F421714

General Info

Members Datasets Scaffolds Average Seq Length
359 288 718 431

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2775507192|2777836309
Length 466
Sequence KSEIDKRPVQKAKTLAYKEIVYILKGGQHMSYRFQKLYEEKVFKDPVHRYIHVRDQVIWDLIGTKEFQRLRRIKQLGTTYLTFHGAEHSRFTHSLGVYEIIRRMVDDVFSGRPEWNDDDRLLALCAGLLHDVGHGPFSHTFEKIFNLDHEELTREIIEGSTEINEILKRVGDDFPMKVSEVIGKTSKNKLVTSMISSQIDADRMDYLLRDAYYTGVSYGNFDMERILRIMRPRPDGVVIKQSGMHAVEHYLISRFQMYWQVYFHPVSRSAEAILQKILQRAKYLHETGYHFNYVPVHFGHLFEGKIDLEEYIKLDESVLLYYFQVWQEESDQILSDLCQRFLNRNLFQYVDFDTQNHTEKFAELKKLFLEIDIDSEYYLVIDTISDEAYDYFRYGEEDGKKPILLLQTNGDLKEISRKSELVDGITGKELFDSKLYFPYDLIYKNPDDKKKKVIEMIEEIAGAKRR

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
10 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
11 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
12 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
13 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
14 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
17 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
18 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
19 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
20 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
21 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
25 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
26 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
27 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
28 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
30 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
39 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
40 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
41 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
42 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
43 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
44 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
45 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
46 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
47 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
48 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
49 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
50 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
51 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
52 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
53 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
54 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
55 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
56 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
57 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
58 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
59 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
60 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
61 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
62 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
63 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
64 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
65 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
66 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
67 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
68 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
69 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
70 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
71 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
72 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
73 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
74 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
75 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
76 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
77 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
78 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
79 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
96 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
98 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
99 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
100 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
101 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
102 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
103 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
104 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
105 2554235283 Bacillus safensis VK Isolate Rhizosphere
106 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
107 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
108 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
109 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
110 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
111 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
112 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
113 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
114 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
115 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
116 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
117 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
118 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
119 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
120 2643221729 Bacillus sp. Root11 Isolate Unclassified
121 2643221730 Bacillus sp. Root131 Isolate Unclassified
122 2643221731 Bacillus sp. Root147 Isolate Unclassified
