F421451

General Info

Members Datasets Scaffolds Average Seq Length
359 175 359 116

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10100992|Ga0070681_101009922
Length 141
Sequence MISALYFMLTLGAWLLNLDFTSYFSQMTVYGITNCNTVKKALDWLKENNIKYAFHDFKKLGISEEKLNEWDKKAGFEKFLNKQGLTWKQLDPQIKVSVKTNTDALKLLREKTSMIKRPVIEDNGFLFFGFDEEVYHNHFGK

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
125 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
126 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
127 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
144 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
145 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
146 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
159 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
165 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
166 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
167 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
168 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
169 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
170 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
171 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
172 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
173 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
174 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
175 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.03
Nodule 0
Rhizoplane 0.84
Rhizosphere 84.4
Stem 0
Stem Tuber 0
Unclassified 4.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1003095 3300001904 Bacteria 2901
2 JGI24741J21665_1027162 3300001915 Unclassified 869
3 JGI24740J21852_10018282 3300001979 Bacteria 2491
4 JGI24737J22298_10000098 3300001990 Bacteria 25831
5 JGI24735J21928_10000009 3300002067 Bacteria 247425
6 JGI24735J21928_10000036 3300002067 Bacteria 65596
7 JGI24735J21928_10038630 3300002067 Bacteria 1396
8 JGI24744J21845_10005483 3300002077 Bacteria 2626
9 JGI25162J39368_1000005 3300002737 Bacteria 435925
10 JGI25162J39368_1000383 3300002737 Bacteria 37576
11 JGI25162J39368_1000527 3300002737 Bacteria 28507
12 JGI25164J39214_1000502 3300002772 Bacteria 19101
13 JGI25165J46597_1000435 3300003214 Bacteria 42373
14 rootH2_10002127 3300003320 Bacteria 66384
15 rootH2_10024209 3300003320 Bacteria 4196
16 rootH2_10073956 3300003320 Bacteria 3903
17 rootH2_10145839 3300003320 Bacteria 2084
18 rootL2_10101326 3300003322 Bacteria 1872
19 rootH1_10230029 3300003323 Bacteria 3154
20 Ga0055529_1013554 3300003763 Unclassified 1037
21 Ga0065714_10011202 3300005288 Bacteria 3767
22 Ga0070658_10071432 3300005327 Bacteria 2843
23 Ga0070658_10342314 3300005327 Unclassified 1279
24 Ga0070658_10605162 3300005327 Unclassified 950
25 Ga0070658_11429758 3300005327 Bacteria 600
26 Ga0070676_10000283 3300005328 Bacteria 22555
27 Ga0068868_100030589 3300005338 Bacteria 4129
28 Ga0068868_100077234 3300005338 Bacteria 2664
29 Ga0070660_100089376 3300005339 Bacteria 2427
30 Ga0070660_100207227 3300005339 Bacteria 1591
31 Ga0070661_100363150 3300005344 Unclassified 1138
32 Ga0070671_100024558 3300005355 Bacteria 4936
33 Ga0070674_100548912 3300005356 Bacteria 969
34 Ga0070659_100000465 3300005366 Bacteria 29940
35 Ga0070659_100049237 3300005366 Bacteria 3313
36 Ga0070663_100118845 3300005455 Bacteria 1994
37 Ga0070678_100008034 3300005456 Bacteria 6291
38 Ga0070662_100001823 3300005457 Bacteria 13070
39 Ga0070681_10100992 3300005458 Bacteria 2830
40 Ga0070681_10748826 3300005458 Bacteria 894
41 Ga0068867_100000696 3300005459 Bacteria 22392
42 Ga0070679_100004019 3300005530 Bacteria 13550
43 Ga0070679_100964313 3300005530 Bacteria 796
44 Ga0070679_101096364 3300005530 Bacteria 741
45 Ga0070684_102371938 3300005535 Bacteria 500
46 Ga0068853_100028092 3300005539 Unclassified 4731
47 Ga0068853_100194461 3300005539 Bacteria 1844
48 Ga0068853_100576138 3300005539 Bacteria 1068
49 Ga0068853_101369407 3300005539 Bacteria 684
50 Ga0070672_100059409 3300005543 Bacteria 3008
51 Ga0070665_100000096 3300005548 Bacteria 166864
52 Ga0068855_100003097 3300005563 Bacteria 20360
53 Ga0068855_100003604 3300005563 Bacteria 18925
54 Ga0068855_100023475 3300005563 Bacteria 7386
55 Ga0068855_100250869 3300005563 Bacteria 1974
56 Ga0068855_100859333 3300005563 Bacteria 961
57 Ga0068857_100040426 3300005577 Bacteria 4135
58 Ga0068857_100378182 3300005577 Bacteria 1315
59 Ga0068857_100416992 3300005577 Bacteria 1251
60 Ga0068857_101024579 3300005577 Bacteria 795
61 Ga0068854_101483937 3300005578 Bacteria 615
62 Ga0068856_100000164 3300005614 Bacteria 68790
63 Ga0068856_100282607 3300005614 Bacteria 1676
64 Ga0068856_100612956 3300005614 Bacteria 1109
65 Ga0068856_101012040 3300005614 Bacteria 849
66 Ga0068852_100184469 3300005616 Bacteria 1964
67 Ga0068852_101241904 3300005616 Bacteria 766
68 Ga0068852_101391598 3300005616 Bacteria 723
69 Ga0068866_10023241 3300005718 Bacteria 2881
70 Ga0068866_10560440 3300005718 Unclassified 765
71 Ga0068870_10360505 3300005840 Bacteria 935
72 Ga0068863_101429734 3300005841 Bacteria 699
73 Ga0068858_100512063 3300005842 Bacteria 1160
74 Ga0075366_10000170 3300006195 Bacteria 27881
75 Ga0075366_10008109 3300006195 Bacteria 5826
76 Ga0075366_10038634 3300006195 Bacteria 2820
77 Ga0075366_10725671 3300006195 Bacteria 617
78 Ga0097621_100001557 3300006237 Bacteria 15672
79 Ga0097621_100928984 3300006237 Bacteria 811
80 Ga0097621_101064346 3300006237 Bacteria 758
81 Ga0075370_10140591 3300006353 Bacteria 1411
82 Ga0075370_10552812 3300006353 Bacteria 696
83 Ga0068871_100001732 3300006358 Bacteria 14696
84 Ga0068865_100000377 3300006881 Bacteria 24723
85 Ga0068865_100854496 3300006881 Bacteria 788
86 Ga0105240_10002021 3300009093 Bacteria 33455
87 Ga0105240_10008785 3300009093 Bacteria 14391
88 Ga0105240_10015598 3300009093 Bacteria 10324
89 Ga0105240_10028966 3300009093 Bacteria 7222
90 Ga0105240_10115148 3300009093 Bacteria 3246
91 Ga0105240_10248868 3300009093 Unclassified 2057
92 Ga0105240_10275390 3300009093 Bacteria 1936
93 Ga0105240_10572104 3300009093 Bacteria 1247
94 Ga0105240_11150195 3300009093 Bacteria 824
95 Ga0105240_11367976 3300009093 Bacteria 745
96 Ga0105240_12131410 3300009093 Bacteria 582
97 Ga0105245_10233862 3300009098 Bacteria 1778
98 Ga0105245_10307359 3300009098 Bacteria 1558
99 Ga0105243_10053814 3300009148 Unclassified 3193
100 Ga0105241_10002990 3300009174 Bacteria 12621
101 Ga0105241_10074540 3300009174 Bacteria 2643
102 Ga0105241_10193351 3300009174 Bacteria 1695
103 Ga0105241_10287088 3300009174 Bacteria 1407
104 Ga0105241_10306100 3300009174 Bacteria 1365
105 Ga0105242_10073991 3300009176 Bacteria 2834
106 Ga0105237_10000762 3300009545 Bacteria 44209
107 Ga0105237_10001136 3300009545 Bacteria 35738
108 Ga0105237_10008171 3300009545 Bacteria 11369
109 Ga0105237_10008218 3300009545 Bacteria 11333
110 Ga0105237_10008779 3300009545 Bacteria 10902
111 Ga0105237_10313934 3300009545 Bacteria 1571
112 Ga0105237_10588050 3300009545 Bacteria 1120
113 Ga0105237_10716814 3300009545 Bacteria 1007
114 Ga0105237_11204401 3300009545 Bacteria 764
115 Ga0105238_10003629 3300009551 Bacteria 15388
116 Ga0105238_10092340 3300009551 Bacteria 3015
117 Ga0105238_12554036 3300009551 Bacteria 547
118 Ga0105238_12565896 3300009551 Bacteria 546
119 Ga0105239_10000004 3300010375 Bacteria 532483
120 Ga0105239_10000015 3300010375 Bacteria 319892
121 Ga0105239_10000655 3300010375 Bacteria 49317
122 Ga0105239_10004803 3300010375 Bacteria 16040
123 Ga0105239_10012919 3300010375 Bacteria 9289
124 Ga0105239_10026197 3300010375 Bacteria 6417
125 Ga0105239_10074842 3300010375 Bacteria 3723
126 Ga0105239_10144792 3300010375 Bacteria 2649
127 Ga0105239_10154939 3300010375 Bacteria 2558
128 Ga0105246_10248354 3300011119 Bacteria 1411
129 Ga0157373_10009645 3300013100 Bacteria 7125
130 Ga0157373_10573990 3300013100 Unclassified 819
131 Ga0157371_10004364 3300013102 Bacteria 12384
132 Ga0157371_10004859 3300013102 Bacteria 11556
133 Ga0157371_10169604 3300013102 Bacteria 1559
134 Ga0157371_10755840 3300013102 Bacteria 730
135 Ga0157371_11193541 3300013102 Bacteria 586
136 Ga0157370_10013983 3300013104 Bacteria 8241
137 Ga0157370_10601563 3300013104 Unclassified 1007
138 Ga0157370_11277864 3300013104 Bacteria 661
139 Ga0157369_10002582 3300013105 Bacteria 21679
140 Ga0157369_10418939 3300013105 Bacteria 1388
141 Ga0157369_10533992 3300013105 Bacteria 1213
142 Ga0157369_11025223 3300013105 Bacteria 844
143 Ga0157369_11235094 3300013105 Bacteria 762
144 Ga0157374_10012002 3300013296 Bacteria 7522
145 Ga0157374_10038094 3300013296 Bacteria 4418
146 Ga0157374_10670060 3300013296 Bacteria 1050
147 Ga0157374_10732300 3300013296 Bacteria 1003
148 Ga0157374_10797743 3300013296 Bacteria 960
149 Ga0157374_10992753 3300013296 Bacteria 858
150 Ga0157374_11270549 3300013296 Bacteria 758
151 Ga0157374_11978654 3300013296 Bacteria 609
152 Ga0157378_10129392 3300013297 Bacteria 2335
153 Ga0157378_10267338 3300013297 Bacteria 1643
154 Ga0157378_13289017 3300013297 Bacteria 502
155 Ga0163162_10000005 3300013306 Bacteria 447195
156 Ga0163162_10017567 3300013306 Bacteria 7000
157 Ga0163162_10128747 3300013306 Bacteria 2639
158 Ga0157372_10000030 3300013307 Bacteria 179925
159 Ga0157372_10001737 3300013307 Bacteria 23642
160 Ga0157372_10015310 3300013307 Bacteria 8217
161 Ga0157372_10018963 3300013307 Bacteria 7404
162 Ga0157372_10136319 3300013307 Unclassified 2827
163 Ga0157372_10298437 3300013307 Bacteria 1874
164 Ga0157375_10057947 3300013308 Bacteria 3831
165 Ga0157375_10710653 3300013308 Bacteria 1158
166 Ga0157377_10010093 3300014745 Bacteria 4661
167 Ga0157376_11599164 3300014969 Bacteria 686
168 Ga0163161_10004267 3300017792 Bacteria 9967
169 Ga0163161_10787915 3300017792 Bacteria 798
170 Ga0206351_10627478 3300020077 Bacteria 889
171 Ga0207427_100025 3300025231 Bacteria 433726
172 Ga0209437_100010 3300025233 Bacteria 838447
173 Ga0209437_100043 3300025233 Bacteria 440454
174 Ga0209026_1000310 3300025250 Bacteria 52783
175 Ga0209026_1004191 3300025250 Bacteria 4399
176 Ga0209026_1032827 3300025250 Bacteria 766
177 Ga0209129_1006299 3300025258 Bacteria 3886
178 Ga0209233_1000017 3300025261 Bacteria 898076
179 Ga0209233_1000685 3300025261 Bacteria 16074
180 Ga0209233_1006175 3300025261 Bacteria 3882
181 Ga0209233_1020942 3300025261 Bacteria 1704
182 Ga0209455_1003999 3300025272 Bacteria 4994
183 Ga0207642_10023966 3300025899 Bacteria 2447
184 Ga0207647_10000206 3300025904 Bacteria 48374
185 Ga0207647_10002696 3300025904 Bacteria 13406
186 Ga0207647_10058022 3300025904 Bacteria 2371
187 Ga0207647_10141433 3300025904 Bacteria 1410
188 Ga0207645_10000035 3300025907 Bacteria 89345
189 Ga0207643_10453511 3300025908 Bacteria 816
190 Ga0207705_10066674 3300025909 Bacteria 2604
191 Ga0207705_10219097 3300025909 Unclassified 1445
192 Ga0207705_10571397 3300025909 Unclassified 879
193 Ga0207654_10007566 3300025911 Bacteria 5478
194 Ga0207654_10062787 3300025911 Bacteria 2178
195 Ga0207654_10199474 3300025911 Bacteria 1317
196 Ga0207654_11380531 3300025911 Bacteria 514
197 Ga0207707_10636481 3300025912 Unclassified 900
198 Ga0207695_10000142 3300025913 Bacteria 214715
199 Ga0207695_10007936 3300025913 Bacteria 13394
200 Ga0207695_10012264 3300025913 Bacteria 10297
201 Ga0207695_10082657 3300025913 Bacteria 3246
202 Ga0207695_10457407 3300025913 Bacteria 1159
203 Ga0207695_10488929 3300025913 Bacteria 1113
204 Ga0207695_10498381 3300025913 Unclassified 1100
205 Ga0207671_10000110 3300025914 Bacteria 126480
206 Ga0207671_10004130 3300025914 Bacteria 14037
207 Ga0207671_10005696 3300025914 Bacteria 11383
208 Ga0207671_10012608 3300025914 Bacteria 6789
209 Ga0207671_10022184 3300025914 Bacteria 4804
210 Ga0207671_11432140 3300025914 Bacteria 535
211 Ga0207660_10007385 3300025917 Bacteria 7111
212 Ga0207657_10094397 3300025919 Bacteria 2491
213 Ga0207657_10192820 3300025919 Bacteria 1643
214 Ga0207649_10654949 3300025920 Unclassified 812
215 Ga0207652_10013033 3300025921 Bacteria 6729
216 Ga0207652_10874541 3300025921 Bacteria 795
217 Ga0207694_10180922 3300025924 Bacteria 1710
218 Ga0207644_10009586 3300025931 Bacteria 6358
219 Ga0207690_10000669 3300025932 Bacteria 21955
220 Ga0207690_10108059 3300025932 Bacteria 1999
221 Ga0207706_10000246 3300025933 Bacteria 59254
222 Ga0207706_10267228 3300025933 Bacteria 1493
223 Ga0207709_10011898 3300025935 Unclassified 4800
224 Ga0207669_10503522 3300025937 Bacteria 969
225 Ga0207704_10002980 3300025938 Bacteria 7656
226 Ga0207704_10435533 3300025938 Bacteria 1043
227 Ga0207704_10839086 3300025938 Bacteria 769
228 Ga0207665_10717831 3300025939 Bacteria 786
229 Ga0207691_10075943 3300025940 Bacteria 3028
230 Ga0207667_10000266 3300025949 Bacteria 72382
231 Ga0207667_10001136 3300025949 Bacteria 33505
232 Ga0207667_10018471 3300025949 Bacteria 7818
233 Ga0207667_10039320 3300025949 Bacteria 5042
234 Ga0207667_10049435 3300025949 Bacteria 4441
235 Ga0207667_10231097 3300025949 Bacteria 1894
236 Ga0207667_11103862 3300025949 Bacteria 776
237 Ga0207651_10203052 3300025960 Bacteria 1590
238 Ga0207677_10074138 3300026023 Bacteria 2413
239 Ga0207677_10100189 3300026023 Bacteria 2129
240 Ga0207703_11413327 3300026035 Bacteria 669
241 Ga0207639_10589208 3300026041 Bacteria 1024
242 Ga0207639_10967303 3300026041 Bacteria 797
243 Ga0207639_11872496 3300026041 Bacteria 561
244 Ga0207678_10213285 3300026067 Bacteria 1652
245 Ga0207702_10000262 3300026078 Bacteria 60584
246 Ga0207702_10529496 3300026078 Bacteria 1151
247 Ga0207641_11385911 3300026088 Bacteria 704
248 Ga0207648_10004436 3300026089 Bacteria 14401
249 Ga0207674_10120082 3300026116 Bacteria 2597
250 Ga0207674_10422473 3300026116 Bacteria 1288
251 Ga0207683_10015828 3300026121 Bacteria 6421
