 | JGI24035J26624_1000559 | JGI24035J26624_10005593 | 308 |
| 295 | 3300005290 | Ga0065712_10003323 | Ga0065712_100033234 | 308 |
| 296 | 3300005293 | Ga0065715_10091062 | Ga0065715_100910624 | 308 |
| 297 | 3300005329 | Ga0070683_100054928 | Ga0070683_1000549283 | 308 |
| 298 | 3300005335 | Ga0070666_10056050 | Ga0070666_100560502 | 308 |
| 299 | 3300005339 | Ga0070660_100264818 | Ga0070660_1002648181 | 308 |
| 300 | 3300005353 | Ga0070669_100058417 | Ga0070669_1000584173 | 308 |
| 301 | 3300005354 | Ga0070675_100114447 | Ga0070675_1001144472 | 308 |
| 302 | 3300005355 | Ga0070671_100114700 | Ga0070671_1001147002 | 308 |
| 303 | 3300005356 | Ga0070674_100103290 | Ga0070674_1001032902 | 308 |
| 304 | 3300005364 | Ga0070673_100020062 | Ga0070673_1000200624 | 308 |
| 305 | 3300005365 | Ga0070688_100017104 | Ga0070688_1000171044 | 308 |
| 306 | 3300005365 | Ga0070688_100060734 | Ga0070688_1000607342 | 308 |
| 307 | 3300005455 | Ga0070663_100010333 | Ga0070663_1000103334 | 308 |
| 308 | 3300005456 | Ga0070678_100029155 | Ga0070678_1000291555 | 308 |
| 309 | 3300005458 | Ga0070681_10021010 | Ga0070681_100210104 | 308 |
| 310 | 3300005466 | Ga0070685_10053357 | Ga0070685_100533572 | 308 |
| 311 | 3300005530 | Ga0070679_100007098 | Ga0070679_1000070986 | 308 |
| 312 | 3300005535 | Ga0070684_100023359 | Ga0070684_1000233592 | 308 |
| 313 | 3300005535 | Ga0070684_100024720 | Ga0070684_1000247201 | 308 |
| 314 | 3300005548 | Ga0070665_100030877 | Ga0070665_1000308774 | 308 |
| 315 | 3300005564 | Ga0070664_100117196 | Ga0070664_1001171963 | 308 |
| 316 | 3300005614 | Ga0068856_100038980 | Ga0068856_1000389802 | 308 |
| 317 | 3300005841 | Ga0068863_100037243 | Ga0068863_1000372435 | 308 |
| 318 | 3300005937 | Ga0081455_10038275 | Ga0081455_100382752 | 308 |
| 319 | 3300006237 | Ga0097621_100185773 | Ga0097621_1001857732 | 308 |
| 320 | 3300009098 | Ga0105245_10037275 | Ga0105245_100372752 | 308 |
| 321 | 3300009147 | Ga0114129_10241310 | Ga0114129_102413102 | 308 |
| 322 | 3300009553 | Ga0105249_10072092 | Ga0105249_100720923 | 308 |
| 323 | 3300013308 | Ga0157375_10015060 | Ga0157375_100150603 | 308 |
| 324 | 3300014325 | Ga0163163_10219045 | Ga0163163_102190452 | 308 |
| 325 | 3300025315 | Ga0207697_10001716 | Ga0207697_100017165 | 308 |
| 326 | 3300025315 | Ga0207697_10016546 | Ga0207697_100165463 | 308 |
| 327 | 3300025315 | Ga0207697_10040265 | Ga0207697_100402652 | 308 |
| 328 | 3300025903 | Ga0207680_10076411 | Ga0207680_100764112 | 308 |
| 329 | 3300025912 | Ga0207707_10007556 | Ga0207707_100075565 | 308 |
| 330 | 3300025918 | Ga0207662_10058898 | Ga0207662_100588982 | 308 |
| 331 | 3300025919 | Ga0207657_10299752 | Ga0207657_102997522 | 308 |
| 332 | 3300025920 | Ga0207649_10026090 | Ga0207649_100260903 | 308 |
| 333 | 3300025921 | Ga0207652_10040386 | Ga0207652_100403863 | 308 |
| 334 | 3300025926 | Ga0207659_10163598 | Ga0207659_101635982 | 308 |
| 335 | 3300025926 | Ga0207659_10376507 | Ga0207659_103765071 | 308 |
| 336 | 3300025931 | Ga0207644_10208558 | Ga0207644_102085582 | 308 |
| 337 | 3300025933 | Ga0207706_10350287 | Ga0207706_103502871 | 308 |
| 338 | 3300025937 | Ga0207669_10038991 | Ga0207669_100389913 | 308 |
| 339 | 3300025939 | Ga0207665_10305854 | Ga0207665_103058542 | 308 |
| 340 | 3300025944 | Ga0207661_10123936 | Ga0207661_101239362 | 308 |
| 341 | 3300025944 | Ga0207661_10377704 | Ga0207661_103777042 | 308 |
