F421511

General Info

Members Datasets Scaffolds Average Seq Length
359 221 718 184

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10091339|Ga0105245_100913392
Length 188
Sequence MPNVSTNDLKNGMALQLPEGLFTVVEFQHVKPGKGGAFVRTKLKNVRTGAVLDRTYRADEKLEQTNIDKREMQFLYREGTYHVFMDNSTYDQTHVDADVMAVATKYLKEGDSAILQVANEDEVVGVELPAAVELLVAETEPGVQGDRVSGARKPATLETGLVVQVPLFVNPGDRIKVDTRSGDYLTRV

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
67 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
106 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
107 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
108 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
109 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
129 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
130 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
131 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
132 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
133 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.1
Metatranscriptomes 3.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.67
Nodule 0
Rhizoplane 6.13
Rhizosphere 89.14
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10091339 3300009098 Bacteria 2802
2 Ga0070658_10000155 3300005327 Bacteria 60553
3 Ga0070690_100259500 3300005330 Bacteria 1232
4 Ga0070680_100063378 3300005336 Bacteria 3028
5 Ga0070682_100150434 3300005337 Bacteria 1597
6 Ga0070682_100394277 3300005337 Bacteria 1045
7 Ga0070660_100043279 3300005339 Bacteria 3441
8 Ga0070689_100301445 3300005340 Bacteria 1334
9 Ga0070674_101048292 3300005356 Bacteria 718
10 Ga0070673_101167296 3300005364 Bacteria 721
11 Ga0070688_100324959 3300005365 Bacteria 1119
12 Ga0070667_100143109 3300005367 Bacteria 2096
13 Ga0070703_10066616 3300005406 Bacteria 1192
14 Ga0070701_10401315 3300005438 Bacteria 869
15 Ga0070708_100024347 3300005445 Bacteria 5163
16 Ga0070678_100198359 3300005456 Bacteria 1655
17 Ga0070678_100241686 3300005456 Bacteria 1510
18 Ga0070681_10010478 3300005458 Bacteria 9156
19 Ga0070681_10113137 3300005458 Bacteria 2654
20 Ga0070681_10113510 3300005458 Bacteria 2649
21 Ga0070681_10321197 3300005458 Bacteria 1458
22 Ga0070681_10392552 3300005458 Bacteria 1299
23 Ga0070681_10765806 3300005458 Bacteria 882
24 Ga0070681_10805604 3300005458 Bacteria 856
25 Ga0070706_100094868 3300005467 Bacteria 2768
26 Ga0070706_100289435 3300005467 Bacteria 1529
27 Ga0070707_100297714 3300005468 Bacteria 1568
28 Ga0070698_100049652 3300005471 Bacteria 4281
29 Ga0070699_100345459 3300005518 Bacteria 1340
30 Ga0070679_100004306 3300005530 Bacteria 13140
31 Ga0070679_100095534 3300005530 Bacteria 2960
32 Ga0070679_101014492 3300005530 Bacteria 774
33 Ga0070684_100213497 3300005535 Bacteria 1759
34 Ga0070684_100541603 3300005535 Bacteria 1080
35 Ga0070684_100712818 3300005535 Bacteria 936
36 Ga0070697_100325153 3300005536 Bacteria 1325
37 Ga0070686_100253357 3300005544 Bacteria 1287
38 Ga0070695_100315769 3300005545 Bacteria 1160
39 Ga0070665_100159832 3300005548 Bacteria 2255
40 Ga0070704_100110634 3300005549 Bacteria 2090
41 Ga0070704_100479843 3300005549 Bacteria 1076
42 Ga0068855_101399246 3300005563 Bacteria 721
43 Ga0070702_100327098 3300005615 Bacteria 1071
44 Ga0068859_100934754 3300005617 Bacteria 951
45 Ga0068858_100038054 3300005842 Bacteria 4462
46 Ga0068860_100214446 3300005843 Bacteria 1868
47 Ga0081455_10096319 3300005937 Bacteria 2386
48 Ga0081538_10147559 3300005981 Bacteria 1072
49 Ga0075365_10003029 3300006038 Bacteria 8523
50 Ga0075365_10123052 3300006038 Bacteria 1791
51 Ga0075428_100201997 3300006844 Bacteria 2148
52 Ga0075430_100243388 3300006846 Bacteria 1490
53 Ga0075431_100625800 3300006847 Bacteria 1058
54 Ga0075431_100815328 3300006847 Bacteria 906
55 Ga0075431_100826940 3300006847 Bacteria 898
56 Ga0075436_100398682 3300006914 Bacteria 997
57 Ga0097620_100934533 3300006931 Bacteria 951
58 Ga0075435_100330876 3300007076 Bacteria 1305
59 Ga0075435_100486752 3300007076 Bacteria 1066
60 Ga0111539_10113261 3300009094 Bacteria 3182
61 Ga0111539_10529853 3300009094 Bacteria 1372
62 Ga0111539_11087974 3300009094 Bacteria 929
63 Ga0105245_10003545 3300009098 Bacteria 13935
64 Ga0105245_10849906 3300009098 Bacteria 952
65 Ga0105245_11169134 3300009098 Bacteria 817
66 Ga0105247_10932497 3300009101 Bacteria 673
67 Ga0114129_10103098 3300009147 Bacteria 3945
68 Ga0114129_11095218 3300009147 Bacteria 998
69 Ga0114129_11135084 3300009147 Bacteria 977
70 Ga0105243_10323814 3300009148 Bacteria 1406
71 Ga0105242_10044337 3300009176 Bacteria 3602
72 Ga0105242_10305848 3300009176 Bacteria 1453
73 Ga0105242_10401764 3300009176 Bacteria 1279
74 Ga0105242_10652898 3300009176 Bacteria 1023
75 Ga0105238_10870863 3300009551 Bacteria 918
76 Ga0105249_10126299 3300009553 Bacteria 2436
77 Ga0105249_11576449 3300009553 Bacteria 729
78 Ga0105246_10119626 3300011119 Bacteria 1949
79 Ga0105246_10230475 3300011119 Bacteria 1458
80 Ga0157373_10504573 3300013100 Bacteria 874
81 Ga0157369_10004458 3300013105 Bacteria 16498
82 Ga0157378_10128995 3300013297 Bacteria 2339
83 Ga0163162_10493055 3300013306 Bacteria 1356
84 Ga0157372_10251698 3300013307 Bacteria 2051
85 Ga0157372_10581442 3300013307 Bacteria 1305
86 Ga0157372_11347961 3300013307 Bacteria 823
87 Ga0157375_11053258 3300013308 Bacteria 951
88 Ga0157375_11127778 3300013308 Bacteria 919
89 Ga0163163_10787420 3300014325 Bacteria 1014
90 Ga0157380_10376501 3300014326 Bacteria 1338
91 Ga0157380_11566576 3300014326 Bacteria 714
92 Ga0157379_10983072 3300014968 Bacteria 804
93 Ga0182005_1049058 3300015265 Bacteria 1147
94 Ga0197907_10568880 3300020069 Bacteria 665
95 Ga0197907_10648649 3300020069 Bacteria 6122
96 Ga0206355_1578167 3300020076 Bacteria 846
97 Ga0206354_11058076 3300020081 Bacteria 811
98 Ga0206354_11653423 3300020081 Bacteria 729
99 Ga0206353_11242615 3300020082 Bacteria 1936
100 Ga0213876_10271653 3300021384 Bacteria 901
101 Ga0224712_10189278 3300022467 Bacteria 931
102 Ga0224712_10193472 3300022467 Bacteria 921
103 Ga0224712_10249455 3300022467 Bacteria 820
104 Ga0224572_1003489 3300024225 Bacteria 2655
105 Ga0207653_10030695 3300025885 Bacteria 1734
106 Ga0207645_10035143 3300025907 Bacteria 3218
107 Ga0207645_10122073 3300025907 Bacteria 1692
108 Ga0207645_10306490 3300025907 Bacteria 1058
109 Ga0207705_10000819 3300025909 Bacteria 25442
110 Ga0207705_10069798 3300025909 Bacteria 2545
111 Ga0207705_10126628 3300025909 Bacteria 1899
112 Ga0207705_10164063 3300025909 Bacteria 1670
113 Ga0207705_10219104 3300025909 Bacteria 1445
114 Ga0207684_10021460 3300025910 Bacteria 5514
115 Ga0207707_10023087 3300025912 Bacteria 5443
116 Ga0207707_10042099 3300025912 Bacteria 3988
117 Ga0207671_10280451 3300025914 Bacteria 1314
118 Ga0207693_10072195 3300025915 Bacteria 2703
119 Ga0207660_10046162 3300025917 Bacteria 3073
120 Ga0207657_10085497 3300025919 Bacteria 2642
121 Ga0207657_10370645 3300025919 Bacteria 1128
122 Ga0207652_10001621 3300025921 Bacteria 19778
123 Ga0207646_10308368 3300025922 Bacteria 1430
124 Ga0207687_10057980 3300025927 Bacteria 2722
125 Ga0207687_10212898 3300025927 Bacteria 1517
126 Ga0207687_10508162 3300025927 Bacteria 1006
127 Ga0207664_10202097 3300025929 Bacteria 1716
128 Ga0207664_11018027 3300025929 Bacteria 742
129 Ga0207644_10026787 3300025931 Bacteria 3977
130 Ga0207690_10009412 3300025932 Bacteria 5803
131 Ga0207686_10172727 3300025934 Bacteria 1526
132 Ga0207686_10249775 3300025934 Bacteria 1295
133 Ga0207686_10291077 3300025934 Bacteria 1209
134 Ga0207686_11037344 3300025934 Bacteria 667
135 Ga0207709_10193483 3300025935 Bacteria 1447
136 Ga0207670_10355799 3300025936 Bacteria 1161
137 Ga0207669_10842283 3300025937 Bacteria 763
138 Ga0207665_10375445 3300025939 Bacteria 1078
139 Ga0207691_10564568 3300025940 Bacteria 964
140 Ga0207691_11092482 3300025940 Bacteria 664
141 Ga0207658_10356387 3300025986 Bacteria 1275
142 Ga0207658_10440677 3300025986 Unclassified 1152
143 Ga0207703_10027415 3300026035 Bacteria 4487
144 Ga0207676_10391259 3300026095 Bacteria 1297
145 Ga0207683_10065646 3300026121 Bacteria 3200
146 Ga0207683_10349961 3300026121 Bacteria 1356
147 Ga0268266_10057480 3300028379 Bacteria 3348
148 Ga0268264_11586488 3300028381 Bacteria 665
149 Ga0265338_10000266 3300028800 Bacteria 95213
150 Ga0265760_10047498 3300031090 Bacteria 1289
151 Ga0265760_10132770 3300031090 Bacteria 806
152 Ga0265325_10000424 3300031241 Bacteria 30295
153 Ga0265339_10001337 3300031249 Bacteria 18429
154 Ga0265339_10156673 3300031249 Bacteria 1149
155 Ga0265327_10005704 3300031251 Bacteria 10274
156 Ga0265327_10007617 3300031251 Bacteria 8303
157 Ga0307408_100223457 3300031548 Bacteria 1538
158 Ga0265313_10000539 3300031595 Bacteria 39481
159 Ga0265314_10057439 3300031711 Unclassified 2672
160 Ga0265314_10274878 3300031711 Bacteria 956
161 Ga0265314_10372718 3300031711 Bacteria 779
162 Ga0307413_10307745 3300031824 Bacteria 1205
163 Ga0307407_10439884 3300031903 Bacteria 944
164 Ga0307416_100475213 3300032002 Bacteria 1309
165 Ga0307416_101063555 3300032002 Bacteria 913
166 Ga0307416_101139046 3300032002 Bacteria 885
167 Ga0373959_0061342 3300034820 Bacteria 833
168 Ga0373944_0185646 3300035089 Bacteria 747
169 Ga0373954_0146467 3300035118 Bacteria 1153
170 Ga0373956_0066766 3300035119 Bacteria 1637
171 Ga0373957_0275674 3300035120 Bacteria 710
172 Ga0373943_0104047 3300035170 Bacteria 1489
173 Ga0373961_0278898 3300035241 Bacteria 613
174 Ga0316574_0014934 3300035398 Bacteria 4499
175 Ga0373931_0617383 3300035691 Bacteria 710
176 Ga0373935_0665868 3300035692 Bacteria 764
177 Ga0373935_0666675 3300035692 Bacteria 764
178 Ga0373933_0020841 3300035724 Bacteria 3718
179 Ga0373933_0332809 3300035724 Bacteria 985
180 Ga0373947_0551083 3300035725 Bacteria 785
181 Ga0373947_0631054 3300035725 Bacteria 730
182 Ga0373937_0006968 3300036401 Bacteria 9756
183 Ga0373937_0228548 3300036401 Bacteria 1752
184 Ga0373937_0436559 3300036401 Bacteria 1243
185 Ga0372808_003263 3300036459 Bacteria 1970
186 Ga0316584_0164086 3300036712 Bacteria 1650
187 Ga0373925_0356938 3300037068 Bacteria 1187
188 Ga0436364_1481876 3300037853 Bacteria 2988
189 Ga0400483_062577 3300039062 Bacteria 66463
190 Ga0400483_201997 3300039062 Bacteria 26527
191 Ga0436365_0869254 3300039437 Bacteria 7466
192 Ga0436365_1383758 3300039437 Bacteria 724
193 Ga0436365_1495429 3300039437 Bacteria 2101
194 Ga0436360_0172373 3300039438 Bacteria 778
195 Ga0436360_0536144 3300039438 Bacteria 3494
196 Ga0436363_0746236 3300039450 Bacteria 826
197 Ga0436363_1569326 3300039450 Bacteria 1302
198 Ga0436362_0214187 3300039453 Bacteria 1274
199 Ga0436362_0367336 3300039453 Bacteria 925
200 Ga0436362_0378620 3300039453 Bacteria 802
201 Ga0436362_0847926 3300039453 Bacteria 2360
202 Ga0451807_2293950 3300041486 Bacteria 934
203 Ga0451837_0544236 3300041494 Bacteria 873
204 Ga0439432_044482 3300042006 Bacteria 1399
205 Ga0439452_039312 3300042010 Bacteria 1120
206 Ga0450923_034241 3300042125 Bacteria 1047
207 Ga0439446_0150209 3300042156 Bacteria 766
208 Ga0439434_0042476 3300042435 Bacteria 1398
209 Ga0466965_0161801 3300044683 Bacteria 1174
210 Ga0466966_0132242 3300044684 Bacteria 1527
211 Ga0466966_0213081 3300044684 Bacteria 1167
212 Ga0466961_0009131 3300044693 Bacteria 6315
213 Ga0466961_0084114 3300044693 Bacteria 2012
214 Ga0466961_0120678 3300044693 Bacteria 1646
215 Ga0466961_0120739 3300044693 Bacteria 1646
216 Ga0466963_0249348 3300044694 Bacteria 1246
217 Ga0466968_0108855 3300044735 Bacteria 1244
218 Ga0466957_0163576 3300044842 Bacteria 1446
219 Ga0466959_0309154 3300045049 Bacteria 1082
220 Ga0466958_0024082 3300045836 Bacteria 3580
221 Ga0466958_0033617 3300045836 Bacteria 3056
222 Ga0466967_1747936 3300045976 Bacteria 619
223 Ga0495603_0405878 3300046455 Bacteria 781
224 Ga0495603_0443877 3300046455 Bacteria 743
225 Ga0495629_0155371 3300046459 Bacteria 1590
226 Ga0495653_0230424 3300046463 Bacteria 1240
227 Ga0495582_0237665 3300046473 Bacteria 1044
228 Ga0495664_0360491 3300046477 Bacteria 875
229 Ga0495584_0229395 3300046491 Bacteria 944
230 Ga0495618_0246535 3300046514 Bacteria 1122
231 Ga0495628_0263886 3300046516 Bacteria 1283
232 Ga0495628_0781242 3300046516 Bacteria 669
233 Ga0495630_0771072 3300046517 Bacteria 735
234 Ga0495652_0243250 3300046529 Bacteria 1337
235 Ga0495652_0449670 3300046529 Bacteria 902
236 Ga0495640_0591293 3300046533 Bacteria 671
237 Ga0495587_0028579 3300046536 Bacteria 3390
238 Ga0495621_0017771 3300046539 Bacteria 2303
239 Ga0495645_0383512 3300046543 Bacteria 899
240 Ga0495667_0001375 3300046559 Bacteria 16005
241 Ga0495656_0269342 3300046615 Bacteria 865
242 Ga0495635_0032097 3300046663 Bacteria 3645
243 Ga0495635_0148977 3300046663 Bacteria 1593
244 Ga0495588_0074116 3300046674 Bacteria 1773
245 Ga0495657_0019474 3300046675 Bacteria 4894
246 Ga0495657_0108084 3300046675 Bacteria 1765
247 Ga0495623_0014853 3300046679 Bacteria 5036
248 Ga0495658_0226005 3300046683 Bacteria 1173
249 Ga0495613_0059575 3300046689 Bacteria 2799
250 Ga0495600_0060320 3300046809 Bacteria 2477
251 Ga0495600_0372163 3300046809 Bacteria 892
252 Ga0495600_0404730 3300046809 Bacteria 849
253 Ga0495581_0217210 3300047315 Bacteria 1118
254 Ga0495604_0175132 3300047317 Bacteria 1505
255 Ga0495604_0486545 3300047317 Bacteria 802
256 Ga0495674_0379644 3300047319 Bacteria 1144
257 Ga0495680_0061185 3300047322 Bacteria 2897
258 Ga0495680_0776995 3300047322 Bacteria 627
259 Ga0495684_0131973 3300047471 Bacteria 1876
260 Ga0495602_0045818 3300048088 Bacteria 3955
261 Ga0495614_0311585 3300048089 Bacteria 729
262 Ga0496102_0577236 3300048905 Bacteria 1047
263 Ga0496103_0338150 3300048906 Bacteria 968
264 Ga0496104_0582805 3300048907 Bacteria 1029
265 Ga0496108_0097886 3300048911 Bacteria 2500
266 Ga0496108_0898933 3300048911 Bacteria 760
267 Ga0496108_1161076 3300048911 Bacteria 654
268 Ga0496109_0027945 3300048912 Bacteria 5042
269 Ga0496109_0817869 3300048912 Bacteria 870
270 Ga0496109_0978276 3300048912 Bacteria 784
271 Ga0496110_0627945 3300048913 Bacteria 973
272 Ga0496110_1736169 3300048913 Bacteria 534
273 Ga0496111_0086006 3300048914 Bacteria 2300
274 Ga0496112_0047765 3300048915 Bacteria 4199
275 Ga0496112_0073600 3300048915 Bacteria 3377
276 Ga0496112_0132764 3300048915 Bacteria 2461
277 Ga0496112_0232529 3300048915 Bacteria 1798
278 Ga0496112_0692634 3300048915 Bacteria 947
279 Ga0496114_0141768 3300048917 Bacteria 2081
280 Ga0496114_0303719 3300048917 Bacteria 1409
281 Ga0496115_0237853 3300048918 Bacteria 1501
282 Ga0496115_0358738 3300048918 Bacteria 1188
283 Ga0501319_002258 3300049535 Bacteria 1207
284 Ga0501325_004093 3300049541 Bacteria 1098
285 Ga0501031_0018358 3300049568 Bacteria 4554
286 Ga0501031_0632598 3300049568 Bacteria 688
287 Ga0501032_0381618 3300049569 Bacteria 906
288 Ga0501034_0005858 3300049571 Bacteria 13370
289 Ga0501034_0098728 3300049571 Bacteria 2915
290 Ga0501034_0468660 3300049571 Bacteria 1176
291 Ga0501036_0031624 3300049572 Bacteria 4473
292 Ga0501036_0416807 3300049572 Bacteria 1120
293 Ga0501038_0095795 3300049574 Bacteria 2479
294 Ga0501039_0020302 3300049575 Bacteria 5093
295 Ga0501039_0028715 3300049575 Bacteria 4283
