F421650

General Info

Members Datasets Scaffolds Average Seq Length
359 204 718 159

Family's Representative Sequence

Representative Sequence 3300048089|Ga0495614_0125415|Ga0495614_0125415_26_655
Length 192
Sequence MQNTSHRIHCKMDSPDSTPVYPLEGGCACGHVRYRLEARPLIIHCCHCTSCQRETGTAFALNAIIESNLVTRLPPAPLTRPGEDATDVESITTPSESGKGQRIVRCPMCRVAVWSHYGGAGSLPRTFVRVGTLDEAWKVQPDVHIYTRSRRMFFKLDGSIPEFEGYYPSKAGVWSQESLIRWEKLAEMEGSK

Samples

Sample ID Description Type Environment
1 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
204 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 1.39
Rhizosphere 96.1
Stem 0
Stem Tuber 0
Unclassified 3.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495614_0125415 3300048089 Eukaryota 1134
2 Ga0065715_10341335 3300005293 Bacteria 961
3 Ga0070658_10002228 3300005327 Bacteria 16261
4 Ga0070658_10088634 3300005327 Bacteria 2548
5 Ga0070658_10571995 3300005327 Bacteria 978
6 Ga0070683_100021226 3300005329 Bacteria 5792
7 Ga0070683_100053964 3300005329 Bacteria 3725
8 Ga0070683_100303671 3300005329 Bacteria 1519
9 Ga0070683_100476458 3300005329 Bacteria 1192
10 Ga0070683_100803410 3300005329 Bacteria 902
11 Ga0070690_100245822 3300005330 Bacteria 1263
12 Ga0070690_100469757 3300005330 Bacteria 936
13 Ga0070670_100477303 3300005331 Bacteria 1107
14 Ga0070670_100882958 3300005331 Bacteria 810
15 Ga0068869_100143664 3300005334 Bacteria 1845
16 Ga0068869_100534523 3300005334 Bacteria 983
17 Ga0070666_10041277 3300005335 Bacteria 3082
18 Ga0070666_10093104 3300005335 Bacteria 2072
19 Ga0070680_100002003 3300005336 Bacteria 15000
20 Ga0070680_100008452 3300005336 Bacteria 7883
21 Ga0070682_100095794 3300005337 Bacteria 1949
22 Ga0068868_100048866 3300005338 Bacteria 3320
23 Ga0068868_100435048 3300005338 Bacteria 1138
24 Ga0070660_100000741 3300005339 Bacteria 21612
25 Ga0070660_100112271 3300005339 Bacteria 2169
26 Ga0070661_100014128 3300005344 Bacteria 5624
27 Ga0070661_100031060 3300005344 Bacteria 3861
28 Ga0070661_100160275 3300005344 Bacteria 1704
29 Ga0070692_10037380 3300005345 Bacteria 2468
30 Ga0070669_100721354 3300005353 Bacteria 843
31 Ga0070675_100349492 3300005354 Bacteria 1311
32 Ga0070671_100425344 3300005355 Bacteria 1138
33 Ga0070673_100157414 3300005364 Bacteria 1929
34 Ga0070673_101958899 3300005364 Bacteria 556
35 Ga0070659_100082177 3300005366 Bacteria 2574
36 Ga0070659_100225693 3300005366 Bacteria 1547
37 Ga0070659_100276858 3300005366 Bacteria 1395
38 Ga0070667_101230725 3300005367 Unclassified 701
39 Ga0070709_10179333 3300005434 Bacteria 1486
40 Ga0070714_100015727 3300005435 Bacteria 6094
41 Ga0070714_101788967 3300005435 Bacteria 600
42 Ga0070713_100069058 3300005436 Bacteria 2979
43 Ga0070713_100766259 3300005436 Bacteria 924
44 Ga0070710_10041660 3300005437 Bacteria 2536
45 Ga0070710_10801721 3300005437 Bacteria 673
46 Ga0070711_100077540 3300005439 Bacteria 2359
47 Ga0070711_101060817 3300005439 Bacteria 697
48 Ga0070705_100024310 3300005440 Bacteria 3268
49 Ga0070694_100246158 3300005444 Bacteria 1351
50 Ga0070708_100019175 3300005445 Bacteria 5742
51 Ga0070663_100172132 3300005455 Bacteria 1674
52 Ga0070678_100984597 3300005456 Unclassified 774
53 Ga0070662_100003023 3300005457 Bacteria 10456
54 Ga0070662_100008215 3300005457 Bacteria 6797
55 Ga0070662_100149984 3300005457 Bacteria 1814
56 Ga0070681_10019875 3300005458 Bacteria 6728
57 Ga0070681_11191139 3300005458 Bacteria 684
58 Ga0070681_11862505 3300005458 Bacteria 529