| 342 | 3300025960 | Ga0207651_10022092 | Ga0207651_100220923 | 308 |
| 343 | 3300026121 | Ga0207683_10070402 | Ga0207683_100704022 | 308 |
| 344 | 3300028379 | Ga0268266_10017633 | Ga0268266_100176333 | 308 |
| 345 | 3300035117 | Ga0373953_0040848 | Ga0373953_0040848_76_1005 | 308 |
| 346 | 3300035172 | Ga0373955_0050341 | Ga0373955_0050341_999_1928 | 308 |
| 347 | 3300035725 | Ga0373947_0037367 | Ga0373947_0037367_1630_2556 | 308 |
| 348 | 3300041512 | Ga0451853_1182859 | Ga0451853_1182859_240_1166 | 308 |
| 349 | 3300046454 | Ga0495592_0256719 | Ga0495592_0256719_182_1114 | 308 |
| 350 | 3300046463 | Ga0495653_0072010 | Ga0495653_0072010_820_1749 | 308 |
| 351 | 3300046526 | Ga0495666_0167050 | Ga0495666_0167050_38_967 | 308 |
| 352 | 3300046679 | Ga0495623_0008269 | Ga0495623_0008269_997_1926 | 308 |
| 353 | 3300047444 | Ga0495675_0008517 | Ga0495675_0008517_92_1021 | 308 |
| 354 | 3300048088 | Ga0495602_0014474 | Ga0495602_0014474_411_1340 | 308 |
| 355 | 3300048905 | Ga0496102_0197130 | Ga0496102_0197130_418_1344 | 308 |
| 356 | 3300048915 | Ga0496112_0012303 | Ga0496112_0012303_2994_3920 | 308 |
| 357 | 3300048918 | Ga0496115_0012099 | Ga0496115_0012099_3131_4057 | 308 |
| 358 | 3300050514 | nmdc:mga08x19_262782_c1 | nmdc:mga08x19_262782_c1_208_1137 | 308 |
| 359 | 3300053077 | Ga0495601_0048391 | Ga0495601_0048391_534_1463 | 308 |
| 360 | 3300053085 | Ga0495619_0191796 | Ga0495619_0191796_242_1174 | 308 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cjg-assembly2.cif.gz_B | structural and kinetic characterization of porphyromonas gingivalis glutaminyl cyclase | 0.8821 | 40 | 303 |
| 6qql-assembly2.cif.gz_B | crystal structure of porphyromonas gingivalis glutaminyl cyclase | 0.8771 | 39 | 303 |
| 3gux-assembly1.cif.gz_A | crystal structure of a putative zn-dependent exopeptidase (bvu_1317) from bacteroides vulgatus atcc 8482 at 1.80 a resolution | 0.8716 | 39 | 303 |
| 3gux-assembly2.cif.gz_B | crystal structure of a putative zn-dependent exopeptidase (bvu_1317) from bacteroides vulgatus atcc 8482 at 1.80 a resolution | 0.8647 | 39 | 299 |
| 7d1e-assembly1.cif.gz_A | crystal structure of bacteroides thetaiotaomicron glutaminyl cyclase bound to n-acetylhistamine | 0.8583 | 39 | 303 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3guxB00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.8611 | 39 | 303 | 3.40.630.10 |
| 4fuuA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.8456 | 39 | 303 | 3.40.630.10 |
| af_Q9VTH7_29_337_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.8366 | 36 | 304 | 3.40.630.10 |
| 3guxB00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.8345 | 39 | 303 | 3.40.630.10 |
| 4fwuA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.8294 | 43 | 308 | 3.40.630.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5K3Q2-F1-model_v4 | Peptidase M28 domain-containing protein | 0.9546 | 31 | 306 |
GO:0008270
GO:0016603 |
| AF-A0A2V5XSA8-F1-model_v4 | Peptidase M28 domain-containing protein | 0.9535 | 31 | 308 |
GO:0008270
GO:0016603 |
| AF-A0A2V6G9P1-F1-model_v4 | Peptidase M28 domain-containing protein | 0.9532 | 30 | 306 |
GO:0008270
GO:0016603 |
| AF-A0A2V5M337-F1-model_v4 | Peptidase M28 domain-containing protein | 0.9511 | 30 | 306 |
GO:0008270
GO:0016603 |
| AF-A0A2V5WNX4-F1-model_v4 | Peptidase M28 domain-containing protein | 0.9448 | 30 | 306 |
GO:0008270
GO:0016603 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar