F421517

General Info

Members Datasets Scaffolds Average Seq Length
359 253 718 116

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_11345322|Ga0105242_113453222
Length 122
Sequence MSTIMRTRPTDRTELLQGTLDMLILRTLLFGPAHGRAIAKHIQQTTQDVLQVEHGSLYPALHRLERKGWLSAKWEVKERNRELKYYRLTAAGRKQLAREESNWKRLAQAIARVLSPPARDEV

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
154 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 0.56
Rhizosphere 98.89
Stem 0
Stem Tuber 0
Unclassified 20.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_11345322 3300009176 Bacteria 740
2 Ga0065715_10285463 3300005293 Bacteria 1076
3 Ga0070658_10593438 3300005327 Unclassified 960
4 Ga0070676_10007290 3300005328 Bacteria 5931
5 Ga0070670_101289248 3300005331 Bacteria 669
6 Ga0070677_10024408 3300005333 Bacteria 2248
7 Ga0068869_100119160 3300005334 Bacteria 2017
8 Ga0070666_10046804 3300005335 Bacteria 2903
9 Ga0070666_10785301 3300005335 Bacteria 701
10 Ga0070682_100178038 3300005337 Bacteria 1483
11 Ga0070689_100189938 3300005340 Bacteria 1672
12 Ga0070689_100229956 3300005340 Unclassified 1524
13 Ga0070689_100468099 3300005340 Bacteria 1075
14 Ga0070691_10074779 3300005341 Bacteria 1649
15 Ga0070661_100611099 3300005344 Bacteria 882
16 Ga0070669_100053411 3300005353 Bacteria 2957
17 Ga0070675_101011931 3300005354 Bacteria 763
18 Ga0070674_101193779 3300005356 Bacteria 675
19 Ga0070688_100113107 3300005365 Bacteria 1808
20 Ga0070667_100175262 3300005367 Bacteria 1895
21 Ga0070709_10010215 3300005434 Bacteria 5191
22 Ga0070709_10109209 3300005434 Bacteria 1857
23 Ga0070709_10218835 3300005434 Unclassified 1357
24 Ga0070713_100132796 3300005436 Bacteria 2197
25 Ga0070713_100319813 3300005436 Unclassified 1433
26 Ga0070713_100615898 3300005436 Bacteria 1032
27 Ga0070713_100713032 3300005436 Unclassified 958
28 Ga0070713_101327199 3300005436 Unclassified 697
29 Ga0070701_10158264 3300005438 Bacteria 1310
30 Ga0070705_100071265 3300005440 Bacteria 2101
31 Ga0070700_100334811 3300005441 Bacteria 1117
32 Ga0070694_100003680 3300005444 Bacteria 9146
33 Ga0070694_100476980 3300005444 Bacteria 989
34 Ga0070708_100321861 3300005445 Bacteria 1457
35 Ga0070663_100164289 3300005455 Bacteria 1711
36 Ga0070678_100889360 3300005456 Bacteria 813
37 Ga0070662_101940379 3300005457 Bacteria 509
38 Ga0068867_100024685 3300005459 Bacteria 4308
39 Ga0068867_100053623 3300005459 Bacteria 2979
40 Ga0070685_10812374 3300005466 Unclassified 690
41 Ga0070706_101774825 3300005467 Bacteria 561
42 Ga0070707_100410316 3300005468 Bacteria 1315
43 Ga0070698_100262598 3300005471 Bacteria 1659
44 Ga0070698_100964715 3300005471 Bacteria 799
45 Ga0070699_100286079 3300005518 Bacteria 1477
46 Ga0070699_100607758 3300005518 Bacteria 997
47 Ga0070699_100648636 3300005518 Unclassified 964
48 Ga0070679_100258149 3300005530 Bacteria 1698
49 Ga0070684_100918953 3300005535 Unclassified 820
50 Ga0070697_100033441 3300005536 Bacteria 4141
51 Ga0070697_101498609 3300005536 Bacteria 603
52 Ga0068853_100015517 3300005539 Bacteria 6256
53 Ga0068853_101768801 3300005539 Unclassified 599
54 Ga0070686_100048963 3300005544 Bacteria 2679
55 Ga0070695_100001967 3300005545 Bacteria 11671
56 Ga0070695_100043801 3300005545 Bacteria 2847
57 Ga0070696_100026672 3300005546 Bacteria 3931
58 Ga0070693_100047285 3300005547 Bacteria 2447
59 Ga0070665_100039568 3300005548 Bacteria 4741
60 Ga0070665_101768202 3300005548 Unclassified 625
61 Ga0070704_100232069 3300005549 Bacteria 1506
62 Ga0070704_100630469 3300005549 Bacteria 945
63 Ga0068855_100053975 3300005563 Bacteria 4727
64 Ga0068855_101164791 3300005563 Bacteria 803
65 Ga0070664_100022562 3300005564 Bacteria 5191
66 Ga0068854_100042538 3300005578 Bacteria 3216
67 Ga0068854_100112142 3300005578 Bacteria 2058
68 Ga0068856_100603323 3300005614 Bacteria 1119
69 Ga0068856_100605450 3300005614 Bacteria 1117
70 Ga0068856_101229730 3300005614 Bacteria 765
71 Ga0070702_100008280 3300005615 Bacteria 5026
72 Ga0068852_100035745 3300005616 Bacteria 4147
73 Ga0068859_100370522 3300005617 Bacteria 1528
74 Ga0068859_100490452 3300005617 Bacteria 1324
75 Ga0068864_101280147 3300005618 Unclassified 733
76 Ga0068866_10127167 3300005718 Bacteria 1444
77 Ga0068861_102189992 3300005719 Unclassified 554
78 Ga0068870_10438717 3300005840 Bacteria 858
79 Ga0068858_100053289 3300005842 Bacteria 3742
80 Ga0068860_100234529 3300005843 Bacteria 1784
81 Ga0068860_100665850 3300005843 Unclassified 1049
82 Ga0068862_101077599 3300005844 Unclassified 798
83 Ga0081455_10871474 3300005937 Bacteria 561
84 Ga0070717_10031207 3300006028 Bacteria 4285
85 Ga0070717_10465116 3300006028 Unclassified 1141
86 Ga0097621_100522790 3300006237 Unclassified 1077
87 Ga0068871_101858918 3300006358 Unclassified 572
88 Ga0075428_100366567 3300006844 Bacteria 1545
89 Ga0075430_100397065 3300006846 Bacteria 1138
90 Ga0075431_101378453 3300006847 Bacteria 665
91 Ga0075433_10024751 3300006852 Bacteria 5070
92 Ga0075433_10094629 3300006852 Unclassified 2644
93 Ga0075433_10138264 3300006852 Bacteria 2165
94 Ga0075433_10338282 3300006852 Bacteria 1330
95 Ga0075434_100017495 3300006871 Bacteria 6909
96 Ga0075434_100251393 3300006871 Bacteria 1787
97 Ga0075434_100477792 3300006871 Bacteria 1267
98 Ga0075436_100876100 3300006914 Unclassified 671
99 Ga0097620_100370489 3300006931 Bacteria 1528
100 Ga0097620_100490506 3300006931 Bacteria 1324
101 Ga0075435_100021779 3300007076 Bacteria 4937
102 Ga0075435_100043608 3300007076 Unclassified 3591
103 Ga0075435_100060685 3300007076 Bacteria 3066
104 Ga0099794_10541247 3300007265 Bacteria 614
105 Ga0105240_10174937 3300009093 Unclassified 2538
106 Ga0105240_10293349 3300009093 Bacteria 1863
107 Ga0105240_10513480 3300009093 Bacteria 1331
108 Ga0105240_12716172 3300009093 Unclassified 510
109 Ga0105245_10077897 3300009098 Bacteria 3024
110 Ga0114129_10000688 3300009147 Bacteria 42747
111 Ga0114129_10015800 3300009147 Bacteria 10733
112 Ga0114129_10346501 3300009147 Bacteria 1969
113 Ga0105243_10114080 3300009148 Unclassified 2267
114 Ga0105243_10165552 3300009148 Bacteria 1910
115 Ga0105241_10130507 3300009174 Unclassified 2034
116 Ga0105241_10146063 3300009174 Bacteria 1930
117 Ga0105248_10008590 3300009177 Bacteria 11217
118 Ga0105248_10205906 3300009177 Unclassified 2217
119 Ga0105248_11616057 3300009177 Bacteria 734
120 Ga0105237_10059777 3300009545 Bacteria 3813
121 Ga0105237_10763594 3300009545 Bacteria 973
122 Ga0105238_10460106 3300009551 Unclassified 1270
123 Ga0105238_10515956 3300009551 Bacteria 1197
124 Ga0105238_10656943 3300009551 Bacteria 1059
125 Ga0105249_10278806 3300009553 Bacteria 1668
126 Ga0105239_10123439 3300010375 Bacteria 2877
127 Ga0105239_11047189 3300010375 Bacteria 939
128 Ga0105239_11909901 3300010375 Unclassified 689
129 Ga0105246_10500193 3300011119 Unclassified 1032
130 Ga0157373_10148112 3300013100 Bacteria 1651
131 Ga0157369_11631642 3300013105 Unclassified 655