296 Ga0501040_0072873 3300049576 Bacteria 2372
297 Ga0501040_0231581 3300049576 Bacteria 1316
298 Ga0501040_0816779 3300049576 Bacteria 675
299 Ga0501041_0138557 3300049577 Bacteria 1517
300 Ga0501041_0484402 3300049577 Bacteria 786
301 Ga0501042_0014808 3300049578 Bacteria 5327
302 Ga0501048_0085368 3300049582 Bacteria 2226
303 Ga0501048_0390167 3300049582 Bacteria 995
304 Ga0501069_0000038 3300049585 Bacteria 82519
305 Ga0501070_0000008 3300049586 Bacteria 199963
306 Ga0501071_0011290 3300049587 Bacteria 6012
307 Ga0501071_0028504 3300049587 Bacteria 3937
308 Ga0501071_0129006 3300049587 Bacteria 1878
309 Ga0501071_0465802 3300049587 Bacteria 968
310 Ga0501071_0901481 3300049587 Bacteria 682
311 Ga0501072_0074025 3300049588 Bacteria 2693
312 Ga0501072_0151676 3300049588 Bacteria 1848
313 Ga0501072_0376959 3300049588 Bacteria 1126
314 Ga0501072_0697528 3300049588 Bacteria 798
315 Ga0501074_0436321 3300049590 Bacteria 929
316 Ga0501075_0256044 3300049591 Bacteria 1334
317 Ga0501075_0283289 3300049591 Bacteria 1263
318 Ga0501076_0051682 3300049592 Bacteria 3254
319 Ga0501076_0068976 3300049592 Bacteria 2825
320 Ga0501076_0098198 3300049592 Bacteria 2359
321 Ga0501080_0002411 3300049742 Bacteria 16315
322 Ga0501081_0804445 3300049743 Bacteria 707
323 Ga0501035_0189918 3300049822 Bacteria 1766
324 Ga0501045_0096508 3300049824 Bacteria 2187
325 nmdc:mga0yw44_244491_c1 3300050492 Bacteria 1193
326 nmdc:mga0yw44_64821_c1 3300050492 Bacteria 2249
327 nmdc:mga0yw44_770721_c1 3300050492 Bacteria 653
328 nmdc:mga05p37_1450013_c1 3300050507 Bacteria 687
329 nmdc:mga05p37_780374_c1 3300050507 Bacteria 1049
330 nmdc:mga09592_282624_c1 3300050508 Bacteria 1439
331 nmdc:mga0qj67_821696_c1 3300050509 Bacteria 735
332 nmdc:mga06r32_117800_c1 3300050510 Bacteria 2618
333 nmdc:mga06r32_566527_c1 3300050510 Bacteria 1109
334 nmdc:mga06r32_738034_c1 3300050510 Bacteria 948
335 nmdc:mga08y16_388462_c1 3300050511 Bacteria 1430
336 nmdc:mga08y16_39456_c1 3300050511 Bacteria 4954
337 nmdc:mga0rr50_471071_c1 3300050513 Bacteria 1066
338 nmdc:mga08x19_311660_c1 3300050514 Bacteria 1094
339 nmdc:mga08x19_879608_c1 3300050514 Bacteria 636
340 Ga0495601_0040089 3300053077 Bacteria 2933
341 Ga0495601_0166833 3300053077 Bacteria 1439
342 Ga0495601_0473827 3300053077 Bacteria 809
343 Ga0495612_0423298 3300053078 Bacteria 607
344 Ga0495595_0006990 3300053084 Bacteria 4609
345 Ga0495595_0131502 3300053084 Bacteria 1224
346 Ga0495619_0019500 3300053085 Bacteria 4313
347 Ga0495619_0064728 3300053085 Bacteria 2438
348 Ga0495619_0155956 3300053085 Bacteria 1575
349 Ga0495619_0241109 3300053085 Bacteria 1253
350 Ga0500616_0004221 3300053153 Bacteria 10356
351 Ga0501084_0000133 3300054114 Bacteria 56376
352 Ga0501084_0087611 3300054114 Bacteria 2614
353 Ga0501084_0469372 3300054114 Bacteria 1064
354 Ga0501084_0642942 3300054114 Bacteria 896
355 Ga0501082_0166267 3300060353 Bacteria 1917
356 Ga0501082_0534338 3300060353 Bacteria 1025
357 Ga0501082_0577392 3300060353 Bacteria 984
358 Ga0501082_1336838 3300060353 Bacteria 626
359 Ga0530510_0268720 3300061734 Bacteria 1272
360 Ga0105245_10091339
361 Ga0070658_10000155
362 Ga0070690_100259500
363 Ga0070680_100063378
364 Ga0070682_100150434
365 Ga0070682_100394277
366 Ga0070660_100043279
367 Ga0070689_100301445
368 Ga0070674_101048292
369 Ga0070673_101167296
370 Ga0070688_100324959
371 Ga0070667_100143109
372 Ga0070703_10066616
373 Ga0070701_10401315
374 Ga0070708_100024347
375 Ga0070678_100198359
376 Ga0070678_100241686
377 Ga0070681_10010478
378 Ga0070681_10113137
379 Ga0070681_10113510
380 Ga0070681_10321197
381 Ga0070681_10392552
382 Ga0070681_10765806
383 Ga0070681_10805604
384 Ga0070706_100094868
385 Ga0070706_100289435
386 Ga0070707_100297714
387 Ga0070698_100049652
388 Ga0070699_100345459
389 Ga0070679_100004306
390 Ga0070679_100095534
391 Ga0070679_101014492
392 Ga0070684_100213497
393 Ga0070684_100541603
394 Ga0070684_100712818
395 Ga0070697_100325153
396 Ga0070686_100253357
397 Ga0070695_100315769
398 Ga0070665_100159832
399 Ga0070704_100110634
400 Ga0070704_100479843
401 Ga0068855_101399246
402 Ga0070702_100327098
403 Ga0068859_100934754
404 Ga0068858_100038054
405 Ga0068860_100214446
406 Ga0081455_10096319
407 Ga0081538_10147559
408 Ga0075365_10003029
409 Ga0075365_10123052
410 Ga0075428_100201997
411 Ga0075430_100243388
412 Ga0075431_100625800
413 Ga0075431_100815328
414 Ga0075431_100826940
415 Ga0075436_100398682
416 Ga0097620_100934533
417 Ga0075435_100330876
418 Ga0075435_100486752
419 Ga0111539_10113261
420 Ga0111539_10529853
421 Ga0111539_11087974
422 Ga0105245_10003545
423 Ga0105245_10849906
424 Ga0105245_11169134
425 Ga0105247_10932497
426 Ga0114129_10103098
427 Ga0114129_11095218
428 Ga0114129_11135084
429 Ga0105243_10323814
430 Ga0105242_10044337
431 Ga0105242_10305848
432 Ga0105242_10401764
433 Ga0105242_10652898
434 Ga0105238_10870863
435 Ga0105249_10126299
436 Ga0105249_11576449
437 Ga0105246_10119626
438 Ga0105246_10230475
439 Ga0157373_10504573
440 Ga0157369_10004458
441 Ga0157378_10128995
442 Ga0163162_10493055
443 Ga0157372_10251698
444 Ga0157372_10581442
445 Ga0157372_11347961
446 Ga0157375_11053258
447 Ga0157375_11127778
448 Ga0163163_10787420
449 Ga0157380_10376501
450 Ga0157380_11566576
451 Ga0157379_10983072
452 Ga0182005_1049058
453 Ga0197907_10568880
454 Ga0197907_10648649
455 Ga0206355_1578167
456 Ga0206354_11058076
457 Ga0206354_11653423
458 Ga0206353_11242615
459 Ga0213876_10271653
460 Ga0224712_10189278
461 Ga0224712_10193472
462 Ga0224712_10249455
463 Ga0224572_1003489
464 Ga0207653_10030695
465 Ga0207645_10035143
466 Ga0207645_10122073
467 Ga0207645_10306490
468 Ga0207705_10000819
469 Ga0207705_10069798
470 Ga0207705_10126628
471 Ga0207705_10164063
472 Ga0207705_10219104
473 Ga0207684_10021460
474 Ga0207707_10023087
475 Ga0207707_10042099
476 Ga0207671_10280451
477 Ga0207693_10072195
478 Ga0207660_10046162
479 Ga0207657_10085497
480 Ga0207657_10370645
481 Ga0207652_10001621
482 Ga0207646_10308368
483 Ga0207687_10057980
484 Ga0207687_10212898
485 Ga0207687_10508162
486 Ga0207664_10202097
487 Ga0207664_11018027
488 Ga0207644_10026787
489 Ga0207690_10009412
490 Ga0207686_10172727
491 Ga0207686_10249775
492 Ga0207686_10291077
493 Ga0207686_11037344
494 Ga0207709_10193483
495 Ga0207670_10355799
496 Ga0207669_10842283
497 Ga0207665_10375445
498 Ga0207691_10564568
499 Ga0207691_11092482
500 Ga0207658_10356387
501 Ga0207658_10440677
502 Ga0207703_10027415
503 Ga0207676_10391259
504 Ga0207683_10065646
505 Ga0207683_10349961
506 Ga0268266_10057480
507 Ga0268264_11586488
508 Ga0265338_10000266
509 Ga0265760_10047498
510 Ga0265760_10132770
511 Ga0265325_10000424
512 Ga0265339_10001337
513 Ga0265339_10156673
514 Ga0265327_10005704
515 Ga0265327_10007617
516 Ga0307408_100223457
517 Ga0265313_10000539
518 Ga0265314_10057439
519 Ga0265314_10274878
520 Ga0265314_10372718
521 Ga0307413_10307745
522 Ga0307407_10439884
523 Ga0307416_100475213
524 Ga0307416_101063555
525 Ga0307416_101139046
526 Ga0373959_0061342
527 Ga0373944_0185646
528 Ga0373954_0146467
529 Ga0373956_0066766
530 Ga0373957_0275674
531 Ga0373943_0104047
532 Ga0373961_0278898
533 Ga0316574_0014934
534 Ga0373931_0617383
535 Ga0373935_0665868
536 Ga0373935_0666675
537 Ga0373933_0020841
538 Ga0373933_0332809
539 Ga0373947_0551083
540 Ga0373947_0631054
541 Ga0373937_0006968
542 Ga0373937_0228548
543 Ga0373937_0436559
544 Ga0372808_003263
545 Ga0316584_0164086
546 Ga0373925_0356938
547 Ga0436364_1481876
548 Ga0400483_062577
549 Ga0400483_201997
550 Ga0436365_0869254
551 Ga0436365_1383758
552 Ga0436365_1495429
553 Ga0436360_0172373