59 Ga0068867_100375343 3300005459 Bacteria 1193
60 Ga0070706_100016027 3300005467 Bacteria 6922
61 Ga0070698_100100057 3300005471 Bacteria 2872
62 Ga0070699_100301964 3300005518 Bacteria 1436
63 Ga0070679_100005847 3300005530 Bacteria 11414
64 Ga0070679_100052532 3300005530 Bacteria 4058
65 Ga0070679_100142838 3300005530 Bacteria 2372
66 Ga0070679_100350067 3300005530 Bacteria 1425
67 Ga0070684_100045277 3300005535 Bacteria 3810
68 Ga0070684_100107313 3300005535 Bacteria 2501
69 Ga0070684_100222515 3300005535 Bacteria 1722
70 Ga0070684_100227485 3300005535 Bacteria 1702
71 Ga0070684_100341092 3300005535 Bacteria 1377
72 Ga0070697_100013310 3300005536 Bacteria 6452
73 Ga0068853_100005757 3300005539 Bacteria 9757
74 Ga0068853_100076581 3300005539 Bacteria 2921
75 Ga0068853_100136346 3300005539 Bacteria 2200
76 Ga0068853_100441640 3300005539 Bacteria 1223
77 Ga0070672_100148515 3300005543 Bacteria 1938
78 Ga0070695_100008046 3300005545 Bacteria 6249
79 Ga0070665_100037524 3300005548 Bacteria 4873
80 Ga0070665_100060090 3300005548 Bacteria 3810
81 Ga0070665_100301287 3300005548 Bacteria 1606
82 Ga0070704_100048212 3300005549 Bacteria 2981
83 Ga0068855_100009179 3300005563 Bacteria 11943
84 Ga0068855_100011302 3300005563 Bacteria 10781
85 Ga0068855_100017217 3300005563 Bacteria 8697
86 Ga0068855_100030767 3300005563 Bacteria 6418
87 Ga0070664_100208779 3300005564 Bacteria 1745
88 Ga0070664_100354558 3300005564 Bacteria 1335
89 Ga0070664_100438735 3300005564 Bacteria 1198
90 Ga0070664_100475078 3300005564 Bacteria 1150
91 Ga0070664_100771975 3300005564 Bacteria 898
92 Ga0070664_100794279 3300005564 Bacteria 885
93 Ga0068857_100180148 3300005577 Bacteria 1923
94 Ga0068857_100215069 3300005577 Bacteria 1754
95 Ga0068857_100354286 3300005577 Bacteria 1359
96 Ga0068857_100518571 3300005577 Bacteria 1120
97 Ga0068857_101235425 3300005577 Bacteria 724
98 Ga0068857_101838844 3300005577 Bacteria 593
99 Ga0068854_100252093 3300005578 Bacteria 1410
100 Ga0068856_100144678 3300005614 Bacteria 2385
101 Ga0068856_100379504 3300005614 Bacteria 1433
102 Ga0068856_101339300 3300005614 Bacteria 731
103 Ga0070702_100168318 3300005615 Bacteria 1423
104 Ga0068852_100160598 3300005616 Bacteria 2098
105 Ga0068859_101309184 3300005617 Bacteria 798
106 Ga0068861_100620255 3300005719 Bacteria 995
107 Ga0068851_10030694 3300005834 Bacteria 2667
108 Ga0068863_100069996 3300005841 Bacteria 3317
109 Ga0068860_100140670 3300005843 Bacteria 2319
110 Ga0068862_100392209 3300005844 Bacteria 1297
111 Ga0070716_100660975 3300006173 Bacteria 794
112 Ga0070712_100023048 3300006175 Bacteria 4107
113 Ga0097621_100232925 3300006237 Bacteria 1608
114 Ga0068871_100056768 3300006358 Bacteria 3184
115 Ga0068871_100182328 3300006358 Bacteria 1805
116 Ga0068871_100240714 3300006358 Bacteria 1573
117 Ga0075431_100289186 3300006847 Bacteria 1658
118 Ga0075434_100756593 3300006871 Bacteria 988
119 Ga0075429_100774353 3300006880 Bacteria 840
120 Ga0097620_101309235 3300006931 Bacteria 798
121 Ga0075435_100731340 3300007076 Bacteria 860
122 Ga0105240_10248660 3300009093 Bacteria 2058
123 Ga0105240_10878921 3300009093 Bacteria 966
124 Ga0105245_10067700 3300009098 Bacteria 3234
125 Ga0105245_10575413 3300009098 Bacteria 1150
126 Ga0114129_11029519 3300009147 Bacteria 1035
127 Ga0105243_11160420 3300009148 Bacteria 784
128 Ga0105241_10029176 3300009174 Bacteria 4114
129 Ga0105241_10723347 3300009174 Bacteria 910
130 Ga0105241_10959657 3300009174 Bacteria 797
131 Ga0105241_11160075 3300009174 Bacteria 730
132 Ga0105248_10044863 3300009177 Bacteria 4958
133 Ga0105248_11110549 3300009177 Bacteria 894
134 Ga0105237_10161488 3300009545 Bacteria 2239
135 Ga0105238_10114564 3300009551 Bacteria 2675
136 Ga0105238_10117788 3300009551 Bacteria 2636
137 Ga0105238_10509731 3300009551 Bacteria 1205
138 Ga0105238_11505944 3300009551 Bacteria 702
139 Ga0105238_11866391 3300009551 Bacteria 633
140 Ga0105249_10193089 3300009553 Bacteria 1988
141 Ga0105239_10259878 3300010375 Bacteria 1951
142 Ga0105239_10528350 3300010375 Bacteria 1342
143 Ga0105239_10628149 3300010375 Bacteria 1226
144 Ga0105239_10665278 3300010375 Bacteria 1190
145 Ga0105239_12140956 3300010375 Bacteria 650
146 Ga0105246_10002313 3300011119 Bacteria 11509
147 Ga0105246_10003992 3300011119 Bacteria 8949
148 Ga0105246_10014670 3300011119 Bacteria 4931
149 Ga0105246_10020648 3300011119 Bacteria 4227
150 Ga0157373_10085494 3300013100 Bacteria 2223
151 Ga0157373_10130900 3300013100 Bacteria 1765
152 Ga0157373_10239822 3300013100 Bacteria 1281
153 Ga0157371_10012493 3300013102 Bacteria 6489
154 Ga0157371_10019431 3300013102 Bacteria 5012
155 Ga0157371_10019700 3300013102 Bacteria 4968
156 Ga0157371_10135086 3300013102 Bacteria 1756
157 Ga0157370_10004761 3300013104 Bacteria 15446
158 Ga0157370_10018959 3300013104 Bacteria 6917
159 Ga0157370_10185369 3300013104 Bacteria 1932
160 Ga0157370_10301947 3300013104 Unclassified 1478
161 Ga0157369_10004367 3300013105 Bacteria 16691
162 Ga0157369_10042392 3300013105 Bacteria 4965
163 Ga0157369_10076859 3300013105 Bacteria 3579
164 Ga0157369_10156188 3300013105 Bacteria 2410
165 Ga0157374_11746543 3300013296 Bacteria 647
166 Ga0157378_10060071 3300013297 Bacteria 3392
167 Ga0157378_10159283 3300013297 Bacteria 2110
168 Ga0157378_11680700 3300013297 Bacteria 682
169 Ga0157378_12272095 3300013297 Bacteria 594
170 Ga0163162_10198420 3300013306 Bacteria 2135
171 Ga0163162_10517056 3300013306 Bacteria 1323
172 Ga0157372_10005172 3300013307 Bacteria 13876
173 Ga0157372_10080315 3300013307 Bacteria 3689
174 Ga0157375_10307944 3300013308 Bacteria 1748
175 Ga0157375_11798420 3300013308 Bacteria 726
176 Ga0157375_11879497 3300013308 Bacteria 710
177 Ga0163163_10164083 3300014325 Bacteria 2267
178 Ga0163163_10226813 3300014325 Bacteria 1917
179 Ga0157379_10007053 3300014968 Bacteria 9712
180 Ga0157379_10192524 3300014968 Bacteria 1843
181 Ga0157376_10513308 3300014969 Bacteria 1180
182 Ga0157376_10654194 3300014969 Bacteria 1051
183 Ga0209233_1000013 3300025261 Bacteria 1013785
184 Ga0207656_10087884 3300025321 Bacteria 1406
185 Ga0207692_10567829 3300025898 Bacteria 726
186 Ga0207688_10185692 3300025901 Bacteria 1241
187 Ga0207680_10039638 3300025903 Bacteria 2735
188 Ga0207699_10040781 3300025906 Bacteria 2677
189 Ga0207645_10235641 3300025907 Bacteria 1209
190 Ga0207705_10021501 3300025909 Bacteria 4604
191 Ga0207705_10045467 3300025909 Bacteria 3155
192 Ga0207705_10102222 3300025909 Bacteria 2109
193 Ga0207705_10331934 3300025909 Bacteria 1170
194 Ga0207684_10369278 3300025910 Bacteria 1234
195 Ga0207654_10011608 3300025911 Bacteria 4496
196 Ga0207654_10404868 3300025911 Bacteria 949
197 Ga0207707_10012769 3300025912 Bacteria 7306
198 Ga0207707_10257386 3300025912 Bacteria 1515
199 Ga0207707_11470354 3300025912 Bacteria 541
200 Ga0207695_10282110 3300025913 Bacteria 1555
201 Ga0207695_10536424 3300025913 Bacteria 1051
202 Ga0207671_10081137 3300025914 Bacteria 2432
203 Ga0207693_10008159 3300025915 Bacteria 8582
204 Ga0207663_11417565 3300025916 Bacteria 559
205 Ga0207657_10000571 3300025919 Bacteria 39136
206 Ga0207657_10001916 3300025919 Bacteria 22462
207 Ga0207657_10009925 3300025919 Bacteria 9529
208 Ga0207649_10005137 3300025920 Bacteria 7072
209 Ga0207649_10015513 3300025920 Bacteria 4281
210 Ga0207649_10052740 3300025920 Bacteria 2524
211 Ga0207652_10017581 3300025921 Bacteria 5853
212 Ga0207652_10084814 3300025921 Bacteria 2775
213 Ga0207652_10267672 3300025921 Bacteria 1541
214 Ga0207652_10453346 3300025921 Bacteria 1156
215 Ga0207652_10746987 3300025921 Bacteria 871
216 Ga0207646_10352388 3300025922 Bacteria 1330
217 Ga0207681_10718955 3300025923 Bacteria 831
218 Ga0207694_10186752 3300025924 Bacteria 1682
219 Ga0207694_10372712 3300025924 Bacteria 1184
220 Ga0207694_10801736 3300025924 Bacteria 795
221 Ga0207694_11132776 3300025924 Bacteria 662
222 Ga0207650_10083884 3300025925 Bacteria 2421
223 Ga0207650_10304787 3300025925 Bacteria 1302
224 Ga0207659_10794558 3300025926 Bacteria 813
225 Ga0207687_10121391 3300025927 Bacteria 1955
226 Ga0207687_10424900 3300025927 Bacteria 1097
227 Ga0207700_10007977 3300025928 Bacteria 6520
228 Ga0207700_10754125 3300025928 Bacteria 870
229 Ga0207700_10893949 3300025928 Bacteria 795
230 Ga0207664_10003452 3300025929 Bacteria 10537
231 Ga0207644_10223454 3300025931 Bacteria 1494
232 Ga0207690_10004464 3300025932 Bacteria 8261
233 Ga0207690_10064133 3300025932 Bacteria 2507
234 Ga0207690_10163678 3300025932 Bacteria 1661
235 Ga0207690_10227860 3300025932 Bacteria 1429
236 Ga0207690_10329068 3300025932 Bacteria 1203
237 Ga0207706_10000384 3300025933 Bacteria 48339
238 Ga0207706_10024156 3300025933 Bacteria 5451
239 Ga0207706_10037741 3300025933 Bacteria 4288
240 Ga0207706_10398383 3300025933 Bacteria 1193
241 Ga0207665_10274859 3300025939 Bacteria 1252
242 Ga0207691_10120590 3300025940 Bacteria 2325
243 Ga0207691_11068459 3300025940 Bacteria 672
244 Ga0207711_10068091 3300025941 Bacteria 3082
245 Ga0207711_10650556 3300025941 Bacteria 983
246 Ga0207711_11787990 3300025941 Bacteria 558
247 Ga0207689_10028154 3300025942 Bacteria 4699
248 Ga0207689_10161773 3300025942 Bacteria 1844
249 Ga0207689_10867907 3300025942 Bacteria 762
250 Ga0207661_10014331 3300025944 Bacteria 5808
251 Ga0207661_10423231 3300025944 Bacteria 1210
252 Ga0207661_10873392 3300025944 Bacteria 828
253 Ga0207679_10080495 3300025945 Bacteria 2487
254 Ga0207679_10255837 3300025945 Bacteria 1491
255 Ga0207679_10502396 3300025945 Bacteria 1082
256 Ga0207667_10014309 3300025949 Bacteria 9048
257 Ga0207667_10248393 3300025949 Bacteria 1820
258 Ga0207667_10278863 3300025949 Bacteria 1708
259 Ga0207667_10379037 3300025949 Bacteria 1441
260 Ga0207712_10020008 3300025961 Bacteria 4379
261 Ga0207640_10024224 3300025981 Bacteria 3660
262 Ga0207658_10152361 3300025986 Bacteria 1885
263 Ga0207658_11651012 3300025986 Unclassified 586
264 Ga0207677_10526152 3300026023 Bacteria 1027
265 Ga0207639_10002992 3300026041 Bacteria 11373
266 Ga0207639_10233714 3300026041 Bacteria 1595
267 Ga0207639_10364587 3300026041 Bacteria 1294
268 Ga0207678_10055963 3300026067 Bacteria 3397
269 Ga0207678_10186935 3300026067 Bacteria 1770
270 Ga0207702_10228377 3300026078 Bacteria 1738
271 Ga0207702_10484532 3300026078 Bacteria 1204
272 Ga0207702_10650042 3300026078 Bacteria 1037
273 Ga0207674_10057625 3300026116 Bacteria 3938
274 Ga0207674_10105160 3300026116 Bacteria 2801
275 Ga0207674_10483122 3300026116 Bacteria 1197
276 Ga0207675_100309005 3300026118 Bacteria 1541
277 Ga0207698_10042439 3300026142 Bacteria 3398
278 Ga0207698_10726157 3300026142 Bacteria 990
279 Ga0207698_10981357 3300026142 Bacteria 855
280 Ga0207698_11175887 3300026142 Bacteria 781
281 Ga0268266_10006035 3300028379 Bacteria 11168
282 Ga0268266_10067216 3300028379 Bacteria 3102
283 Ga0268266_10572524 3300028379 Bacteria 1083
284 Ga0268265_10359869 3300028380 Bacteria 1332
285 Ga0307517_10104111 3300028786 Bacteria 2213
286 Ga0307509_10103157 3300031507 Bacteria 2881
287 Ga0307408_100214903 3300031548 Bacteria 1565
288 Ga0307516_10003782 3300031730 Bacteria 19218
289 Ga0307516_10420694 3300031730 Bacteria 994
290 Ga0307405_10149766 3300031731 Bacteria 1639
291 Ga0316577_10292898 3300031733 Bacteria 922
292 Ga0307413_10274631 3300031824 Bacteria 1264
293 Ga0307407_10206350 3300031903 Bacteria 1320
294 Ga0307412_10182406 3300031911 Bacteria 1580
295 Ga0307415_100228270 3300032126 Bacteria 1497
296 Ga0373926_0015288 3300035083 Unclassified 2616
297 Ga0373934_0230405 3300035086 Bacteria 765
298 Ga0373936_0041399 3300035113 Bacteria 1848
299 Ga0373945_0151249 3300035116 Bacteria 941
300 Ga0373956_0085693 3300035119 Bacteria 1449
301 Ga0373956_0114876 3300035119 Bacteria 1255
302 Ga0373960_0052806 3300035121 Bacteria 1211
303 Ga0373943_0141530 3300035170 Bacteria 1296
304 Ga0373942_0245916 3300035207 Bacteria 607
305 Ga0373924_0167925 3300035410 Bacteria 964
306 Ga0373937_0005246 3300036401 Bacteria 11067
307 Ga0316582_0005751 3300036647 Bacteria 6432
308 Ga0316584_0097939 3300036712 Bacteria 2196
309 Ga0316584_0952354 3300036712 Bacteria 575
310 Ga0395898_1852396 3300037466 Bacteria 524
311 Ga0436360_0200912 3300039438 Bacteria 611
312 Ga0466966_0063734 3300044684 Bacteria 2322
313 Ga0466961_0078516 3300044693 Bacteria 2091
314 Ga0466957_0190194 3300044842 Bacteria 1344
315 Ga0466959_0238717 3300045049 Bacteria 1256
316 Ga0466958_0048489 3300045836 Bacteria 2567
317 Ga0466967_0067541 3300045976 Bacteria 3189
318 Ga0495617_090951 3300046452 Bacteria 996
319 Ga0495629_0042660 3300046459 Eukaryota 3187
320 Ga0495580_0518506 3300046472 Bacteria 794
321 Ga0495582_0469608 3300046473 Bacteria 727
322 Ga0495639_0269345 3300046475 Unclassified 845
323 Ga0495606_0001464 3300046507 Bacteria 31526
324 Ga0495606_0285364 3300046507 Bacteria 900
325 Ga0495648_0083487 3300046524 Bacteria 1810
326 Ga0495654_0028072 3300046530 Bacteria 2880
327 Ga0495640_0153996 3300046533 Unclassified 1476
328 Ga0495598_0181278 3300046537 Bacteria 751
329 Ga0495621_0018947 3300046539 Bacteria 2241
330 Ga0495625_0000990 3300046660 Bacteria 37644
331 Ga0495657_0229899 3300046675 Bacteria 1122
332 Ga0495623_0150830 3300046679 Bacteria 1374
333 Ga0495593_0248934 3300047673 Unclassified 890
334 Ga0496101_0463769 3300048904 Bacteria 1000
335 Ga0496101_1567382 3300048904 Unclassified 512
336 Ga0496102_0065393 3300048905 Bacteria 3333
337 Ga0496112_0236163 3300048915 Bacteria 1782
338 Ga0496112_1010088 3300048915 Bacteria 751
339 Ga0496125_0505127 3300048928 Unclassified 679
340 Ga0496126_0483664 3300048929 Unclassified 992
341 Ga0501032_1033683 3300049569 Bacteria 516
342 Ga0501034_0924281 3300049571 Bacteria 759
343 Ga0501069_0548509 3300049585 Bacteria 692
344 Ga0501070_0280053 3300049586 Unclassified 1361
345 Ga0501071_0081440 3300049587 Bacteria 2369
346 Ga0501074_0569456 3300049590 Bacteria 802
347 Ga0501076_0102208 3300049592 Bacteria 2311
348 Ga0501080_0583376 3300049742 Bacteria 994
349 Ga0501080_0632597 3300049742 Bacteria 948
350 Ga0501045_0236197 3300049824 Bacteria 1361
351 nmdc:mga05p37_811881_c1 3300050507 Bacteria 1022
352 nmdc:mga09592_608350_c1 3300050508 Bacteria 936
353 nmdc:mga06r32_247896_c1 3300050510 Bacteria 1769
354 nmdc:mga0n895_104156_c1 3300050512 Bacteria 2850
355 nmdc:mga0n895_405168_c1 3300050512 Unclassified 1379
356 nmdc:mga0a205_114238_c1 3300050515 Bacteria 2599
357 Ga0495601_0945772 3300053077 Bacteria 543
358 Ga0500559_0333863 3300053136 Bacteria 710
359 2792841004 2791355137 Bacteria 9654227
360 Ga0495614_0125415
361 Ga0065715_10341335
362 Ga0070658_10002228
363 Ga0070658_10088634
364 Ga0070658_10571995
365 Ga0070683_100021226
366 Ga0070683_100053964
367 Ga0070683_100303671
368 Ga0070683_100476458
369 Ga0070683_100803410
370 Ga0070690_100245822
371 Ga0070690_100469757
372 Ga0070670_100477303
373 Ga0070670_100882958
374 Ga0068869_100143664
375 Ga0068869_100534523
376 Ga0070666_10041277
377 Ga0070666_10093104
378 Ga0070680_100002003
379 Ga0070680_100008452
380 Ga0070682_100095794
381 Ga0068868_100048866
382 Ga0068868_100435048
383 Ga0070660_100000741
384 Ga0070660_100112271
385 Ga0070661_100014128
386 Ga0070661_100031060
387 Ga0070661_100160275
388 Ga0070692_10037380
389 Ga0070669_100721354
390 Ga0070675_100349492
391 Ga0070671_100425344
392 Ga0070673_100157414
393 Ga0070673_101958899
394 Ga0070659_100082177
395 Ga0070659_100225693
396 Ga0070659_100276858
397 Ga0070667_101230725
398 Ga0070709_10179333
399 Ga0070714_100015727
400 Ga0070714_101788967
401 Ga0070713_100069058
402 Ga0070713_100766259
403 Ga0070710_10041660
404 Ga0070710_10801721
405 Ga0070711_100077540
406 Ga0070711_101060817
407 Ga0070705_100024310
408 Ga0070694_100246158
409 Ga0070708_100019175
410 Ga0070663_100172132
411 Ga0070678_100984597
412 Ga0070662_100003023
413 Ga0070662_100008215
414 Ga0070662_100149984
415 Ga0070681_10019875
416 Ga0070681_11191139
417 Ga0070681_11862505
418 Ga0068867_100375343
419 Ga0070706_100016027
420 Ga0070698_100100057
421 Ga0070699_100301964
422 Ga0070679_100005847
423 Ga0070679_100052532
424 Ga0070679_100142838
425 Ga0070679_100350067
426 Ga0070684_100045277
427 Ga0070684_100107313
428 Ga0070684_100222515
429 Ga0070684_100227485
430 Ga0070684_100341092
431 Ga0070697_100013310
432 Ga0068853_100005757
433 Ga0068853_100076581
434 Ga0068853_100136346
435 Ga0068853_100441640
436 Ga0070672_100148515
437 Ga0070695_100008046
438 Ga0070665_100037524
439 Ga0070665_100060090
440 Ga0070665_100301287
441 Ga0070704_100048212
442 Ga0068855_100009179
443 Ga0068855_100011302
444 Ga0068855_100017217
445 Ga0068855_100030767
446 Ga0070664_100208779
447 Ga0070664_100354558
448 Ga0070664_100438735
449 Ga0070664_100475078
450 Ga0070664_100771975
451 Ga0070664_100794279
452 Ga0068857_100180148
453 Ga0068857_100215069
454 Ga0068857_100354286
455 Ga0068857_100518571
456 Ga0068857_101235425
457 Ga0068857_101838844
458 Ga0068854_100252093
459 Ga0068856_100144678
460 Ga0068856_100379504
461 Ga0068856_101339300
462 Ga0070702_100168318
463 Ga0068852_100160598
464 Ga0068859_101309184
465 Ga0068861_100620255
466 Ga0068851_10030694
467 Ga0068863_100069996
468 Ga0068860_100140670
469 Ga0068862_100392209
470 Ga0070716_100660975
471 Ga0070712_100023048
472 Ga0097621_100232925
473 Ga0068871_100056768
474 Ga0068871_100182328
475 Ga0068871_100240714