132 Ga0157374_12216167 3300013296 Unclassified 576
133 Ga0157378_10011462 3300013297 Bacteria 7758
134 Ga0157378_11070280 3300013297 Bacteria 843
135 Ga0163162_12983599 3300013306 Unclassified 544
136 Ga0157372_10091125 3300013307 Unclassified 3467
137 Ga0157372_10311604 3300013307 Unclassified 1832
138 Ga0157372_10398811 3300013307 Bacteria 1603
139 Ga0157375_12369586 3300013308 Bacteria 633
140 Ga0163163_10018978 3300014325 Bacteria 6450
141 Ga0163163_10207665 3300014325 Bacteria 2007
142 Ga0157379_10134361 3300014968 Bacteria 2228
143 Ga0157376_10519309 3300014969 Unclassified 1174
144 Ga0157376_10522232 3300014969 Bacteria 1170
145 Ga0157376_10697626 3300014969 Bacteria 1020
146 Ga0207697_10114399 3300025315 Bacteria 1157
147 Ga0207653_10072125 3300025885 Bacteria 1182
148 Ga0207682_10029039 3300025893 Bacteria 2210
149 Ga0207688_10139527 3300025901 Bacteria 1426
150 Ga0207680_10179044 3300025903 Bacteria 1432
151 Ga0207647_10032703 3300025904 Bacteria 3338
152 Ga0207699_10040175 3300025906 Bacteria 2694
153 Ga0207699_10168391 3300025906 Unclassified 1464
154 Ga0207645_10011645 3300025907 Bacteria 5998
155 Ga0207705_11246266 3300025909 Unclassified 569
156 Ga0207684_10469025 3300025910 Bacteria 1080
157 Ga0207684_11262304 3300025910 Bacteria 609
158 Ga0207654_10136467 3300025911 Bacteria 1559
159 Ga0207654_10534678 3300025911 Unclassified 831
160 Ga0207695_10043111 3300025913 Bacteria 4812
161 Ga0207695_10074819 3300025913 Unclassified 3447
162 Ga0207695_10385582 3300025913 Bacteria 1286
163 Ga0207695_11678232 3300025913 Bacteria 516
164 Ga0207649_10912844 3300025920 Unclassified 689
165 Ga0207652_10347503 3300025921 Bacteria 1339
166 Ga0207681_10064975 3300025923 Bacteria 2521
167 Ga0207694_10064101 3300025924 Bacteria 2864
168 Ga0207694_10251482 3300025924 Bacteria 1446
169 Ga0207687_10647051 3300025927 Unclassified 894
170 Ga0207700_10078459 3300025928 Unclassified 2569
171 Ga0207700_10251819 3300025928 Unclassified 1509
172 Ga0207700_11059283 3300025928 Unclassified 725
173 Ga0207706_10073159 3300025933 Bacteria 3014
174 Ga0207686_10018568 3300025934 Bacteria 3939
175 Ga0207686_10836156 3300025934 Bacteria 740
176 Ga0207709_10073840 3300025935 Unclassified 2174
177 Ga0207709_10094683 3300025935 Bacteria 1961
178 Ga0207670_10437920 3300025936 Unclassified 1052
179 Ga0207669_10252542 3300025937 Bacteria 1314
180 Ga0207689_10018952 3300025942 Bacteria 5804
181 Ga0207689_10125324 3300025942 Bacteria 2113
182 Ga0207689_10245873 3300025942 Bacteria 1479
183 Ga0207661_10798448 3300025944 Bacteria 869
184 Ga0207679_10124677 3300025945 Bacteria 2057
185 Ga0207667_10152230 3300025949 Bacteria 2380
186 Ga0207667_10710276 3300025949 Bacteria 1007
187 Ga0207651_10950931 3300025960 Bacteria 766
188 Ga0207712_10080531 3300025961 Bacteria 2369
189 Ga0207668_10878893 3300025972 Bacteria 797
190 Ga0207640_10177324 3300025981 Bacteria 1594
191 Ga0207640_10676253 3300025981 Bacteria 882
192 Ga0207658_10088198 3300025986 Bacteria 2398
193 Ga0207677_10939478 3300026023 Bacteria 781
194 Ga0207703_10558819 3300026035 Bacteria 1079
195 Ga0207703_10762246 3300026035 Unclassified 922
196 Ga0207703_11313323 3300026035 Unclassified 696
197 Ga0207639_10017032 3300026041 Bacteria 5149
198 Ga0207708_10002747 3300026075 Bacteria 12929
199 Ga0207702_10199245 3300026078 Bacteria 1855
200 Ga0207702_10253645 3300026078 Bacteria 1653
201 Ga0207648_10022986 3300026089 Bacteria 5590