554 Ga0436360_0536144
555 Ga0436363_0746236
556 Ga0436363_1569326
557 Ga0436362_0214187
558 Ga0436362_0367336
559 Ga0436362_0378620
560 Ga0436362_0847926
561 Ga0451807_2293950
562 Ga0451837_0544236
563 Ga0439432_044482
564 Ga0439452_039312
565 Ga0450923_034241
566 Ga0439446_0150209
567 Ga0439434_0042476
568 Ga0466965_0161801
569 Ga0466966_0132242
570 Ga0466966_0213081
571 Ga0466961_0009131
572 Ga0466961_0084114
573 Ga0466961_0120678
574 Ga0466961_0120739
575 Ga0466963_0249348
576 Ga0466968_0108855
577 Ga0466957_0163576
578 Ga0466959_0309154
579 Ga0466958_0024082
580 Ga0466958_0033617
581 Ga0466967_1747936
582 Ga0495603_0405878
583 Ga0495603_0443877
584 Ga0495629_0155371
585 Ga0495653_0230424
586 Ga0495582_0237665
587 Ga0495664_0360491
588 Ga0495584_0229395
589 Ga0495618_0246535
590 Ga0495628_0263886
591 Ga0495628_0781242
592 Ga0495630_0771072
593 Ga0495652_0243250
594 Ga0495652_0449670
595 Ga0495640_0591293
596 Ga0495587_0028579
597 Ga0495621_0017771
598 Ga0495645_0383512
599 Ga0495667_0001375
600 Ga0495656_0269342
601 Ga0495635_0032097
602 Ga0495635_0148977
603 Ga0495588_0074116
604 Ga0495657_0019474
605 Ga0495657_0108084
606 Ga0495623_0014853
607 Ga0495658_0226005
608 Ga0495613_0059575
609 Ga0495600_0060320
610 Ga0495600_0372163
611 Ga0495600_0404730
612 Ga0495581_0217210
613 Ga0495604_0175132
614 Ga0495604_0486545
615 Ga0495674_0379644
616 Ga0495680_0061185
617 Ga0495680_0776995
618 Ga0495684_0131973
619 Ga0495602_0045818
620 Ga0495614_0311585
621 Ga0496102_0577236
622 Ga0496103_0338150
623 Ga0496104_0582805
624 Ga0496108_0097886
625 Ga0496108_0898933
626 Ga0496108_1161076
627 Ga0496109_0027945
628 Ga0496109_0817869
629 Ga0496109_0978276
630 Ga0496110_0627945
631 Ga0496110_1736169
632 Ga0496111_0086006
633 Ga0496112_0047765
634 Ga0496112_0073600
635 Ga0496112_0132764
636 Ga0496112_0232529
637 Ga0496112_0692634
638 Ga0496114_0141768
639 Ga0496114_0303719
640 Ga0496115_0237853
641 Ga0496115_0358738
642 Ga0501319_002258
643 Ga0501325_004093
644 Ga0501031_0018358
645 Ga0501031_0632598
646 Ga0501032_0381618
647 Ga0501034_0005858
648 Ga0501034_0098728
649 Ga0501034_0468660
650 Ga0501036_0031624
651 Ga0501036_0416807
652 Ga0501038_0095795
653 Ga0501039_0020302
654 Ga0501039_0028715
655 Ga0501040_0072873
656 Ga0501040_0231581
657 Ga0501040_0816779
658 Ga0501041_0138557
659 Ga0501041_0484402
660 Ga0501042_0014808
661 Ga0501048_0085368
662 Ga0501048_0390167
663 Ga0501069_0000038
664 Ga0501070_0000008
665 Ga0501071_0011290
666 Ga0501071_0028504
667 Ga0501071_0129006
668 Ga0501071_0465802
669 Ga0501071_0901481
670 Ga0501072_0074025
671 Ga0501072_0151676
672 Ga0501072_0376959
673 Ga0501072_0697528
674 Ga0501074_0436321
675 Ga0501075_0256044
676 Ga0501075_0283289
677 Ga0501076_0051682
678 Ga0501076_0068976
679 Ga0501076_0098198
680 Ga0501080_0002411
681 Ga0501081_0804445
682 Ga0501035_0189918
683 Ga0501045_0096508
684 nmdc:mga0yw44_244491_c1
685 nmdc:mga0yw44_64821_c1
686 nmdc:mga0yw44_770721_c1
687 nmdc:mga05p37_1450013_c1
688 nmdc:mga05p37_780374_c1
689 nmdc:mga09592_282624_c1
690 nmdc:mga0qj67_821696_c1
691 nmdc:mga06r32_117800_c1
692 nmdc:mga06r32_566527_c1
693 nmdc:mga06r32_738034_c1
694 nmdc:mga08y16_388462_c1
695 nmdc:mga08y16_39456_c1
696 nmdc:mga0rr50_471071_c1
697 nmdc:mga08x19_311660_c1
698 nmdc:mga08x19_879608_c1
699 Ga0495601_0040089
700 Ga0495601_0166833
701 Ga0495601_0473827
702 Ga0495612_0423298
703 Ga0495595_0006990
704 Ga0495595_0131502
705 Ga0495619_0019500
706 Ga0495619_0064728
707 Ga0495619_0155956
708 Ga0495619_0241109
709 Ga0500616_0004221
710 Ga0501084_0000133
711 Ga0501084_0087611
712 Ga0501084_0469372
713 Ga0501084_0642942
714 Ga0501082_0166267
715 Ga0501082_0534338
716 Ga0501082_0577392
717 Ga0501082_1336838
718 Ga0530510_0268720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09285