123 2643221732 Bacillus sp. Root239 Isolate Unclassified
124 2643221735 Bacillus sp. Root920 Isolate Unclassified
125 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
126 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
127 2671180694 Paenibacillus sp. A3 Isolate Unclassified
128 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
129 2684622632 Bacillus cereus 905 Isolate Unclassified
130 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
131 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
132 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
133 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
134 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
135 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
136 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
137 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
138 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
139 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
140 2738541295 Bacillus sp. OK085 Isolate Unclassified
141 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
142 2738541358 Bacillus sp. OV752 Isolate Unclassified
143 2738543006 Bacillus sp. OK077 Isolate Unclassified
144 2738543010 Bacillus sp. YR335 Isolate Unclassified
145 2738543017 Bacillus sp. OV186 Isolate Unclassified
146 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
147 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
148 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
149 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
150 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
151 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
152 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
153 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
154 2811994870 Bacillus sp. JB4 Isolate Unclassified
155 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
156 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
157 2818991441 Niallia circulans 3243 Isolate Rhizosphere
158 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
159 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
160 2818991459 Paenibacillus sp. 597 Isolate Unclassified
161 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
162 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
163 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
164 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
165 2842682962 Bacillus sp. R-72492 Isolate Unclassified
166 2842882022 Bacillus sp. R-71893 Isolate Unclassified
167 2849139964 Bacillus sp. R-71875 Isolate Unclassified
168 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
169 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
170 2857472729 Cohnella sp. R-74144 Isolate Unclassified
171 2857581216 Bacillus sp. R-71922 Isolate Unclassified
172 2857586860 Bacillus sp. R-71935 Isolate Unclassified
173 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
174 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
175 2860837431 Bacillus sp. WR11 Isolate Unclassified
176 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
177 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
178 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
179 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
180 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
181 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
182 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
183 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
184 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
185 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
186 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
187 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
188 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
189 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
190 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
191 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
192 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
193 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
194 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
195 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
196 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
197 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
198 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
199 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
200 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
201 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
202 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
203 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
204 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
205 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
206 2919720352 Priestia megaterium 4340 Isolate Unclassified
207 2919726948 Bacillus pumilus 4489 Isolate Unclassified
208 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
209 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
210 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
211 2929004312 Priestia megaterium 1104 Isolate Unclassified
212 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
213 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
214 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
215 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
216 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
217 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
218 2938917290 Bacillus sp. CR71 Isolate Unclassified
219 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
220 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
221 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
222 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
223 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
224 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
225 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
226 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
227 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
228 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
229 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
230 2965761152 Bacillus sp. COPE52 Isolate Unclassified
231 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
232 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
233 2969141011 Bacillus velezensis MH25 Isolate Unclassified
234 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
235 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
236 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
237 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
238 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
239 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
240 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
241 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
242 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
243 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
244 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
245 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
246 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
247 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
248 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
249 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
250 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
251 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
252 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
253 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
254 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
255 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
256 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
257 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
258 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
259 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
260 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
261 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
262 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
263 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
264 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
265 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
266 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
267 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
268 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
269 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
270 8022653035 Bacillus sp. Rc4 Isolate Unclassified
271 8022792930 Bacillus sp. Xin Isolate Rhizosphere
272 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
273 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
274 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
275 8023438354 Bacillus sp. BH2 Isolate Unclassified
276 8023444577 Bacillus sp. BH32 Isolate Unclassified
277 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
278 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
279 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
280 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
281 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
282 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
283 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
284 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
285 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
286 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
287 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
288 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 39.55
Metatranscriptomes 6.96
Isolates 53.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.56
Bulb 0
Endosphere 10.86
Nodule 0.28
Rhizoplane 4.46
Rhizosphere 47.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000061 3300003187 Bacteria 146828
2 JGI25151J46595_10001044 3300003187 Bacteria 20675
3 JGI25151J46595_10008271 3300003187 Bacteria 5018
4 JGI25151J46595_10009444 3300003187 Bacteria 4616
5 JGI25151J46595_10012061 3300003187 Bacteria 3942
6 rootH2_10040044 3300003320 Bacteria 14085
7 rootL2_10010890 3300003322 Bacteria 24266
8 Ga0006562J51391_1003813 3300003578 Bacteria 2540
9 Ga0006562J51391_1004890 3300003578 Bacteria 6280
10 Ga0006562J51391_1023376 3300003578 Bacteria 2763
11 Ga0055532_1000091 3300003758 Bacteria 103710
12 Ga0055532_1003500 3300003758 Bacteria 2662
13 Ga0055536_1011506 3300003781 Bacteria 3384
14 Ga0055528_1002504 3300003790 Bacteria 9805
15 Ga0055541_1000158 3300003841 Bacteria 33250
16 Ga0055541_1002493 3300003841 Bacteria 3660
17 Ga0070672_100062739 3300005543 Bacteria 2934
18 Ga0105251_10006247 3300009011 Bacteria 7636
19 Ga0105251_10014221 3300009011 Bacteria 4413
20 Ga0105244_10004740 3300009036 Bacteria 9258
21 Ga0105244_10027847 3300009036 Bacteria 3040
22 Ga0105244_10031574 3300009036 Bacteria 2810
23 Ga0105250_10003487 3300009092 Bacteria 7443
24 Ga0105245_10027835 3300009098 Bacteria 4981
25 Ga0105247_10005598 3300009101 Bacteria 7885
26 Ga0105243_10011747 3300009148 Bacteria 6622
27 Ga0105242_10005936 3300009176 Bacteria 9420
28 Ga0105246_10002991 3300011119 Bacteria 10245
29 Ga0105246_10004083 3300011119 Bacteria 8859
30 Ga0157371_10009255 3300013102 Bacteria 7771
31 Ga0157378_10002187 3300013297 Bacteria 17345
32 Ga0157377_10013687 3300014745 Bacteria 4112
33 Ga0209784_100051 3300025224 Bacteria 183666
34 Ga0209784_100151 3300025224 Bacteria 63336
35 Ga0209566_100116 3300025225 Bacteria 107510
36 Ga0209566_100196 3300025225 Bacteria 62620
37 Ga0209566_100205 3300025225 Bacteria 61044
38 Ga0209147_100062 3300025229 Bacteria 242831
39 Ga0209147_100470 3300025229 Bacteria 24707
40 Ga0209147_103172 3300025229 Bacteria 3377
41 Ga0209437_100524 3300025233 Bacteria 26708
42 Ga0209673_1004297 3300025273 Bacteria 7701
43 Ga0209130_1001708 3300025284 Bacteria 13271
44 Ga0209130_1002717 3300025284 Bacteria 8402
45 Ga0209130_1002828 3300025284 Bacteria 8064
46 Ga0209675_1008073 3300025291 Bacteria 3928
47 Ga0209675_1012238 3300025291 Bacteria 2777
48 Ga0209676_1000784 3300025292 Bacteria 42325
49 Ga0209676_1001446 3300025292 Bacteria 22364
50 Ga0209025_1000011 3300025294 Bacteria 976387
51 Ga0209025_1000287 3300025294 Bacteria 113923
52 Ga0209025_1000331 3300025294 Bacteria 104721
53 Ga0209025_1001038 3300025294 Bacteria 40754
54 Ga0209025_1002664 3300025294 Bacteria 18239
55 Ga0209025_1002858 3300025294 Bacteria 17322
56 Ga0209025_1002923 3300025294 Bacteria 17011
57 Ga0209025_1003142 3300025294 Bacteria 16132
58 Ga0209025_1004976 3300025294 Bacteria 11116
59 Ga0209025_1006867 3300025294 Bacteria 8684
60 Ga0209025_1009533 3300025294 Bacteria 6744
61 Ga0207696_1002199 3300025711 Bacteria 9767
62 Ga0207696_1010310 3300025711 Bacteria 3432
63 Ga0207655_1004832 3300025728 Bacteria 9376
64 Ga0207655_1006420 3300025728 Bacteria 7796
65 Ga0207655_1021035 3300025728 Bacteria 3327
66 Ga0207655_1034620 3300025728 Bacteria 2268
67 Ga0207655_1036835 3300025728 Bacteria 2164
68 Ga0207713_1002567 3300025735 Bacteria 13121
69 Ga0207713_1004189 3300025735 Bacteria 9456
70 Ga0207713_1029215 3300025735 Bacteria 2474
71 Ga0207645_10014343 3300025907 Bacteria 5305
72 Ga0207681_10068455 3300025923 Bacteria 2466
73 Ga0207687_10015352 3300025927 Bacteria 5020
74 Ga0207686_10016175 3300025934 Bacteria 4182
75 Ga0207709_10031318 3300025935 Bacteria 3105
76 Ga0237817_10046 3300030083 Bacteria 42105
77 Ga0237817_10084 3300030083 Bacteria 28761
78 Ga0268256_1008005 3300030500 Bacteria 3675
79 Ga0307410_10031966 3300031852 Bacteria 3382
80 Ga0307416_100063251 3300032002 Bacteria 3029
81 Ga0307416_100111590 3300032002 Bacteria 2411
82 Ga0395900_0278989 3300037418 Bacteria 1664
83 Ga0237819_00011 3300038705 Bacteria 65140
84 Ga0237819_01079 3300038705 Bacteria 8062
85 Ga0439436_0010153 3300041404 Bacteria 2875
86 Ga0439439_0001681 3300041406 Bacteria 4492
87 Ga0439449_0000662 3300042007 Bacteria 13021
88 Ga0439449_0026319 3300042007 Bacteria 2171
89 Ga0466968_0018858 3300044735 Bacteria 2770
90 Ga0466959_0008975 3300045049 Bacteria 7094
91 Ga0466967_0000341 3300045976 Bacteria 21472
92 Ga0495585_0007991 3300046492 Bacteria 6431
93 Ga0495622_0014255 3300046557 Bacteria 3692
94 Ga0495633_0078415 3300046558 Bacteria 1538
95 Ga0495649_0054819 3300046694 Bacteria 2155
96 Ga0495660_0004595 3300046810 Bacteria 8328
97 Ga0495660_0005733 3300046810 Bacteria 7417
98 Ga0495683_0009169 3300047323 Bacteria 5273
99 Ga0496100_0001375 3300048903 Bacteria 11916
100 Ga0496102_0003257 3300048905 Bacteria 13770
101 Ga0496103_0007342 3300048906 Bacteria 6568
102 Ga0496104_0001346 3300048907 Bacteria 21272
103 Ga0496106_0008997 3300048909 Bacteria 7380
104 Ga0496107_0021280 3300048910 Bacteria 4584
105 Ga0496108_0002954 3300048911 Bacteria 13670
106 Ga0496109_0001532 3300048912 Bacteria 19232
107 Ga0496110_0092274 3300048913 Bacteria 2710
108 Ga0496111_0001455 3300048914 Bacteria 13533
109 Ga0496111_0002682 3300048914 Bacteria 10810
110 Ga0496112_0005699 3300048915 Bacteria 10816
111 Ga0496113_0073279 3300048916 Bacteria 2608
112 Ga0496113_0122938 3300048916 Bacteria 2031
113 Ga0496116_0000596 3300048919 Bacteria 48028
114 Ga0496116_0000782 3300048919 Bacteria 40453
115 Ga0496116_0010830 3300048919 Bacteria 7606
116 Ga0496116_0017653 3300048919 Bacteria 5530
117 Ga0496116_0040865 3300048919 Bacteria 3188
118 Ga0496117_0040456 3300048920 Bacteria 3428
119 Ga0496117_0112843 3300048920 Bacteria 1689
120 Ga0496118_0047711 3300048921 Bacteria 3316
121 Ga0496119_0000682 3300048922 Bacteria 45362
122 Ga0496119_0006105 3300048922 Bacteria 11283
123 Ga0496119_0010134 3300048922 Bacteria 7960
124 Ga0496120_0000678 3300048923 Bacteria 49988
125 Ga0496120_0060661 3300048923 Bacteria 2115
126 Ga0496121_0123541 3300048924 Bacteria 1950
127 Ga0496121_0156824 3300048924 Bacteria 1669
128 Ga0496122_0008096 3300048925 Bacteria 11457
129 Ga0496122_0008160 3300048925 Bacteria 11387
130 Ga0496122_0053526 3300048925 Bacteria 3042
131 Ga0496122_0065504 3300048925 Bacteria 2633
132 Ga0496122_0077691 3300048925 Bacteria 2329
133 Ga0496122_0133589 3300048925 Bacteria 1570
134 Ga0496123_0002354 3300048926 Bacteria 23709
135 Ga0496124_0000542 3300048927 Bacteria 64211
136 Ga0496124_0010181 3300048927 Bacteria 9562
137 Ga0496124_0049425 3300048927 Bacteria 3588
138 Ga0496124_0070314 3300048927 Bacteria 2904
139 Ga0496125_0008810 3300048928 Bacteria 10492
140 Ga0496126_0005347 3300048929 Bacteria 14684
141 Ga0496126_0011284 3300048929 Bacteria 9269
142 Ga0496126_0012013 3300048929 Bacteria 8899
143 Ga0496126_0036498 3300048929 Bacteria 4595
144 Ga0501306_004264 3300049127 Bacteria 1593
145 Ga0501341_00351 3300049131 Bacteria 1848
146 Ga0501305_000837 3300049161 Bacteria 2742
147 Ga0501311_002774 3300049527 Bacteria 1713
148 Ga0501312_001079 3300049528 Bacteria 2546
149 Ga0501312_003763 3300049528 Bacteria 1746
150 Ga0501312_004453 3300049528 Bacteria 1653
151 Ga0501313_000730 3300049529 Bacteria 2456
152 Ga0501313_002107 3300049529 Bacteria 1847
153 Ga0501315_001094 3300049531 Bacteria 2197
154 Ga0501316_001253 3300049532 Bacteria 2109
155 Ga0501316_002706 3300049532 Bacteria 1663
156 Ga0501317_001226 3300049533 Bacteria 2154
157 Ga0501318_000886 3300049534 Bacteria 2135
158 Ga0501318_001512 3300049534 Bacteria 1849
159 Ga0501323_001237 3300049539 Bacteria 2205
160 Ga0501333_000469 3300049549 Bacteria 1857
161 Ga0501334_00371 3300049550 Bacteria 1999
162 Ga0501335_000194 3300049551 Bacteria 3346
163 Ga0501337_000106 3300049553 Bacteria 3213
164 Ga0501340_000503 3300049556 Bacteria 1757
165 Ga0501217_001414 3300049661 Bacteria 4489
166 Ga0501217_013733 3300049661 Bacteria 1820
167 Ga0587079_001438 3300059647 Bacteria 2661
168 2777836309 2775507192 Bacteria 4622234
169 2511701476 2511231119 Bacteria 4019861
170 2512736619 2512564039 Bacteria 8739048
171 2524191705 2524023129 Bacteria 6762600
172 2540608686 2540341094 Bacteria 4061186
173 2545557810 2545555800 Bacteria 4222588
174 2550903432 2548877040 Bacteria 7507281
175 2553391265 2551306519 Bacteria 5465154
176 2555468625 2554235283 Bacteria 3683090
177 2563930592 2563366752 Bacteria 4961801
178 2571530875 2571042143 Bacteria 6986194
179 2573041708 2571042588 Bacteria 5045676
180 2578334536 2576861424 Bacteria 5270569
181 2578932202 2576861599 Bacteria 4217202
182 2580930453 2579778775 Bacteria 5360914
183 2587743976 2585428059 Bacteria 8696589
184 2595091935 2593339131 Bacteria 5116855
185 2595320782 2593339198 Bacteria 7267884
186 2601636911 2600255286 Bacteria 5390125
187 2621272562 2619619294 Bacteria 5575484
188 2631983356 2630968484 Bacteria 3876276
189 2643738690 2643221543 Bacteria 6628015
190 2644423951 2643221676 Bacteria 8119172
191 2644702498 2643221729 Bacteria 6621700
192 2644715128 2643221730 Bacteria 6523787
193 2644720483 2643221731 Bacteria 5623886
194 2644726432 2643221732 Bacteria 5756404
195 2644738580 2643221735 Bacteria 3676263
196 2651531082 2648501850 Bacteria 3975476
197 2672338696 2671180330 Bacteria 5521719
198 2673818955 2671180694 Bacteria 7506943
199 2674421584 2671180844 Bacteria 4164150
200 2685153336 2684622632 Bacteria 5380049
201 2686998770 2684623153 Bacteria 3878815
202 2687500058 2687453109 Bacteria 3860091
203 2695629433 2695420354 Bacteria 3922431
204 2698319852 2695420987 Bacteria 6152737
205 2705997249 2703719227 Bacteria 5631989
206 2717914875 2716884898 Bacteria 3928789
207 2721508498 2718218445 Bacteria 5113413
208 2723601373 2721755693 Bacteria 6126117
209 2728529742 2728368933 Bacteria 7044283
210 2730137496 2728369359 Bacteria 5621728
211 2738813604 2738541295 Bacteria 5730091
212 2738839167 2738541299 Bacteria 4020721
213 2739156861 2738541358 Bacteria 5932299
214 2739209389 2738543006 Bacteria 5904091
215 2739232334 2738543010 Bacteria 5583595
216 2739269394 2738543017 Bacteria 4271950
217 2753812983 2751185905 Bacteria 6142767
218 2757566985 2757320391 Bacteria 4746095
219 2777761997 2775507177 Bacteria 4384303
220 2791211825 2788500588 Bacteria 4584915
221 2793186393 2791355222 Bacteria 5898266
222 2802440568 2802428803 Bacteria 5806948
223 2808870762 2808606364 Bacteria 4465927
224 2809053825 2808606399 Bacteria 4021018
225 2812313955 2811994870 Bacteria 3776934
226 2816865380 2816332186 Bacteria 5331395
227 2817482062 2816332295 Bacteria 4352468
228 2819567406 2818991441 Bacteria 5062707
229 2819583676 2818991443 Bacteria 6598732
230 2819626629 2818991451 Bacteria 4697364
231 2819676047 2818991459 Bacteria 8736032
232 2819711016 2818991465 Bacteria 5388835
233 2819722972 2818991468 Bacteria 3723169
234 2821118264 2821111986 Bacteria 6894338
235 2823530000 2823526263 Bacteria 3765752
236 2842687548 2842682962 Bacteria 5589973
237 2842886423 2842882022 Bacteria 6158489
238 2849142959 2849139964 Bacteria 5613304
239 2852674205 2852673933 Bacteria 3347676
240 2857460142 2857453340 Bacteria 8090534
241 2857477604 2857472729 Bacteria 6568124
242 2857583169 2857581216 Bacteria 5522813
243 2857588981 2857586860 Bacteria 4354574
244 2857609136 2857604169 Bacteria 5111450
245 2857610327 2857609550 Bacteria 3753890
246 2860841503 2860837431 Bacteria 4202080
247 2864738817 2864733723 Bacteria 6770668
248 2865002639 2864997549 Bacteria 5139696
249 2865008715 2865002811 Bacteria 6333767
250 2877772359 2877768649 Bacteria 3957164
251 2880173208 2880169592 Bacteria 3900066
252 2881639590 2881636855 Bacteria 5205297
253 2881646074 2881644220 Bacteria 5302661
254 2885529777 2885526491 Bacteria 7164189
255 2888578954 2888578766 Bacteria 6743310
256 2889042474 2889042446 Bacteria 7618936
257 2889052512 2889049205 Bacteria 7524325
258 2889277466 2889276214 Bacteria 5979355
259 2889299044 2889295896 Bacteria 4704906
260 2897113473 2897109615 Bacteria 4009619
261 2904119526 2904113452 Bacteria 7796941
262 2904167384 2904162308 Bacteria 7086713
263 2904496855 2904490793 Bacteria 7046938
264 2904528836 2904524088 Bacteria 5887454
265 2904561803 2904560550 Bacteria 4029838
266 2904601012 2904595352 Bacteria 6124848
267 2904608952 2904606771 Bacteria 4684500
268 2904758161 2904755435 Bacteria 7986759
269 2907205062 2907202186 Bacteria 6632024
270 2908667234 2908665501 Bacteria 3678115
271 2919094750 2919093281 Bacteria 3660974
272 2919148466 2919143609 Bacteria 6219228
273 2919166189 2919160200 Bacteria 6929020
274 2919416121 2919414237 Bacteria 5429133
275 2919432256 2919425241 Bacteria 8055701
276 2919521765 2919517244 Bacteria 5858162
277 2919724895 2919720352 Bacteria 5986006
278 2919727313 2919726948 Bacteria 3696050
279 2925332271 2925326138 Bacteria 9652120
280 2928098188 2928093941 Bacteria 5965005
281 2928510847 2928510474 Bacteria 4815308
282 2929007622 2929004312 Bacteria 5678476
283 2929207109 2929206907 Bacteria 5918291
284 2929239046 2929233124 Bacteria 5948380
285 2931385899 2931384279 Bacteria 7299545
286 2936344466 2936340661 Bacteria 5139038
287 2936363340 2936361878 Bacteria 5632809
288 2938653450 2938649242 Bacteria 7118381
289 2938923271 2938917290 Bacteria 5914775
290 2939597787 2939593269 Bacteria 4798695
291 2939685028 2939679117 Bacteria 6921672
292 2939706829 2939702853 Bacteria 5139229
293 2945995498 2945991243 Bacteria 7008369
294 2946058205 2946053406 Bacteria 6978655
295 2947432140 2947426588 Bacteria 5357194
296 2954776588 2954773129 Bacteria 3741715
297 2956902323 2956897341 Bacteria 5447711
298 2960321405 2960319331 Bacteria 5502575
299 2960378361 2960375949 Bacteria 5361395
300 2962294741 2962290636 Bacteria 4072939
301 2965766665 2965761152 Bacteria 5806513
302 2968562217 2968558590 Bacteria 6956864
303 2969140664 2969136845 Bacteria 3923176
304 2969144926 2969141011 Bacteria 4118468
305 2969768509 2969765954 Bacteria 4216713
306 2969770859 2969770375 Bacteria 4271280
307 2971406906 2971403814 Bacteria 7370929
308 2971412831 2971410472 Bacteria 8311090
309 2971513843 2971511577 Bacteria 5404012
310 2971897050 2971893375 Bacteria 3929648
311 2977254972 2977254563 Bacteria 4828420
312 2979089026 2979083700 Bacteria 5894929
313 2980129479 2980125574 Bacteria 5567337
314 2980179564 2980176882 Bacteria 5397533
315 2980185292 2980182181 Bacteria 9454109
316 2980496508 2980492589 Bacteria 4072961
317 2981289575 2981284811 Bacteria 4641497
318 2981294520 2981289755 Bacteria 4641509
319 2981985212 2981980479 Bacteria 4641628
320 2981990146 2981985349 Bacteria 4641497
321 2984531979 2984527788 Bacteria 5288478
322 2984533233 2984532647 Bacteria 5288506
323 2988230061 2988225383 Bacteria 7221625
324 2990275957 2990275345 Bacteria 4887158
325 2996637388 2996632988 Bacteria 6921523
326 2996711042 2996706504 Bacteria 5757485
327 3001269717 3001267043 Bacteria 4823521
328 3001275062 3001272096 Bacteria 4729684
329 3001894431 3001892409 Bacteria 6328293
330 3006826606 3006826541 Bacteria 4678913
331 3006862491 3006858327 Bacteria 4317835
332 3006883214 3006879489 Bacteria 4064221
333 3006969526 3006969106 Bacteria 4739423
334 3006980427 3006978542 Bacteria 5328100
335 3006986486 3006984091 Bacteria 4207523
336 3006990807 3006988479 Bacteria 4767936
337 648167957 648028048 Bacteria 5394884
338 8002323441 8002317523 Bacteria 8051857
339 8022626860 8022621104 Bacteria 5241040
340 8022632582 8022630665 Bacteria 3886130
341 8022655570 8022653035 Bacteria 4035078
342 8022793660 8022792930 Bacteria 5693794
343 8022894453 8022893055 Bacteria 5300455
344 8022918435 8022914991 Bacteria 5584517
345 8022954069 8022948649 Bacteria 5366783
346 8023441517 8023438354 Bacteria 5779374
347 8023449040 8023444577 Bacteria 5661597
348 8046992122 8046991243 Bacteria 8497463
349 8051954033 8051952484 Bacteria 3926774
350 8052175901 8052174270 Bacteria 3881265
351 8054468520 8054465665 Bacteria 7323556
352 8054801406 8054795415 Bacteria 9785225
353 8055532412 8055531788 Bacteria 5249694
354 8055634110 8055632911 Bacteria 5283357
355 8056534054 8056533031 Bacteria 8964429
356 8057587793 8057582654 Bacteria 5218944
357 8057636715 8057632132 Bacteria 4726859
358 8057735770 8057733483 Bacteria 6578323
359 8057979759 8057977335 Bacteria 5694872
360 JGI25151J46595_10000061
361 JGI25151J46595_10001044
362 JGI25151J46595_10008271
363 JGI25151J46595_10009444
364 JGI25151J46595_10012061
365 rootH2_10040044
366 rootL2_10010890
367 Ga0006562J51391_1003813
368 Ga0006562J51391_1004890
369 Ga0006562J51391_1023376
370 Ga0055532_1000091
371 Ga0055532_1003500
372 Ga0055536_1011506
373 Ga0055528_1002504
374 Ga0055541_1000158
375 Ga0055541_1002493
376 Ga0070672_100062739
377 Ga0105251_10006247
378 Ga0105251_10014221
379 Ga0105244_10004740
380 Ga0105244_10027847
381 Ga0105244_10031574
382 Ga0105250_10003487
383 Ga0105245_10027835
384 Ga0105247_10005598
385 Ga0105243_10011747
386 Ga0105242_10005936
387 Ga0105246_10002991
388 Ga0105246_10004083
389 Ga0157371_10009255
390 Ga0157378_10002187
391 Ga0157377_10013687
392 Ga0209784_100051
393 Ga0209784_100151
394 Ga0209566_100116
395 Ga0209566_100196
396 Ga0209566_100205
397 Ga0209147_100062
398 Ga0209147_100470
399 Ga0209147_103172
400 Ga0209437_100524
401 Ga0209673_1004297
402 Ga0209130_1001708
403 Ga0209130_1002717
404 Ga0209130_1002828
405 Ga0209675_1008073
406 Ga0209675_1012238
407 Ga0209676_1000784
408 Ga0209676_1001446
409 Ga0209025_1000011
410 Ga0209025_1000287
411 Ga0209025_1000331
412 Ga0209025_1001038