202 Ga0207648_10068318 3300026089 Bacteria 3096
203 Ga0207675_100057637 3300026118 Bacteria 3624
204 Ga0207675_101787856 3300026118 Unclassified 634
205 Ga0207683_10065951 3300026121 Bacteria 3192
206 Ga0207698_10448296 3300026142 Bacteria 1245
207 Ga0268266_11219734 3300028379 Bacteria 727
208 Ga0268265_10163938 3300028380 Bacteria 1892
209 Ga0268264_11222306 3300028381 Bacteria 761
210 Ga0265318_10013198 3300028577 Bacteria 3499
211 Ga0265338_10005538 3300028800 Bacteria 16440
212 Ga0265330_10000780 3300031235 Bacteria 20025
213 Ga0265332_10128627 3300031238 Bacteria 1063
214 Ga0265320_10040575 3300031240 Bacteria 2320
215 Ga0265325_10000072 3300031241 Bacteria 70302
216 Ga0265340_10201356 3300031247 Bacteria 895
217 Ga0265339_10014764 3300031249 Bacteria 4701
218 Ga0265316_10028030 3300031344 Bacteria 4651
219 Ga0265313_10018174 3300031595 Bacteria 3959
220 Ga0265342_10003806 3300031712 Bacteria 12147
221 Ga0373952_0023250 3300035092 Bacteria 1323
222 Ga0373923_0004044 3300035111 Bacteria 4813
223 Ga0373941_0173429 3300035115 Bacteria 805
224 Ga0373953_0011727 3300035117 Bacteria 3086
225 Ga0373954_0025639 3300035118 Bacteria 2697
226 Ga0373956_0001127 3300035119 Bacteria 11025
227 Ga0373957_0005045 3300035120 Bacteria 4075
228 Ga0373946_0692698 3300035171 Bacteria 532
229 Ga0373955_0004062 3300035172 Bacteria 6456
230 Ga0373924_0019459 3300035410 Unclassified 2630
231 Ga0373931_0984133 3300035691 Unclassified 570
232 Ga0373933_0000677 3300035724 Bacteria 21015
233 Ga0373937_0003072 3300036401 Bacteria 13961
234 Ga0373925_0405024 3300037068 Bacteria 1113
235 Ga0436364_0369656 3300037853 Bacteria 3009
236 Ga0395901_1047797 3300038443 Unclassified 789
237 Ga0439446_0260578 3300042156 Bacteria 600
238 Ga0451577_1123186 3300042876 Bacteria 703
239 Ga0451577_1779439 3300042876 Bacteria 541
240 Ga0453683_0479694 3300044673 Bacteria 806
241 Ga0466961_0173239 3300044693 Unclassified 1342
242 Ga0466963_0343456 3300044694 Bacteria 1051
243 Ga0466963_0768054 3300044694 Unclassified 680
244 Ga0466964_0432802 3300044706 Bacteria 694
245 Ga0466957_0304992 3300044842 Bacteria 1071
246 Ga0466957_0840738 3300044842 Unclassified 654
247 Ga0451576_0160806 3300045051 Bacteria 2344
248 Ga0451576_0396848 3300045051 Unclassified 1446
249 Ga0466958_0267138 3300045836 Bacteria 1095
250 Ga0466967_0331757 3300045976 Bacteria 1469
251 Ga0495592_0003976 3300046454 Bacteria 10716
252 Ga0495629_0040007 3300046459 Bacteria 3299
253 Ga0495651_0001692 3300046462 Bacteria 17049
254 Ga0495653_0011129 3300046463 Bacteria 7357
255 Ga0495580_0183339 3300046472 Unclassified 1445
256 Ga0495580_0442542 3300046472 Bacteria 873
257 Ga0495582_0159502 3300046473 Bacteria 1282
258 Ga0495664_0193639 3300046477 Bacteria 1232
259 Ga0495664_0370171 3300046477 Bacteria 862
260 Ga0495594_0589295 3300046499 Bacteria 630
261 Ga0495608_0000808 3300046511 Bacteria 21978
262 Ga0495618_0231490 3300046514 Bacteria 1163
263 Ga0495618_0261607 3300046514 Bacteria 1083
264 Ga0495628_0001564 3300046516 Bacteria 20953
265 Ga0495630_0004820 3300046517 Bacteria 9464
266 Ga0495652_0002997 3300046529 Bacteria 16948
267 Ga0495665_0020232 3300046531 Bacteria 3577
268 Ga0495586_0061607 3300046535 Unclassified 2042
269 Ga0495587_0000128 3300046536 Bacteria 57292
270 Ga0495645_0001310 3300046543 Bacteria 16902
271 Ga0495633_0555589 3300046558 Unclassified 517
272 Ga0495667_0009334 3300046559 Bacteria 6647
273 Ga0495667_0948759 3300046559 Bacteria 526
274 Ga0495634_0697919 3300046642 Unclassified 584
275 Ga0495635_0000302 3300046663 Bacteria 31833
276 Ga0495657_0000670 3300046675 Bacteria 30989
277 Ga0495599_0000406 3300046678 Bacteria 24606
278 Ga0495623_0000010 3300046679 Bacteria 121464
279 Ga0495646_0001154 3300046680 Bacteria 15436
280 Ga0495658_0412147 3300046683 Bacteria 862
281 Ga0495669_0470847 3300046684 Unclassified 610
282 Ga0495613_0296010 3300046689 Bacteria 1121
283 Ga0495670_0311320 3300046691 Bacteria 845
284 Ga0495600_0000430 3300046809 Bacteria 21493
285 Ga0495581_0078737 3300047315 Unclassified 1907
286 Ga0495581_0885238 3300047315 Bacteria 510
287 Ga0495604_0001166 3300047317 Bacteria 21714
288 Ga0495674_0002060 3300047319 Bacteria 19714
289 Ga0495674_0237939 3300047319 Unclassified 1501
290 Ga0495674_0275328 3300047319 Bacteria 1380
291 Ga0495680_0003733 3300047322 Bacteria 14833
292 Ga0495675_0000707 3300047444 Bacteria 20824
293 Ga0495684_0000207 3300047471 Bacteria 45417
294 Ga0495684_0036215 3300047471 Bacteria 3784
295 Ga0495684_0150583 3300047471 Unclassified 1740
296 Ga0495602_0000693 3300048088 Bacteria 31634
297 Ga0496103_0149748 3300048906 Bacteria 1495
298 Ga0496115_0029175 3300048918 Bacteria 4331
299 Ga0501031_0119179 3300049568 Bacteria 1724
300 Ga0501032_0005699 3300049569 Bacteria 9226
301 Ga0501033_0003076 3300049570 Bacteria 13865
302 Ga0501033_1198553 3300049570 Bacteria 503
303 Ga0501034_0004552 3300049571 Bacteria 15387
304 Ga0501036_0003748 3300049572 Bacteria 12179
305 Ga0501037_0011085 3300049573 Bacteria 6632
306 Ga0501038_0125421 3300049574 Bacteria 2113
307 Ga0501039_0002919 3300049575 Bacteria 12795
308 Ga0501043_0124145 3300049579 Bacteria 2024
309 Ga0501046_0322411 3300049580 Unclassified 1125
310 Ga0501047_0044915 3300049581 Bacteria 4270
311 Ga0501048_0015472 3300049582 Bacteria 5635
312 Ga0501067_0227774 3300049583 Unclassified 1037
313 Ga0501068_0000078 3300049584 Bacteria 39422
314 Ga0501069_0000673 3300049585 Bacteria 15866
315 Ga0501070_0386342 3300049586 Bacteria 1133
316 Ga0501072_0001507 3300049588 Bacteria 17440
317 Ga0501072_0404852 3300049588 Bacteria 1082
318 Ga0501073_0012891 3300049589 Bacteria 6094
319 Ga0501074_0185717 3300049590 Unclassified 1482
320 Ga0501075_0163716 3300049591 Bacteria 1697
321 Ga0501076_0082073 3300049592 Bacteria 2588
322 Ga0501077_0104014 3300049593 Unclassified 1799
323 Ga0501079_0361572 3300049741 Bacteria 1137
324 Ga0501080_0000059 3300049742 Bacteria 72357
325 Ga0501083_0002842 3300049744 Bacteria 11968
326 Ga0501035_0303151 3300049822 Bacteria 1345
327 Ga0501035_1023071 3300049822 Bacteria 649
328 Ga0501044_0084649 3300049823 Unclassified 3204
329 nmdc:mga05p37_12292_c1 3300050507 Bacteria 10224
330 nmdc:mga05p37_1836_c1 3300050507 Bacteria 24760
331 nmdc:mga05p37_21692_c1 3300050507 Bacteria 7781
332 nmdc:mga05p37_83611_c1 3300050507 Bacteria 3932
333 nmdc:mga05p37_992361_c1 3300050507 Bacteria 893
334 nmdc:mga0qj67_541863_c1 3300050509 Bacteria 934
335 nmdc:mga06r32_148466_c1 3300050510 Bacteria 2322
336 nmdc:mga06r32_1570121_c1 3300050510 Unclassified 597
337 nmdc:mga06r32_713314_c1 3300050510 Bacteria 968
338 nmdc:mga08y16_1592907_c1 3300050511 Unclassified 611
339 nmdc:mga0n895_11469_c1 3300050512 Bacteria 7909
340 nmdc:mga0n895_48138_c1 3300050512 Bacteria 4172
341 nmdc:mga0n895_519358_c1 3300050512 Bacteria 1198
342 nmdc:mga0n895_655321_c1 3300050512 Bacteria 1048
343 nmdc:mga0rr50_29824_c1 3300050513 Unclassified 3853
344 nmdc:mga0rr50_41883_c1 3300050513 Bacteria 3341
345 nmdc:mga08x19_133328_c1 3300050514 Unclassified 1673
346 nmdc:mga0a205_100859_c1 3300050515 Bacteria 2786
347 nmdc:mga0a205_31285_c1 3300050515 Bacteria 5098
348 nmdc:mga0a205_38499_c1 3300050515 Bacteria 4601
349 nmdc:mga0a205_481174_c1 3300050515 Bacteria 1100
350 Ga0495601_0031197 3300053077 Bacteria 3312
351 Ga0495601_0226556 3300053077 Bacteria 1221
352 Ga0495601_0511081 3300053077 Bacteria 775
353 Ga0495612_0007006 3300053078 Bacteria 4611
354 Ga0495612_0418526 3300053078 Bacteria 610
355 Ga0495619_0000323 3300053085 Bacteria 33441
356 Ga0500568_0003407 3300053139 Bacteria 8877
357 Ga0501084_0014054 3300054114 Bacteria 6628
358 Ga0501082_0101602 3300060353 Bacteria 2487
359 Ga0530510_0081301 3300061734 Unclassified 2359
360 Ga0105242_11345322
361 Ga0065715_10285463
362 Ga0070658_10593438
363 Ga0070676_10007290
364 Ga0070670_101289248
365 Ga0070677_10024408
366 Ga0068869_100119160
367 Ga0070666_10046804
368 Ga0070666_10785301
369 Ga0070682_100178038
370 Ga0070689_100189938
371 Ga0070689_100229956
372 Ga0070689_100468099
373 Ga0070691_10074779
374 Ga0070661_100611099
375 Ga0070669_100053411
376 Ga0070675_101011931
377 Ga0070674_101193779
378 Ga0070688_100113107
379 Ga0070667_100175262
380 Ga0070709_10010215
381 Ga0070709_10109209
382 Ga0070709_10218835
383 Ga0070713_100132796
384 Ga0070713_100319813
385 Ga0070713_100615898
386 Ga0070713_100713032
387 Ga0070713_101327199
388 Ga0070701_10158264
389 Ga0070705_100071265
390 Ga0070700_100334811
391 Ga0070694_100003680
392 Ga0070694_100476980
393 Ga0070708_100321861
394 Ga0070663_100164289
395 Ga0070678_100889360
396 Ga0070662_101940379
397 Ga0068867_100024685
398 Ga0068867_100053623
399 Ga0070685_10812374
400 Ga0070706_101774825
401 Ga0070707_100410316
402 Ga0070698_100262598
403 Ga0070698_100964715
404 Ga0070699_100286079
405 Ga0070699_100607758
406 Ga0070699_100648636
407 Ga0070679_100258149
408 Ga0070684_100918953
409 Ga0070697_100033441
410 Ga0070697_101498609
411 Ga0068853_100015517
412 Ga0068853_101768801
413 Ga0070686_100048963
414 Ga0070695_100001967
415 Ga0070695_100043801
416 Ga0070696_100026672
417 Ga0070693_100047285
418 Ga0070665_100039568
419 Ga0070665_101768202
420 Ga0070704_100232069
421 Ga0070704_100630469
422 Ga0068855_100053975
423 Ga0068855_101164791
424 Ga0070664_100022562
425 Ga0068854_100042538
426 Ga0068854_100112142
427 Ga0068856_100603323
428 Ga0068856_100605450
429 Ga0068856_101229730
430 Ga0070702_100008280
431 Ga0068852_100035745
432 Ga0068859_100370522
433 Ga0068859_100490452
434 Ga0068864_101280147
435 Ga0068866_10127167
436 Ga0068861_102189992
437 Ga0068870_10438717
438 Ga0068858_100053289
439 Ga0068860_100234529
440 Ga0068860_100665850
441 Ga0068862_101077599
442 Ga0081455_10871474
443 Ga0070717_10031207
444 Ga0070717_10465116
445 Ga0097621_100522790
446 Ga0068871_101858918
447 Ga0075428_100366567
448 Ga0075430_100397065
449 Ga0075431_101378453
450 Ga0075433_10024751
451 Ga0075433_10094629
452 Ga0075433_10138264
453 Ga0075433_10338282
454 Ga0075434_100017495
455 Ga0075434_100251393
456 Ga0075434_100477792
457 Ga0075436_100876100
458 Ga0097620_100370489
459 Ga0097620_100490506
460 Ga0075435_100021779
461 Ga0075435_100043608
462 Ga0075435_100060685
463 Ga0099794_10541247
464 Ga0105240_10174937
465 Ga0105240_10293349
466 Ga0105240_10513480
467 Ga0105240_12716172
468 Ga0105245_10077897
469 Ga0114129_10000688
470 Ga0114129_10015800
471 Ga0114129_10346501
472 Ga0105243_10114080
473 Ga0105243_10165552
474 Ga0105241_10130507
475 Ga0105241_10146063
476 Ga0105248_10008590
477 Ga0105248_10205906
478 Ga0105248_11616057
479 Ga0105237_10059777
480 Ga0105237_10763594
481 Ga0105238_10460106
482 Ga0105238_10515956
483 Ga0105238_10656943
484 Ga0105249_10278806
485 Ga0105239_10123439
486 Ga0105239_11047189
487 Ga0105239_11909901
488 Ga0105246_10500193
489 Ga0157373_10148112
490 Ga0157369_11631642
491 Ga0157374_12216167
492 Ga0157378_10011462
493 Ga0157378_11070280
494 Ga0163162_12983599
495 Ga0157372_10091125
496 Ga0157372_10311604
497 Ga0157372_10398811
498 Ga0157375_12369586
499 Ga0163163_10018978
500 Ga0163163_10207665
501 Ga0157379_10134361
502 Ga0157376_10519309
503 Ga0157376_10522232
504 Ga0157376_10697626
505 Ga0207697_10114399
506 Ga0207653_10072125
507 Ga0207682_10029039
508 Ga0207688_10139527
509 Ga0207680_10179044
510 Ga0207647_10032703
511 Ga0207699_10040175
512 Ga0207699_10168391
513 Ga0207645_10011645
514 Ga0207705_11246266
515 Ga0207684_10469025
516 Ga0207684_11262304
517 Ga0207654_10136467
518 Ga0207654_10534678
519 Ga0207695_10043111
520 Ga0207695_10074819
521 Ga0207695_10385582
522 Ga0207695_11678232
523 Ga0207649_10912844
524 Ga0207652_10347503
525 Ga0207681_10064975
526 Ga0207694_10064101
527 Ga0207694_10251482
528 Ga0207687_10647051
529 Ga0207700_10078459
530 Ga0207700_10251819
531 Ga0207700_11059283
532 Ga0207706_10073159
533 Ga0207686_10018568
534 Ga0207686_10836156
535 Ga0207709_10073840
536 Ga0207709_10094683
537 Ga0207670_10437920
538 Ga0207669_10252542
539 Ga0207689_10018952
540 Ga0207689_10125324
541 Ga0207689_10245873
542 Ga0207661_10798448
543 Ga0207679_10124677
544 Ga0207667_10152230
545 Ga0207667_10710276
546 Ga0207651_10950931
547 Ga0207712_10080531
548 Ga0207668_10878893
549 Ga0207640_10177324
550 Ga0207640_10676253
551 Ga0207658_10088198
552 Ga0207677_10939478
553 Ga0207703_10558819
554 Ga0207703_10762246
555 Ga0207703_11313323
556 Ga0207639_10017032
557 Ga0207708_10002747
558 Ga0207702_10199245
559 Ga0207702_10253645
560 Ga0207648_10022986
561 Ga0207648_10068318
562 Ga0207675_100057637
563 Ga0207675_101787856
564 Ga0207683_10065951
565 Ga0207698_10448296
566 Ga0268266_11219734
567 Ga0268265_10163938
568 Ga0268264_11222306
569 Ga0265318_10013198
570 Ga0265338_10005538
571 Ga0265330_10000780
572 Ga0265332_10128627
573 Ga0265320_10040575
574 Ga0265325_10000072
575 Ga0265340_10201356
576 Ga0265339_10014764
577 Ga0265316_10028030
578 Ga0265313_10018174
579 Ga0265342_10003806
580 Ga0373952_0023250
581 Ga0373923_0004044
582 Ga0373941_0173429
583 Ga0373953_0011727
584 Ga0373954_0025639
585 Ga0373956_0001127
586 Ga0373957_0005045
587 Ga0373946_0692698
588 Ga0373955_0004062
589 Ga0373924_0019459
590 Ga0373931_0984133
591 Ga0373933_0000677
592 Ga0373937_0003072
593 Ga0373925_0405024
594 Ga0436364_0369656
595 Ga0395901_1047797
596 Ga0439446_0260578
597 Ga0451577_1123186
598 Ga0451577_1779439
599 Ga0453683_0479694
600 Ga0466961_0173239
601 Ga0466963_0343456
602 Ga0466963_0768054
603 Ga0466964_0432802
604 Ga0466957_0304992
605 Ga0466957_0840738
606 Ga0451576_0160806
607 Ga0451576_0396848
608 Ga0466958_0267138
609 Ga0466967_0331757
610 Ga0495592_0003976
611 Ga0495629_0040007
612 Ga0495651_0001692
613 Ga0495653_0011129
614 Ga0495580_0183339
615 Ga0495580_0442542
616 Ga0495582_0159502
617 Ga0495664_0193639
618 Ga0495664_0370171
619 Ga0495594_0589295
620 Ga0495608_0000808
621 Ga0495618_0231490
622 Ga0495618_0261607
