F421530

General Info

Members Datasets Scaffolds Average Seq Length
359 182 718 249

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10057841|Ga0157378_100578413
Length 285
Sequence LERRSLYGGKLGPGELARSERRCDVKTLREIVIVSALTVAFLPGQDAPATAASPAGRGAAARNGAPAPRLPDGKPDFSGIWDGGGPIDDLAVGLAKGEKIPLLPSAEKIMQARLSKDDPEANCLPTGIPRVAPYPWTFATAPGRLYILFEGNIHSYRQIFMDGRQHPKDLNPTWYGHSVGHWEGDALVIDTVGFNDKFWFDFRGHPHTEQLHTVERYTRKDFGTLVNEVTIDDPGAYSKPFTLKFNATLMPKGEILEYICQENNVDVKHILGPAGPGGGEIGPKQ

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
125 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.61
Metatranscriptomes 1.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 0.84
Rhizosphere 98.33
Stem 0
Stem Tuber 0
Unclassified 22.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10057841 3300013297 Bacteria 3456
2 Ga0065704_10091659 3300005289 Bacteria 2702
3 Ga0065707_10103104 3300005295 Unclassified 2767
4 Ga0070683_100047795 3300005329 Bacteria 3955
5 Ga0070683_100069460 3300005329 Bacteria 3285
6 Ga0070683_100132498 3300005329 Bacteria 2359
7 Ga0068869_100003626 3300005334 Bacteria 9472
8 Ga0070666_10001611 3300005335 Bacteria 13729
9 Ga0070666_10024073 3300005335 Bacteria 3964
10 Ga0070666_10196959 3300005335 Unclassified 1417
11 Ga0070680_100296152 3300005336 Bacteria 1372
12 Ga0070682_100302919 3300005337 Bacteria 1174
13 Ga0068868_100023014 3300005338 Bacteria 4711
14 Ga0068868_100037475 3300005338 Bacteria 3759
15 Ga0070660_100203308 3300005339 Bacteria 1607
16 Ga0070689_100069428 3300005340 Unclassified 2749
17 Ga0070691_10009981 3300005341 Bacteria 4326
18 Ga0070661_100060635 3300005344 Bacteria 2776
19 Ga0070692_10109473 3300005345 Bacteria 1526
20 Ga0070675_100003364 3300005354 Bacteria 12116
21 Ga0070673_100006316 3300005364 Bacteria 7697
22 Ga0070673_100124756 3300005364 Bacteria 2153
23 Ga0070673_100351866 3300005364 Bacteria 1307
24 Ga0070688_100050080 3300005365 Unclassified 2601
25 Ga0070667_100001720 3300005367 Bacteria 19568
26 Ga0070667_100059808 3300005367 Bacteria 3224
27 Ga0070711_100067827 3300005439 Bacteria 2504
28 Ga0070678_100169181 3300005456 Unclassified 1778
29 Ga0070678_100262980 3300005456 Bacteria 1452
30 Ga0068867_100052780 3300005459 Bacteria 3001
31 Ga0068867_100301539 3300005459 Unclassified 1321
32 Ga0070679_100248935 3300005530 Bacteria 1733
33 Ga0070684_100057878 3300005535 Unclassified 3385
34 Ga0070684_100083416 3300005535 Bacteria 2832
35 Ga0070684_100189284 3300005535 Unclassified 1872
36 Ga0068853_100063963 3300005539 Unclassified 3188
37 Ga0070672_100011469 3300005543 Bacteria 6182
38 Ga0070686_100006886 3300005544 Bacteria 6333
39 Ga0070695_100219812 3300005545 Bacteria 1368
40 Ga0070693_100235470 3300005547 Bacteria 1207
41 Ga0070665_100029385 3300005548 Bacteria 5532
42 Ga0070665_100177669 3300005548 Bacteria 2130
43 Ga0068855_100024832 3300005563 Bacteria 7169
44 Ga0068855_100047681 3300005563 Bacteria 5061
45 Ga0068855_100062758 3300005563 Bacteria 4337
46 Ga0068855_100074288 3300005563 Unclassified 3949
47 Ga0068855_100104147 3300005563 Unclassified 3264
48 Ga0070664_100009191 3300005564 Bacteria 8024
49 Ga0070664_100117549 3300005564 Unclassified 2325
50 Ga0070664_100225220 3300005564 Unclassified 1679
51 Ga0068857_100027767 3300005577 Unclassified 4991
52 Ga0068857_100406013 3300005577 Bacteria 1268
53 Ga0068854_100061645 3300005578 Bacteria 2717
54 Ga0068856_100028669 3300005614 Bacteria 5439
55 Ga0068856_100151156 3300005614 Bacteria 2331
56 Ga0068856_100170799 3300005614 Bacteria 2186
57 Ga0068856_100473132 3300005614 Unclassified 1274
58 Ga0068859_100008801 3300005617 Bacteria 10192
59 Ga0068859_100012958 3300005617 Bacteria 8376
60 Ga0068859_100022773 3300005617 Bacteria 6282
61 Ga0068864_100006937 3300005618 Bacteria 9293
62 Ga0068864_100059916 3300005618 Bacteria 3295
63 Ga0068861_100005313 3300005719 Bacteria 8694
64 Ga0068863_100015411 3300005841 Bacteria 7349
65 Ga0068858_100016246 3300005842 Bacteria 6992
66 Ga0068858_100020202 3300005842 Bacteria 6227
67 Ga0068858_100407391 3300005842 Bacteria 1307
68 Ga0068860_100001444 3300005843 Bacteria 25740
69 Ga0068860_100042646 3300005843 Bacteria 4332
70 Ga0068860_100066797 3300005843 Bacteria 3417
71 Ga0068860_100109952 3300005843 Bacteria 2634
72 Ga0068860_100159610 3300005843 Bacteria 2173
73 Ga0068860_100169416 3300005843 Unclassified 2109
74 Ga0068860_100248656 3300005843 Bacteria 1731
75 Ga0068860_100378526 3300005843 Bacteria 1397
76 Ga0097621_100001713 3300006237 Bacteria 14989
77 Ga0097621_100017020 3300006237 Bacteria 5512
78 Ga0097621_100017206 3300006237 Bacteria 5486
79 Ga0097621_100020619 3300006237 Bacteria 5081
80 Ga0097621_100057590 3300006237 Bacteria 3178
81 Ga0097621_100072203 3300006237 Bacteria 2854
82 Ga0097621_100295263 3300006237 Bacteria 1430
83 Ga0097621_100337048 3300006237 Bacteria 1338
84 Ga0097621_100418876 3300006237 Bacteria 1202
85 Ga0068871_100005700 3300006358 Bacteria 8739
86 Ga0068871_100019425 3300006358 Bacteria 5188
87 Ga0068871_100035400 3300006358 Bacteria 3967
88 Ga0068871_100068607 3300006358 Bacteria 2912
89 Ga0075428_100007745 3300006844 Bacteria 11902
90 Ga0075428_100026964 3300006844 Bacteria 6363
91 Ga0075428_100043871 3300006844 Unclassified 4916
92 Ga0075428_100130441 3300006844 Bacteria 2735
93 Ga0075430_100083825 3300006846 Unclassified 2670
94 Ga0075430_100200473 3300006846 Unclassified 1657
95 Ga0075431_100010900 3300006847 Bacteria 9144
96 Ga0075431_100036824 3300006847 Bacteria 5040
97 Ga0075433_10019177 3300006852 Bacteria 5692
98 Ga0075434_100000579 3300006871 Bacteria 28227
99 Ga0075434_100001041 3300006871 Bacteria 22625
100 Ga0075429_100097081 3300006880 Bacteria 2571
101 Ga0075429_100173869 3300006880 Bacteria 1887
102 Ga0068865_100009737 3300006881 Bacteria 5961
103 Ga0068865_100017610 3300006881 Bacteria 4597
104 Ga0075436_100226292 3300006914 Unclassified 1328
105 Ga0097620_100008801 3300006931 Bacteria 10192
106 Ga0097620_100012958 3300006931 Bacteria 8376
107 Ga0097620_100022773 3300006931 Bacteria 6282
108 Ga0105240_10001445 3300009093 Bacteria 40579
109 Ga0105240_10105440 3300009093 Bacteria 3422
110 Ga0105240_10183286 3300009093 Bacteria 2469
111 Ga0111539_10004829 3300009094 Bacteria 17568
112 Ga0111539_10009260 3300009094 Bacteria 12445
113 Ga0111539_10027853 3300009094 Bacteria 6900
114 Ga0111539_10033398 3300009094 Bacteria 6245
115 Ga0105245_10000473 3300009098 Bacteria 36745
116 Ga0105245_10004443 3300009098 Bacteria 12403
117 Ga0105245_10009480 3300009098 Bacteria 8493
118 Ga0105245_10131118 3300009098 Bacteria 2351
119 Ga0105245_10375500 3300009098 Bacteria 1415
120 Ga0105245_10468644 3300009098 Bacteria 1271
121 Ga0105247_10006758 3300009101 Bacteria 7080
122 Ga0105247_10097198 3300009101 Unclassified 1878
123 Ga0105247_10321612 3300009101 Unclassified 1079
124 Ga0114129_10080478 3300009147 Unclassified 4528
125 Ga0114129_10364115 3300009147 Unclassified 1912
126 Ga0105243_10456767 3300009148 Bacteria 1200
127 Ga0105241_10272498 3300009174 Bacteria 1442
128 Ga0105241_10293646 3300009174 Bacteria 1392
129 Ga0105242_10004531 3300009176 Bacteria 10785
130 Ga0105242_10010675 3300009176 Bacteria 7049
131 Ga0105242_10017992 3300009176 Bacteria 5521
132 Ga0105242_10041167 3300009176 Bacteria 3725
133 Ga0105242_10083896 3300009176 Bacteria 2669
134 Ga0105242_10093065 3300009176 Bacteria 2540
135 Ga0105242_10203014 3300009176 Bacteria 1762
136 Ga0105242_10375417 3300009176 Bacteria 1320
137 Ga0105248_10013168 3300009177 Bacteria 9106
138 Ga0105248_10015429 3300009177 Bacteria 8422
139 Ga0105248_10018073 3300009177 Bacteria 7783
140 Ga0105248_10033865 3300009177 Bacteria 5708
141 Ga0105248_10120345 3300009177 Bacteria 2962
142 Ga0105248_10305398 3300009177 Bacteria 1792
143 Ga0105248_10645277 3300009177 Unclassified 1194
144 Ga0105248_10920246 3300009177 Unclassified 987
145 Ga0105237_10033075 3300009545 Bacteria 5238
146 Ga0105237_10083017 3300009545 Unclassified 3196
147 Ga0105238_10017744 3300009551 Bacteria 7236
148 Ga0105238_10025291 3300009551 Bacteria 6051
149 Ga0105238_10036307 3300009551 Bacteria 5009
150 Ga0105238_10037176 3300009551 Bacteria 4950
151 Ga0105238_10058714 3300009551 Unclassified 3856
152 Ga0105238_10265663 3300009551 Bacteria 1696
153 Ga0105249_10482501 3300009553 Unclassified 1283
154 Ga0105239_10018044 3300010375 Bacteria 7805
155 Ga0105239_10029073 3300010375 Bacteria 6076
156 Ga0105239_10083429 3300010375 Bacteria 3519
157 Ga0105239_10143321 3300010375 Bacteria 2663
158 Ga0105239_10449699 3300010375 Bacteria 1461
159 Ga0105239_10494831 3300010375 Bacteria 1390
160 Ga0105246_10006397 3300011119 Bacteria 7195
161 Ga0105246_10027901 3300011119 Bacteria 3705
162 Ga0105246_10250659 3300011119 Bacteria 1405
163 Ga0157370_10008704 3300013104 Bacteria 10920
164 Ga0157370_10390901 3300013104 Bacteria 1281
165 Ga0157369_10269317 3300013105 Bacteria 1775
166 Ga0157374_10015751 3300013296 Bacteria 6640
167 Ga0157378_10001093 3300013297 Bacteria 24766
168 Ga0157378_10064535 3300013297 Bacteria 3276
169 Ga0157378_10230544 3300013297 Bacteria 1764
170 Ga0163162_10011986 3300013306 Bacteria 8455
171 Ga0163162_10353274 3300013306 Bacteria 1602
172 Ga0163162_10437336 3300013306 Bacteria 1440
173 Ga0163162_10455917 3300013306 Bacteria 1410
174 Ga0157372_10046721 3300013307 Bacteria 4807
175 Ga0157372_10097898 3300013307 Bacteria 3346
176 Ga0157375_10006921 3300013308 Bacteria 9896
177 Ga0157375_10469960 3300013308 Unclassified 1423
178 Ga0163163_10003209 3300014325 Bacteria 13853
179 Ga0163163_10006736 3300014325 Bacteria 10067
180 Ga0163163_10358497 3300014325 Unclassified 1515
181 Ga0163163_10557759 3300014325 Bacteria 1208
182 Ga0157380_10004385 3300014326 Bacteria 9781
183 Ga0157379_10151717 3300014968 Bacteria 2090
184 Ga0157376_10001111 3300014969 Bacteria 17644
185 Ga0157376_10039959 3300014969 Bacteria 3831
186 Ga0157376_10108885 3300014969 Bacteria 2435
187 Ga0157376_10196043 3300014969 Unclassified 1855
188 Ga0157376_10245337 3300014969 Bacteria 1670
189 Ga0157376_10362866 3300014969 Bacteria 1390
190 Ga0157376_10478070 3300014969 Unclassified 1220
191 Ga0197907_10492922 3300020069 Bacteria 1270
192 Ga0206356_11028489 3300020070 Bacteria 1093
193 Ga0206352_10126864 3300020078 Bacteria 1661
194 Ga0206350_11400384 3300020080 Bacteria 1174
195 Ga0206350_11584241 3300020080 Bacteria 1272
196 Ga0213875_10155507 3300021388 Unclassified 1072
197 Ga0207710_10008409 3300025900 Bacteria 4351
198 Ga0207680_10013380 3300025903 Bacteria 4213
199 Ga0207680_10213305 3300025903 Unclassified 1321
200 Ga0207699_10075999 3300025906 Unclassified 2068
201 Ga0207654_10034041 3300025911 Bacteria 2828
202 Ga0207707_10025143 3300025912 Bacteria 5208
203 Ga0207695_10007981 3300025913 Bacteria 13346
204 Ga0207695_10258162 3300025913 Bacteria 1641
205 Ga0207671_10397645 3300025914 Bacteria 1096
206 Ga0207671_10537584 3300025914 Unclassified 932
207 Ga0207663_10093214 3300025916 Unclassified 2004
208 Ga0207663_10479874 3300025916 Unclassified 963
209 Ga0207662_10128229 3300025918 Unclassified 1597
210 Ga0207652_10301892 3300025921 Unclassified 1445
211 Ga0207694_10017664 3300025924 Bacteria 5392
212 Ga0207694_10021562 3300025924 Unclassified 4882
213 Ga0207694_10080065 3300025924 Unclassified 2563
214 Ga0207659_10005936 3300025926 Bacteria 7452
215 Ga0207687_10001494 3300025927 Bacteria 16023
216 Ga0207687_10001761 3300025927 Bacteria 14883
217 Ga0207687_10015794 3300025927 Bacteria 4955
218 Ga0207687_10031758 3300025927 Bacteria 3572
219 Ga0207687_10095367 3300025927 Viruses 2179
220 Ga0207700_10075686 3300025928 Unclassified 2609
221 Ga0207700_10197084 3300025928 Unclassified 1695
222 Ga0207686_10012442 3300025934 Bacteria 4681
223 Ga0207686_10025127 3300025934 Bacteria 3461
224 Ga0207686_10101818 3300025934 Unclassified 1919
225 Ga0207686_10112461 3300025934 Bacteria 1839
226 Ga0207670_10621178 3300025936 Unclassified 889
227 Ga0207669_10052709 3300025937 Bacteria 2446
228 Ga0207665_10348628 3300025939 Bacteria 1117
229 Ga0207691_10065929 3300025940 Unclassified 3276
230 Ga0207691_10448592 3300025940 Bacteria 1098
231 Ga0207711_10011170 3300025941 Bacteria 7462
232 Ga0207711_10023417 3300025941 Bacteria 5170
233 Ga0207711_10295208 3300025941 Bacteria 1494
234 Ga0207689_10004351 3300025942 Bacteria 12899
235 Ga0207689_10071865 3300025942 Unclassified 2842
236 Ga0207689_10115370 3300025942 Bacteria 2208
237 Ga0207689_10141989 3300025942 Bacteria 1978
238 Ga0207661_10062176 3300025944 Bacteria 3020
239 Ga0207661_10142633 3300025944 Bacteria 2063
240 Ga0207679_10012055 3300025945 Bacteria 5622
241 Ga0207667_10049444 3300025949 Bacteria 4440
242 Ga0207667_10076383 3300025949 Unclassified 3476
243 Ga0207667_10125350 3300025949 Bacteria 2645
244 Ga0207667_10468571 3300025949 Unclassified 1279
245 Ga0207651_10015509 3300025960 Unclassified 4430
246 Ga0207712_10117983 3300025961 Bacteria 2002
247 Ga0207712_10328802 3300025961 Bacteria 1264
248 Ga0207658_10055475 3300025986 Bacteria 2936
249 Ga0207677_10074262 3300026023 Bacteria 2412
250 Ga0207677_10181263 3300026023 Bacteria 1657
251 Ga0207703_10006808 3300026035 Bacteria 9109
252 Ga0207703_10012457 3300026035 Bacteria 6630
253 Ga0207639_10065199 3300026041 Bacteria 2826
254 Ga0207708_10035777 3300026075 Bacteria 3779
255 Ga0207702_10010324 3300026078 Bacteria 7822
256 Ga0207702_10181589 3300026078 Bacteria 1938
257 Ga0207702_10622545 3300026078 Bacteria 1060
258 Ga0207648_10039665 3300026089 Bacteria 4140
259 Ga0207648_10064608 3300026089 Bacteria 3190
260 Ga0207648_10078954 3300026089 Bacteria 2871
261 Ga0207676_10522337 3300026095 Bacteria 1130
262 Ga0207674_10022641 3300026116 Bacteria 6743
263 Ga0207674_10032612 3300026116 Bacteria 5461
264 Ga0207674_10145439 3300026116 Bacteria 2329
265 Ga0207675_100003771 3300026118 Bacteria 14760
266 Ga0207683_10271247 3300026121 Bacteria 1550
267 Ga0207698_10047455 3300026142 Unclassified 3254
268 Ga0207428_10000592 3300027907 Bacteria 42773
269 Ga0207428_10011404 3300027907 Bacteria 7856
270 Ga0207428_10034926 3300027907 Bacteria 4114
271 Ga0268266_10138074 3300028379 Bacteria 2185
272 Ga0268266_10262134 3300028379 Bacteria 1602
273 Ga0268264_10004164 3300028381 Bacteria 12359
274 Ga0268264_10120004 3300028381 Bacteria 2316
275 Ga0268264_10214550 3300028381 Bacteria 1769
276 Ga0268264_10216239 3300028381 Bacteria 1762
277 Ga0268264_10698379 3300028381 Bacteria 1007
278 Ga0265314_10000932 3300031711 Bacteria 34486
279 Ga0307412_10193058 3300031911 Bacteria 1541
280 Ga0373934_0125752 3300035086 Bacteria 1044
281 Ga0373953_0105104 3300035117 Bacteria 1190
282 Ga0373931_0365571 3300035691 Unclassified 906
283 Ga0373933_0002180 3300035724 Bacteria 11217
284 Ga0373933_0072066 3300035724 Bacteria 2104
285 Ga0373937_0051686 3300036401 Bacteria 3767
286 Ga0373937_0737574 3300036401 Bacteria 932
287 Ga0373925_0025293 3300037068 Bacteria 4337
288 Ga0439454_024978 3300042011 Bacteria 906
289 Ga0439435_0024074 3300042436 Unclassified 1604
290 Ga0439460_0015982 3300042461 Bacteria 1994
291 Ga0495651_0157071 3300046462 Bacteria 1634
292 Ga0495653_0213424 3300046463 Unclassified 1302
293 Ga0495608_0407117 3300046511 Unclassified 831
294 Ga0495628_0448057 3300046516 Bacteria 938
295 Ga0495644_0069008 3300046523 Bacteria 1328
296 Ga0495586_0020958 3300046535 Unclassified 3484
297 Ga0495587_0000612 3300046536 Bacteria 24272
298 Ga0495621_0007560 3300046539 Bacteria 3223
299 Ga0495645_0287143 3300046543 Bacteria 1080
300 Ga0495656_0001796 3300046615 Bacteria 7051
301 Ga0495656_0227899 3300046615 Bacteria 934
302 Ga0495599_0019679 3300046678 Bacteria 4208
303 Ga0495623_0054725 3300046679 Bacteria 2517
304 Ga0495623_0147643 3300046679 Bacteria 1393
305 Ga0495669_0002612 3300046684 Bacteria 7369
306 Ga0495674_0124110 3300047319 Unclassified 2180
307 Ga0495680_0132040 3300047322 Bacteria 1834
308 Ga0495675_0258165 3300047444 Unclassified 1045
309 Ga0495602_0000355 3300048088 Bacteria 42648
310 Ga0496102_0177711 3300048905 Unclassified 2005
311 Ga0496107_0585648 3300048910 Unclassified 825
312 Ga0496114_0000515 3300048917 Bacteria 28421
313 Ga0501040_0081166 3300049576 Unclassified 2247
314 Ga0501041_0012829 3300049577 Bacteria 4964
315 Ga0501041_0089304 3300049577 Bacteria 1903
316 Ga0501042_0031314 3300049578 Bacteria 3762
317 Ga0501042_0206776 3300049578 Unclassified 1415
318 Ga0501043_0307543 3300049579 Unclassified 1210
319 Ga0501046_0032428 3300049580 Bacteria 4230
320 Ga0501071_0081775 3300049587 Unclassified 2364
321 Ga0501071_0213158 3300049587 Unclassified 1452
322 Ga0501072_0103475 3300049588 Unclassified 2263
323 Ga0501074_0301369 3300049590 Unclassified 1138
324 Ga0501075_0020292 3300049591 Bacteria 4831
325 Ga0501075_0036228 3300049591 Bacteria 3682
326 Ga0501075_0072953 3300049591 Bacteria 2595
327 Ga0501076_0008923 3300049592 Bacteria 7377
328 Ga0501076_0062175 3300049592 Bacteria 2973
329 Ga0501077_0204536 3300049593 Unclassified 1254
330 Ga0501079_0022883 3300049741 Unclassified 4797
331 Ga0501080_0282531 3300049742 Unclassified 1508
332 Ga0501081_0004952 3300049743 Bacteria 8565
333 Ga0501083_0407364 3300049744 Bacteria 885
334 Ga0501035_0232096 3300049822 Unclassified 1572
335 Ga0501045_0118790 3300049824 Unclassified 1962
336 nmdc:mga05p37_314695_c1 3300050507 Bacteria 1855
337 nmdc:mga05p37_73321_c1 3300050507 Bacteria 4213
338 nmdc:mga09592_136837_c1 3300050508 Unclassified 2110
339 nmdc:mga09592_6838_c1 3300050508 Bacteria 9283
340 nmdc:mga0qj67_107552_c1 3300050509 Bacteria 2250
341 nmdc:mga0qj67_337765_c1 3300050509 Unclassified 1219
342 nmdc:mga0qj67_97574_c1 3300050509 Bacteria 2367
343 nmdc:mga06r32_374966_c1 3300050510 Bacteria 1406
344 nmdc:mga06r32_51039_c1 3300050510 Bacteria 3958
345 nmdc:mga08y16_28325_c1 3300050511 Bacteria 5905
346 nmdc:mga08y16_4439_c1 3300050511 Bacteria 14664
347 nmdc:mga08y16_5242_c1 3300050511 Bacteria 13538
348 nmdc:mga08y16_528906_c1 3300050511 Bacteria 1195
349 nmdc:mga0n895_1903_c1 3300050512 Bacteria 15972
350 nmdc:mga0n895_574_c1 3300050512 Bacteria 25246
351 nmdc:mga08x19_148433_c1 3300050514 Unclassified 1586
352 nmdc:mga0a205_813_c1 3300050515 Bacteria 25396
353 Ga0495601_0011928 3300053077 Bacteria 5209
354 Ga0500568_0000196 3300053139 Bacteria 52926
355 Ga0500568_0003207 3300053139 Bacteria 9289
356 Ga0501084_0059591 3300054114 Bacteria 3195
357 Ga0501082_0028598 3300060353 Unclassified 4801
358 Ga0501082_0767104 3300060353 Unclassified 844
359 Ga0530510_0020514 3300061734 Unclassified 4698
360 Ga0157378_10057841
361 Ga0065704_10091659
362 Ga0065707_10103104
363 Ga0070683_100047795
364 Ga0070683_100069460
365 Ga0070683_100132498
366 Ga0068869_100003626
367 Ga0070666_10001611
368 Ga0070666_10024073
369 Ga0070666_10196959
370 Ga0070680_100296152
371 Ga0070682_100302919
372 Ga0068868_100023014
373 Ga0068868_100037475
374 Ga0070660_100203308
375 Ga0070689_100069428
376 Ga0070691_10009981
377 Ga0070661_100060635
378 Ga0070692_10109473
379 Ga0070675_100003364
380 Ga0070673_100006316
381 Ga0070673_100124756
382 Ga0070673_100351866
383 Ga0070688_100050080
384 Ga0070667_100001720
385 Ga0070667_100059808
386 Ga0070711_100067827
387 Ga0070678_100169181
388 Ga0070678_100262980
389 Ga0068867_100052780
390 Ga0068867_100301539
391 Ga0070679_100248935
392 Ga0070684_100057878
393 Ga0070684_100083416
394 Ga0070684_100189284
395 Ga0068853_100063963
396 Ga0070672_100011469
397 Ga0070686_100006886
398 Ga0070695_100219812
399 Ga0070693_100235470
400 Ga0070665_100029385
401 Ga0070665_100177669
402 Ga0068855_100024832
403 Ga0068855_100047681
404 Ga0068855_100062758
405 Ga0068855_100074288
406 Ga0068855_100104147
407 Ga0070664_100009191
408 Ga0070664_100117549
409 Ga0070664_100225220
410 Ga0068857_100027767
411 Ga0068857_100406013
412 Ga0068854_100061645
413 Ga0068856_100028669
414 Ga0068856_100151156
415 Ga0068856_100170799
416 Ga0068856_100473132
417 Ga0068859_100008801
418 Ga0068859_100012958
419 Ga0068859_100022773
420 Ga0068864_100006937
421 Ga0068864_100059916
422 Ga0068861_100005313
423 Ga0068863_100015411
424 Ga0068858_100016246
425 Ga0068858_100020202
426 Ga0068858_100407391
427 Ga0068860_100001444
428 Ga0068860_100042646
429 Ga0068860_100066797
430 Ga0068860_100109952
431 Ga0068860_100159610
432 Ga0068860_100169416
433 Ga0068860_100248656
434 Ga0068860_100378526
435 Ga0097621_100001713
436 Ga0097621_100017020
437 Ga0097621_100017206
438 Ga0097621_100020619
439 Ga0097621_100057590
440 Ga0097621_100072203
441 Ga0097621_100295263
442 Ga0097621_100337048
443 Ga0097621_100418876
444 Ga0068871_100005700
445 Ga0068871_100019425
446 Ga0068871_100035400
447 Ga0068871_100068607
448 Ga0075428_100007745
449 Ga0075428_100026964
450 Ga0075428_100043871
451 Ga0075428_100130441
452 Ga0075430_100083825
453 Ga0075430_100200473
454 Ga0075431_100010900
455 Ga0075431_100036824
456 Ga0075433_10019177
457 Ga0075434_100000579
458 Ga0075434_100001041
459 Ga0075429_100097081
460 Ga0075429_100173869
461 Ga0068865_100009737
462 Ga0068865_100017610
463 Ga0075436_100226292
464 Ga0097620_100008801
465 Ga0097620_100012958
466 Ga0097620_100022773
467 Ga0105240_10001445
468 Ga0105240_10105440
469 Ga0105240_10183286
470 Ga0111539_10004829
471 Ga0111539_10009260
472 Ga0111539_10027853
473 Ga0111539_10033398
474 Ga0105245_10000473
475 Ga0105245_10004443
476 Ga0105245_10009480
477 Ga0105245_10131118
478 Ga0105245_10375500
479 Ga0105245_10468644
480 Ga0105247_10006758
481 Ga0105247_10097198
482 Ga0105247_10321612
483 Ga0114129_10080478
484 Ga0114129_10364115
485 Ga0105243_10456767
486 Ga0105241_10272498
487 Ga0105241_10293646
488 Ga0105242_10004531
489 Ga0105242_10010675
490 Ga0105242_10017992
491 Ga0105242_10041167
492 Ga0105242_10083896
493 Ga0105242_10093065
494 Ga0105242_10203014
495 Ga0105242_10375417
496 Ga0105248_10013168
497 Ga0105248_10015429
498 Ga0105248_10018073
499 Ga0105248_10033865
500 Ga0105248_10120345
501 Ga0105248_10305398
502 Ga0105248_10645277
503 Ga0105248_10920246
504 Ga0105237_10033075
505 Ga0105237_10083017
506 Ga0105238_10017744
507 Ga0105238_10025291
508 Ga0105238_10036307
509 Ga0105238_10037176
510 Ga0105238_10058714
511 Ga0105238_10265663
512 Ga0105249_10482501
513 Ga0105239_10018044
514 Ga0105239_10029073
515 Ga0105239_10083429
516 Ga0105239_10143321
517 Ga0105239_10449699
518 Ga0105239_10494831
519 Ga0105246_10006397
520 Ga0105246_10027901
521 Ga0105246_10250659
522 Ga0157370_10008704
523 Ga0157370_10390901
524 Ga0157369_10269317
525 Ga0157374_10015751
526 Ga0157378_10001093
527 Ga0157378_10064535
528 Ga0157378_10230544
529 Ga0163162_10011986
530 Ga0163162_10353274
531 Ga0163162_10437336
532 Ga0163162_10455917
533 Ga0157372_10046721
534 Ga0157372_10097898
535 Ga0157375_10006921
536 Ga0157375_10469960
537 Ga0163163_10003209
538 Ga0163163_10006736
539 Ga0163163_10358497
540 Ga0163163_10557759
541 Ga0157380_10004385
542 Ga0157379_10151717
543 Ga0157376_10001111
544 Ga0157376_10039959
545 Ga0157376_10108885
546 Ga0157376_10196043
547 Ga0157376_10245337
548 Ga0157376_10362866
549 Ga0157376_10478070
550 Ga0197907_10492922
551 Ga0206356_11028489
552 Ga0206352_10126864
553 Ga0206350_11400384
554 Ga0206350_11584241
555 Ga0213875_10155507
556 Ga0207710_10008409
557 Ga0207680_10013380
558 Ga0207680_10213305
559 Ga0207699_10075999
560 Ga0207654_10034041
561 Ga0207707_10025143
562 Ga0207695_10007981
563 Ga0207695_10258162
564 Ga0207671_10397645
565 Ga0207671_10537584
566 Ga0207663_10093214
567 Ga0207663_10479874
568 Ga0207662_10128229
569 Ga0207652_10301892
570 Ga0207694_10017664
571 Ga0207694_10021562
572 Ga0207694_10080065
573 Ga0207659_10005936
574 Ga0207687_10001494
575 Ga0207687_10001761
576 Ga0207687_10015794
577 Ga0207687_10031758
578 Ga0207687_10095367
579 Ga0207700_10075686
580 Ga0207700_10197084
581 Ga0207686_10012442
582 Ga0207686_10025127
583 Ga0207686_10101818
584 Ga0207686_10112461
585 Ga0207670_10621178
586 Ga0207669_10052709
587 Ga0207665_10348628
588 Ga0207691_10065929
589 Ga0207691_10448592
590 Ga0207711_10011170
591 Ga0207711_10023417
592 Ga0207711_10295208
593 Ga0207689_10004351
594 Ga0207689_10071865
595 Ga0207689_10115370
596 Ga0207689_10141989
597 Ga0207661_10062176
598 Ga0207661_10142633
599 Ga0207679_10012055
600 Ga0207667_10049444
601 Ga0207667_10076383
602 Ga0207667_10125350
603 Ga0207667_10468571
604 Ga0207651_10015509
605 Ga0207712_10117983
606 Ga0207712_10328802
607 Ga0207658_10055475
608 Ga0207677_10074262
609 Ga0207677_10181263
610 Ga0207703_10006808
611 Ga0207703_10012457
612 Ga0207639_10065199
613 Ga0207708_10035777
614 Ga0207702_10010324
615 Ga0207702_10181589
616 Ga0207702_10622545
617 Ga0207648_10039665
618 Ga0207648_10064608
619 Ga0207648_10078954
620 Ga0207676_10522337
621 Ga0207674_10022641
622 Ga0207674_10032612
623 Ga0207674_10145439
624 Ga0207675_100003771
625 Ga0207683_10271247
626 Ga0207698_10047455
627 Ga0207428_10000592
628 Ga0207428_10011404
629 Ga0207428_10034926
630 Ga0268266_10138074
631 Ga0268266_10262134
632 Ga0268264_10004164