Elong-fact-P_C

Elongation factor P, C-terminal

132

187

0.99

PF08207

EFP_N

Elongation factor P (EF-P) KOW-like domain

5

62

0.98

PF01132

EFP

Elongation factor P (EF-P) OB domain

70

123

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v6a-assembly2.cif.gz_CV structure of ef-p bound to the 70s ribosome. 0.9446 1 185
4v6a-assembly2.cif.gz_CV structure of ef-p bound to the 70s ribosome. 0.9395 1 185
3a5z-assembly2.cif.gz_F crystal structure of escherichia coli genx in complex with elongation factor p 0.9381 1 59
3a5z-assembly2.cif.gz_H crystal structure of escherichia coli genx in complex with elongation factor p 0.9372 1 185
5j3b-assembly1.cif.gz_A structure of translation elongation factor p from acinetobacter baumannii 0.9326 2 185
ID Description Score Start End Superfamily
af_P9WNM3_64_126_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9743 64 126 2.40.50.140
5j3bA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9739 129 185 2.40.50.140
af_Q2QYK4_39_108_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9699 2 63 2.30.30.30
af_I1JVU1_64_124_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9689 2 61 2.30.30.30
5j3bB01 Mainly Beta;Roll;SH3 type barrels.; 0.9642 1 63 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A7V9F6L7-F1-model_v4 Elongation factor P 0.9825 1 137 GO:0003746
GO:0005737
AF-A8LE05-F1-model_v4 Elongation factor P (EF-P) 0.9811 1 186 GO:0003746
GO:0005737
GO:0043043
AF-A0A1R4ISP4-F1-model_v4 Elongation factor P (EF-P) 0.9811 1 186 GO:0003746
GO:0005737
GO:0043043
AF-A0A6H9YGU9-F1-model_v4 Elongation factor P (EF-P) 0.981 1 185 GO:0003746
GO:0005737
GO:0043043
AF-A0A7K1UKR8-F1-model_v4 Elongation factor P (EF-P) 0.9807 1 186 GO:0003746
GO:0005737
GO:0043043

Map