476 Ga0075431_100289186
477 Ga0075434_100756593
478 Ga0075429_100774353
479 Ga0097620_101309235
480 Ga0075435_100731340
481 Ga0105240_10248660
482 Ga0105240_10878921
483 Ga0105245_10067700
484 Ga0105245_10575413
485 Ga0114129_11029519
486 Ga0105243_11160420
487 Ga0105241_10029176
488 Ga0105241_10723347
489 Ga0105241_10959657
490 Ga0105241_11160075
491 Ga0105248_10044863
492 Ga0105248_11110549
493 Ga0105237_10161488
494 Ga0105238_10114564
495 Ga0105238_10117788
496 Ga0105238_10509731
497 Ga0105238_11505944
498 Ga0105238_11866391
499 Ga0105249_10193089
500 Ga0105239_10259878
501 Ga0105239_10528350
502 Ga0105239_10628149
503 Ga0105239_10665278
504 Ga0105239_12140956
505 Ga0105246_10002313
506 Ga0105246_10003992
507 Ga0105246_10014670
508 Ga0105246_10020648
509 Ga0157373_10085494
510 Ga0157373_10130900
511 Ga0157373_10239822
512 Ga0157371_10012493
513 Ga0157371_10019431
514 Ga0157371_10019700
515 Ga0157371_10135086
516 Ga0157370_10004761
517 Ga0157370_10018959
518 Ga0157370_10185369
519 Ga0157370_10301947
520 Ga0157369_10004367
521 Ga0157369_10042392
522 Ga0157369_10076859
523 Ga0157369_10156188
524 Ga0157374_11746543
525 Ga0157378_10060071
526 Ga0157378_10159283
527 Ga0157378_11680700
528 Ga0157378_12272095
529 Ga0163162_10198420
530 Ga0163162_10517056
531 Ga0157372_10005172
532 Ga0157372_10080315
533 Ga0157375_10307944
534 Ga0157375_11798420
535 Ga0157375_11879497
536 Ga0163163_10164083
537 Ga0163163_10226813
538 Ga0157379_10007053
539 Ga0157379_10192524
540 Ga0157376_10513308
541 Ga0157376_10654194
542 Ga0209233_1000013
543 Ga0207656_10087884
544 Ga0207692_10567829
545 Ga0207688_10185692
546 Ga0207680_10039638
547 Ga0207699_10040781
548 Ga0207645_10235641
549 Ga0207705_10021501
550 Ga0207705_10045467
551 Ga0207705_10102222
552 Ga0207705_10331934
553 Ga0207684_10369278
554 Ga0207654_10011608
555 Ga0207654_10404868
556 Ga0207707_10012769
557 Ga0207707_10257386
558 Ga0207707_11470354
559 Ga0207695_10282110
560 Ga0207695_10536424
561 Ga0207671_10081137
562 Ga0207693_10008159
563 Ga0207663_11417565
564 Ga0207657_10000571
565 Ga0207657_10001916
566 Ga0207657_10009925
567 Ga0207649_10005137
568 Ga0207649_10015513
569 Ga0207649_10052740
570 Ga0207652_10017581
571 Ga0207652_10084814
572 Ga0207652_10267672
573 Ga0207652_10453346
574 Ga0207652_10746987
575 Ga0207646_10352388
576 Ga0207681_10718955
577 Ga0207694_10186752
578 Ga0207694_10372712
579 Ga0207694_10801736
580 Ga0207694_11132776
581 Ga0207650_10083884
582 Ga0207650_10304787
583 Ga0207659_10794558
584 Ga0207687_10121391
585 Ga0207687_10424900
586 Ga0207700_10007977
587 Ga0207700_10754125
588 Ga0207700_10893949
589 Ga0207664_10003452
590 Ga0207644_10223454
591 Ga0207690_10004464
592 Ga0207690_10064133
593 Ga0207690_10163678
594 Ga0207690_10227860
595 Ga0207690_10329068
596 Ga0207706_10000384
597 Ga0207706_10024156
598 Ga0207706_10037741
599 Ga0207706_10398383
600 Ga0207665_10274859
601 Ga0207691_10120590
602 Ga0207691_11068459
603 Ga0207711_10068091
604 Ga0207711_10650556
605 Ga0207711_11787990
606 Ga0207689_10028154
607 Ga0207689_10161773
608 Ga0207689_10867907
609 Ga0207661_10014331
610 Ga0207661_10423231
611 Ga0207661_10873392
612 Ga0207679_10080495
613 Ga0207679_10255837
614 Ga0207679_10502396
615 Ga0207667_10014309
616 Ga0207667_10248393
617 Ga0207667_10278863
618 Ga0207667_10379037
619 Ga0207712_10020008
620 Ga0207640_10024224
621 Ga0207658_10152361
622 Ga0207658_11651012
623 Ga0207677_10526152
624 Ga0207639_10002992