633 Ga0268264_10120004
634 Ga0268264_10214550
635 Ga0268264_10216239
636 Ga0268264_10698379
637 Ga0265314_10000932
638 Ga0307412_10193058
639 Ga0373934_0125752
640 Ga0373953_0105104
641 Ga0373931_0365571
642 Ga0373933_0002180
643 Ga0373933_0072066
644 Ga0373937_0051686
645 Ga0373937_0737574
646 Ga0373925_0025293
647 Ga0439454_024978
648 Ga0439435_0024074
649 Ga0439460_0015982
650 Ga0495651_0157071
651 Ga0495653_0213424
652 Ga0495608_0407117
653 Ga0495628_0448057
654 Ga0495644_0069008
655 Ga0495586_0020958
656 Ga0495587_0000612
657 Ga0495621_0007560
658 Ga0495645_0287143
659 Ga0495656_0001796
660 Ga0495656_0227899
661 Ga0495599_0019679
662 Ga0495623_0054725
663 Ga0495623_0147643
664 Ga0495669_0002612
665 Ga0495674_0124110
666 Ga0495680_0132040
667 Ga0495675_0258165
668 Ga0495602_0000355
669 Ga0496102_0177711
670 Ga0496107_0585648
671 Ga0496114_0000515
672 Ga0501040_0081166
673 Ga0501041_0012829
674 Ga0501041_0089304
675 Ga0501042_0031314
676 Ga0501042_0206776
677 Ga0501043_0307543
678 Ga0501046_0032428
679 Ga0501071_0081775
680 Ga0501071_0213158
681 Ga0501072_0103475
682 Ga0501074_0301369
683 Ga0501075_0020292
684 Ga0501075_0036228
685 Ga0501075_0072953
686 Ga0501076_0008923
687 Ga0501076_0062175
688 Ga0501077_0204536
689 Ga0501079_0022883
690 Ga0501080_0282531
691 Ga0501081_0004952
692 Ga0501083_0407364
693 Ga0501035_0232096
694 Ga0501045_0118790
695 nmdc:mga05p37_314695_c1
696 nmdc:mga05p37_73321_c1
697 nmdc:mga09592_136837_c1
698 nmdc:mga09592_6838_c1
699 nmdc:mga0qj67_107552_c1
700 nmdc:mga0qj67_337765_c1
701 nmdc:mga0qj67_97574_c1
702 nmdc:mga06r32_374966_c1
703 nmdc:mga06r32_51039_c1
704 nmdc:mga08y16_28325_c1
705 nmdc:mga08y16_4439_c1
706 nmdc:mga08y16_5242_c1
707 nmdc:mga08y16_528906_c1
708 nmdc:mga0n895_1903_c1
709 nmdc:mga0n895_574_c1
710 nmdc:mga08x19_148433_c1
711 nmdc:mga0a205_813_c1
712 Ga0495601_0011928
713 Ga0500568_0000196
714 Ga0500568_0003207
715 Ga0501084_0059591
716 Ga0501082_0028598
717 Ga0501082_0767104
718 Ga0530510_0020514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wzf-assembly1.cif.gz_A structural and mechanism analysis of yunm 0.7746 171 215
1tbu-assembly1.cif.gz_C crystal structure of n-terminal domain of yeast peroxisomal thioesterase-1 0.7286 174 213
5cn1-assembly4.cif.gz_D crystal structure of yeast gga1_gae domain-p21 0.7277 170 211
3bdr-assembly1.cif.gz_A-2 crystal structure of fatty acid-binding protein-like ycf58 from thermosynecoccus elongatus. northeast structural genomics consortium target ter13. 0.7276 148 214
2gf6-assembly2.cif.gz_C crystal structure of a putative thioesterase (sso2295) from sulfolobus solfataricus at 1.91 a resolution 0.7228 174 212
ID Description Score Start End Superfamily
af_Q7XTY9_163_289_2.60.40.200 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.7775 171 196 2.60.40.200
af_Q2FY89_118_236_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7623 97 125 2.10.109.10
5cn1C00 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.7313 170 212 2.60.40.1230
af_A0A0P0X651_63_187_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7295 174 214 3.10.129.10
1tbuC00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7286 174 213 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2V8Y1Z9-F1-model_v4 Uncharacterized protein 0.9282 99 218
AF-A0A7C7SPN1-F1-model_v4 Uncharacterized protein 0.9145 96 224
AF-A0A2V8I9H5-F1-model_v4 Uncharacterized protein 0.9115 99 231
AF-A0A3D1IJC1-F1-model_v4 Uncharacterized protein 0.9113 107 227
AF-A0A2V8J0E3-F1-model_v4 Uncharacterized protein 0.9055 103 224

Map