413 Ga0209025_1002664
414 Ga0209025_1002858
415 Ga0209025_1002923
416 Ga0209025_1003142
417 Ga0209025_1004976
418 Ga0209025_1006867
419 Ga0209025_1009533
420 Ga0207696_1002199
421 Ga0207696_1010310
422 Ga0207655_1004832
423 Ga0207655_1006420
424 Ga0207655_1021035
425 Ga0207655_1034620
426 Ga0207655_1036835
427 Ga0207713_1002567
428 Ga0207713_1004189
429 Ga0207713_1029215
430 Ga0207645_10014343
431 Ga0207681_10068455
432 Ga0207687_10015352
433 Ga0207686_10016175
434 Ga0207709_10031318
435 Ga0237817_10046
436 Ga0237817_10084
437 Ga0268256_1008005
438 Ga0307410_10031966
439 Ga0307416_100063251
440 Ga0307416_100111590
441 Ga0395900_0278989
442 Ga0237819_00011
443 Ga0237819_01079
444 Ga0439436_0010153
445 Ga0439439_0001681
446 Ga0439449_0000662
447 Ga0439449_0026319
448 Ga0466968_0018858
449 Ga0466959_0008975
450 Ga0466967_0000341
451 Ga0495585_0007991
452 Ga0495622_0014255
453 Ga0495633_0078415
454 Ga0495649_0054819
455 Ga0495660_0004595
456 Ga0495660_0005733
457 Ga0495683_0009169
458 Ga0496100_0001375
459 Ga0496102_0003257
460 Ga0496103_0007342
461 Ga0496104_0001346
462 Ga0496106_0008997
463 Ga0496107_0021280
464 Ga0496108_0002954
465 Ga0496109_0001532
466 Ga0496110_0092274
467 Ga0496111_0001455
468 Ga0496111_0002682
469 Ga0496112_0005699
470 Ga0496113_0073279
471 Ga0496113_0122938
472 Ga0496116_0000596
473 Ga0496116_0000782
474 Ga0496116_0010830
475 Ga0496116_0017653
476 Ga0496116_0040865
477 Ga0496117_0040456
478 Ga0496117_0112843
479 Ga0496118_0047711
480 Ga0496119_0000682
481 Ga0496119_0006105
482 Ga0496119_0010134
483 Ga0496120_0000678
484 Ga0496120_0060661
485 Ga0496121_0123541
486 Ga0496121_0156824
487 Ga0496122_0008096
488 Ga0496122_0008160
489 Ga0496122_0053526
490 Ga0496122_0065504
491 Ga0496122_0077691
492 Ga0496122_0133589
493 Ga0496123_0002354
494 Ga0496124_0000542
495 Ga0496124_0010181
496 Ga0496124_0049425
497 Ga0496124_0070314
498 Ga0496125_0008810
499 Ga0496126_0005347
500 Ga0496126_0011284
501 Ga0496126_0012013
502 Ga0496126_0036498
503 Ga0501306_004264
504 Ga0501341_00351
505 Ga0501305_000837
506 Ga0501311_002774
507 Ga0501312_001079
508 Ga0501312_003763
509 Ga0501312_004453
510 Ga0501313_000730
511 Ga0501313_002107
512 Ga0501315_001094
513 Ga0501316_001253
514 Ga0501316_002706
515 Ga0501317_001226
516 Ga0501318_000886
517 Ga0501318_001512
518 Ga0501323_001237
519 Ga0501333_000469
520 Ga0501334_00371
521 Ga0501335_000194
522 Ga0501337_000106
523 Ga0501340_000503
524 Ga0501217_001414
525 Ga0501217_013733
526 Ga0587079_001438
527 2777836309
528 2511701476
529 2512736619
530 2524191705
531 2540608686
532 2545557810
533 2550903432
534 2553391265
535 2555468625
536 2563930592
537 2571530875
538 2573041708
539 2578334536
540 2578932202
541 2580930453
542 2587743976
543 2595091935
544 2595320782
545 2601636911
546 2621272562
547 2631983356
548 2643738690
549 2644423951
550 2644702498
551 2644715128
552 2644720483
553 2644726432
554 2644738580
555 2651531082
556 2672338696
557 2673818955
558 2674421584
559 2685153336
560 2686998770
561 2687500058
562 2695629433
563 2698319852
564 2705997249
565 2717914875
566 2721508498
567 2723601373
568 2728529742
569 2730137496
570 2738813604
571 2738839167
572 2739156861
573 2739209389
574 2739232334
575 2739269394
576 2753812983
577 2757566985
578 2777761997
579 2791211825
580 2793186393
581 2802440568
582 2808870762
583 2809053825
584 2812313955
585 2816865380
586 2817482062
587 2819567406
588 2819583676
589 2819626629
590 2819676047
591 2819711016
592 2819722972
593 2821118264
594 2823530000
595 2842687548
596 2842886423
597 2849142959
598 2852674205
599 2857460142
600 2857477604
601 2857583169
602 2857588981
603 2857609136
604 2857610327
605 2860841503
606 2864738817
607 2865002639
608 2865008715
609 2877772359
610 2880173208
611 2881639590
612 2881646074
613 2885529777
614 2888578954
615 2889042474
616 2889052512
617 2889277466
618 2889299044
619 2897113473
620 2904119526
621 2904167384
622 2904496855
623 2904528836
624 2904561803
625 2904601012
626 2904608952
627 2904758161
628 2907205062
629 2908667234
630 2919094750
631 2919148466
632 2919166189
633 2919416121
634 2919432256
635 2919521765
636 2919724895
637 2919727313
638 2925332271
639 2928098188
640 2928510847
641 2929007622
642 2929207109
643 2929239046
644 2931385899
645 2936344466
646 2936363340
647 2938653450
648 2938923271
649 2939597787
650 2939685028
651 2939706829
652 2945995498
653 2946058205
654 2947432140
655 2954776588
656 2956902323
657 2960321405
658 2960378361
659 2962294741
660 2965766665
661 2968562217
662 2969140664
663 2969144926
664 2969768509
665 2969770859
666 2971406906
667 2971412831
668 2971513843
669 2971897050
670 2977254972
671 2979089026
672 2980129479
673 2980179564
674 2980185292
675 2980496508
676 2981289575
677 2981294520
678 2981985212
679 2981990146
680 2984531979
681 2984533233
682 2988230061
683 2990275957
684 2996637388
685 2996711042
686 3001269717
687 3001275062
688 3001894431
689 3006826606
690 3006862491
691 3006883214
692 3006969526
693 3006980427
694 3006986486
695 3006990807
696 648167957
697 8002323441
698 8022626860
699 8022632582
700 8022655570
701 8022793660
702 8022894453
703 8022918435
704 8022954069
705 8023441517
706 8023449040
707 8046992122
708 8051954033
709 8052175901
710 8054468520
711 8054801406
712 8055532412
713 8055634110
714 8056534054
715 8057587793
716 8057636715
717 8057735770
718 8057979759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19276