625 Ga0207639_10233714
626 Ga0207639_10364587
627 Ga0207678_10055963
628 Ga0207678_10186935
629 Ga0207702_10228377
630 Ga0207702_10484532
631 Ga0207702_10650042
632 Ga0207674_10057625
633 Ga0207674_10105160
634 Ga0207674_10483122
635 Ga0207675_100309005
636 Ga0207698_10042439
637 Ga0207698_10726157
638 Ga0207698_10981357
639 Ga0207698_11175887
640 Ga0268266_10006035
641 Ga0268266_10067216
642 Ga0268266_10572524
643 Ga0268265_10359869
644 Ga0307517_10104111
645 Ga0307509_10103157
646 Ga0307408_100214903
647 Ga0307516_10003782
648 Ga0307516_10420694
649 Ga0307405_10149766
650 Ga0316577_10292898
651 Ga0307413_10274631
652 Ga0307407_10206350
653 Ga0307412_10182406
654 Ga0307415_100228270
655 Ga0373926_0015288
656 Ga0373934_0230405
657 Ga0373936_0041399
658 Ga0373945_0151249
659 Ga0373956_0085693
660 Ga0373956_0114876
661 Ga0373960_0052806
662 Ga0373943_0141530
663 Ga0373942_0245916
664 Ga0373924_0167925
665 Ga0373937_0005246
666 Ga0316582_0005751
667 Ga0316584_0097939
668 Ga0316584_0952354
669 Ga0395898_1852396
670 Ga0436360_0200912
671 Ga0466966_0063734
672 Ga0466961_0078516
673 Ga0466957_0190194
674 Ga0466959_0238717
675 Ga0466958_0048489
676 Ga0466967_0067541
677 Ga0495617_090951
678 Ga0495629_0042660
679 Ga0495580_0518506
680 Ga0495582_0469608
681 Ga0495639_0269345
682 Ga0495606_0001464
683 Ga0495606_0285364
684 Ga0495648_0083487
685 Ga0495654_0028072
686 Ga0495640_0153996
687 Ga0495598_0181278
688 Ga0495621_0018947
689 Ga0495625_0000990
690 Ga0495657_0229899
691 Ga0495623_0150830
692 Ga0495593_0248934
693 Ga0496101_0463769
694 Ga0496101_1567382
695 Ga0496102_0065393
696 Ga0496112_0236163
697 Ga0496112_1010088
698 Ga0496125_0505127
699 Ga0496126_0483664
700 Ga0501032_1033683
701 Ga0501034_0924281
702 Ga0501069_0548509
703 Ga0501070_0280053
704 Ga0501071_0081440
705 Ga0501074_0569456
706 Ga0501076_0102208
707 Ga0501080_0583376
708 Ga0501080_0632597
709 Ga0501045_0236197
710 nmdc:mga05p37_811881_c1
711 nmdc:mga09592_608350_c1
712 nmdc:mga06r32_247896_c1
713 nmdc:mga0n895_104156_c1
714 nmdc:mga0n895_405168_c1
715 nmdc:mga0a205_114238_c1
716 Ga0495601_0945772
717 Ga0500559_0333863
718 2792841004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

44

149

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8871 7 142
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8183 7 142
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7651 10 108
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.6784 10 108
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.6516 5 162
ID Description Score Start End Superfamily
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7965 7 136 3.90.1590.10
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7623 10 108 2.170.150.70
af_K7MPT9_9_124_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7557 11 108 2.170.150.70
af_Q56VY4_31_104_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7556 76 92 3.30.40.10
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7497 7 136 3.90.1590.10
ID Description Score Start End GO Terms
AF-A0A521RHC5-F1-model_v4 GFA family protein 0.9767 7 161 GO:0016846
GO:0046872
AF-A0A6M4GWV9-F1-model_v4 CENP-V/GFA domain-containing protein 0.9735 6 158 GO:0016846
GO:0046872
AF-A0A0R3M6V1-F1-model_v4 Aldehyde-activating protein 0.9714 10 164 GO:0016846
GO:0046872
AF-A0A422QX46-F1-model_v4 GFA family protein 0.9713 7 160 GO:0016846
GO:0046872
AF-A0A4P8J2G6-F1-model_v4 GFA family protein 0.9709 5 162 GO:0016846
GO:0046872

Map