623 Ga0495628_0001564
624 Ga0495630_0004820
625 Ga0495652_0002997
626 Ga0495665_0020232
627 Ga0495586_0061607
628 Ga0495587_0000128
629 Ga0495645_0001310
630 Ga0495633_0555589
631 Ga0495667_0009334
632 Ga0495667_0948759
633 Ga0495634_0697919
634 Ga0495635_0000302
635 Ga0495657_0000670
636 Ga0495599_0000406
637 Ga0495623_0000010
638 Ga0495646_0001154
639 Ga0495658_0412147
640 Ga0495669_0470847
641 Ga0495613_0296010
642 Ga0495670_0311320
643 Ga0495600_0000430
644 Ga0495581_0078737
645 Ga0495581_0885238
646 Ga0495604_0001166
647 Ga0495674_0002060
648 Ga0495674_0237939
649 Ga0495674_0275328
650 Ga0495680_0003733
651 Ga0495675_0000707
652 Ga0495684_0000207
653 Ga0495684_0036215
654 Ga0495684_0150583
655 Ga0495602_0000693
656 Ga0496103_0149748
657 Ga0496115_0029175
658 Ga0501031_0119179
659 Ga0501032_0005699
660 Ga0501033_0003076
661 Ga0501033_1198553
662 Ga0501034_0004552
663 Ga0501036_0003748
664 Ga0501037_0011085
665 Ga0501038_0125421
666 Ga0501039_0002919
667 Ga0501043_0124145
668 Ga0501046_0322411
669 Ga0501047_0044915
670 Ga0501048_0015472
671 Ga0501067_0227774
672 Ga0501068_0000078
673 Ga0501069_0000673
674 Ga0501070_0386342
675 Ga0501072_0001507
676 Ga0501072_0404852
677 Ga0501073_0012891
678 Ga0501074_0185717
679 Ga0501075_0163716
680 Ga0501076_0082073
681 Ga0501077_0104014
682 Ga0501079_0361572
683 Ga0501080_0000059
684 Ga0501083_0002842
685 Ga0501035_0303151
686 Ga0501035_1023071
687 Ga0501044_0084649
688 nmdc:mga05p37_12292_c1
689 nmdc:mga05p37_1836_c1
690 nmdc:mga05p37_21692_c1
691 nmdc:mga05p37_83611_c1
692 nmdc:mga05p37_992361_c1
693 nmdc:mga0qj67_541863_c1
694 nmdc:mga06r32_148466_c1
695 nmdc:mga06r32_1570121_c1
696 nmdc:mga06r32_713314_c1
697 nmdc:mga08y16_1592907_c1
698 nmdc:mga0n895_11469_c1
699 nmdc:mga0n895_48138_c1
700 nmdc:mga0n895_519358_c1
701 nmdc:mga0n895_655321_c1
702 nmdc:mga0rr50_29824_c1
703 nmdc:mga0rr50_41883_c1
704 nmdc:mga08x19_133328_c1
705 nmdc:mga0a205_100859_c1
706 nmdc:mga0a205_31285_c1
707 nmdc:mga0a205_38499_c1
708 nmdc:mga0a205_481174_c1
709 Ga0495601_0031197
710 Ga0495601_0226556
711 Ga0495601_0511081
712 Ga0495612_0007006
713 Ga0495612_0418526
714 Ga0495619_0000323
715 Ga0500568_0003407
716 Ga0501084_0014054
717 Ga0501082_0101602
718 Ga0530510_0081301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

24

98

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9128 10 111
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9019 9 115
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.895 10 113
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.8924 9 116
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.8848 9 115
ID Description Score Start End Superfamily
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8906 9 112 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8848 9 115 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8785 16 95 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8766 9 115 1.10.10.10
4esbA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8712 9 111 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A537T4U9-F1-model_v4 PadR family transcriptional regulator 0.9567 8 114
AF-A0A061LVB0-F1-model_v4 Transcriptional regulator 0.9534 13 114
AF-A0A1Y4NFL1-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.953 13 112
AF-A0A1I0DAG5-F1-model_v4 Transcriptional regulator PadR-like family protein 0.9526 13 114
AF-A0A2V8HPL0-F1-model_v4 PadR family transcriptional regulator 0.9525 10 116

Map