HD_assoc_2

HD associated region

221

290

0.94

PF01966

HD

HD domain

90

210

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lrl-assembly2.cif.gz_A structure of an enterococcus faecalis hd-domain protein complexed with dgtp and dttp 0.9486 1 428
3irh-assembly2.cif.gz_A structure of an enterococcus faecalis hd-domain protein complexed with dgtp and datp 0.9432 1 428
3irh-assembly4.cif.gz_C structure of an enterococcus faecalis hd-domain protein complexed with dgtp and datp 0.943 1 428
4lrl-assembly3.cif.gz_C structure of an enterococcus faecalis hd-domain protein complexed with dgtp and dttp 0.9427 1 428
4lrl-assembly3.cif.gz_D structure of an enterococcus faecalis hd-domain protein complexed with dgtp and dttp 0.9421 1 420
ID Description Score Start End Superfamily
af_Q2G0G3_5_268_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.975 3 266 1.10.3210.10
af_Q2G0G3_5_268_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9714 3 266 1.10.3210.10
4lrlC01 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9123 3 401 1.10.3210.10
4lrlC01 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9062 3 401 1.10.3210.10
2o6iB02 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;; 0.881 235 428 1.20.1250.30
ID Description Score Start End GO Terms
AF-A0A317YNG9-F1-model_v4 Uncharacterized protein 0.9957 104 186 GO:0006203
GO:0008832
AF-A0A7Z7YSE2-F1-model_v4 HD domain-containing protein 0.9859 66 199 GO:0006203
GO:0008832
AF-A0A4R6BAG4-F1-model_v4 HD domain-containing protein 0.9849 86 212 GO:0006203
GO:0008832
AF-A0A724WS40-F1-model_v4 HD domain-containing protein 0.9809 6 353 GO:0006203
GO:0008832
AF-A0A150MUC5-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase (EC 3.1.5.1) 0.9769 3 431 GO:0006203
GO:0008832

Map