252 Ga0207698_10178811 3300026142 Bacteria 1877
253 Ga0207698_11239168 3300026142 Bacteria 760
254 Ga0268266_10000032 3300028379 Bacteria 395079
255 Ga0307517_10004407 3300028786 Bacteria 21615
256 Ga0307515_10001308 3300028794 Bacteria 56577
257 Ga0307515_10059546 3300028794 Bacteria 5470
258 Ga0265338_10026846 3300028800 Bacteria 5794
259 Ga0265338_10282331 3300028800 Bacteria 1213
260 Ga0307509_10393926 3300031507 Bacteria 1094
261 Ga0307516_10734271 3300031730 Bacteria 646
262 Ga0307412_11364502 3300031911 Unclassified 640
263 Ga0307507_10000309 3300033179 Bacteria 98028
264 Ga0307510_10000366 3300033180 Bacteria 42784
265 Ga0395899_0000034 3300037312 Bacteria 302623
266 Ga0395899_0000199 3300037312 Bacteria 87960
267 Ga0395899_0000201 3300037312 Bacteria 87516
268 Ga0395900_0000157 3300037418 Bacteria 112131
269 Ga0395900_0607078 3300037418 Bacteria 1034
270 Ga0395898_0003116 3300037466 Bacteria 18720
271 Ga0395905_0000195 3300037471 Bacteria 95130
272 Ga0395905_1002887 3300037471 Bacteria 738
273 Ga0395901_0000283 3300038443 Bacteria 62908
274 Ga0395901_0120011 3300038443 Bacteria 2763
275 Ga0436361_0401394 3300039447 Bacteria 4019
276 Ga0436361_0572910 3300039447 Bacteria 677
277 Ga0451793_0547719 3300041452 Bacteria 506
278 Ga0451795_0883339 3300041456 Bacteria 595
279 Ga0451807_1676689 3300041486 Bacteria 588
280 Ga0451851_1268722 3300041507 Bacteria 596
281 Ga0466969_0069927 3300044656 Bacteria 1689
282 Ga0466966_0019674 3300044684 Bacteria 4441
283 Ga0466966_0153009 3300044684 Bacteria 1406
284 Ga0466961_0096596 3300044693 Bacteria 1863
285 Ga0466959_0414009 3300045049 Bacteria 915
286 Ga0466958_0097949 3300045836 Bacteria 1820
287 Ga0495592_0161769 3300046454 Bacteria 1540
288 Ga0495641_0534216 3300046461 Bacteria 535
289 Ga0495651_0227333 3300046462 Bacteria 1287
290 Ga0495650_0000447 3300046471 Bacteria 65735
291 Ga0495650_0033928 3300046471 Bacteria 2265
292 Ga0495585_0000116 3300046492 Bacteria 86272
293 Ga0495585_0000658 3300046492 Bacteria 31746
294 Ga0495596_0104241 3300046500 Bacteria 1101
295 Ga0495583_0079273 3300046506 Bacteria 1429
296 Ga0495606_0000844 3300046507 Bacteria 46120
297 Ga0495606_0004887 3300046507 Bacteria 13131
298 Ga0495606_0005006 3300046507 Bacteria 12923
299 Ga0495606_0018248 3300046507 Bacteria 5270
300 Ga0495606_0152378 3300046507 Bacteria 1356
301 Ga0495610_0025468 3300046512 Bacteria 3174
302 Ga0495616_0000538 3300046513 Bacteria 28605
303 Ga0495616_0003682 3300046513 Bacteria 9787
304 Ga0495631_0036199 3300046518 Bacteria 2205
305 Ga0495631_0148678 3300046518 Bacteria 1005
306 Ga0495644_0011232 3300046523 Bacteria 3451
307 Ga0495648_0014307 3300046524 Bacteria 5816
308 Ga0495648_0063408 3300046524 Bacteria 2182
309 Ga0495642_0264928 3300046528 Bacteria 752
310 Ga0495652_0153469 3300046529 Bacteria 1796
311 Ga0495652_0256565 3300046529 Bacteria 1293
312 Ga0495609_0017608 3300046538 Bacteria 3317
313 Ga0495633_0000026 3300046558 Bacteria 204722
314 Ga0495633_0003682 3300046558 Bacteria 10122
315 Ga0495668_0000054 3300046616 Bacteria 203960
316 Ga0495611_0023748 3300046648 Bacteria 2663
317 Ga0495625_0000972 3300046660 Bacteria 38083
318 Ga0495625_0003592 3300046660 Bacteria 15260
319 Ga0495625_0006420 3300046660 Bacteria 10472
320 Ga0495625_0066711 3300046660 Bacteria 2534
321 Ga0495625_0111254 3300046660 Bacteria 1872
322 Ga0495625_0220855 3300046660 Bacteria 1242
323 Ga0495661_0007204 3300046665 Bacteria 7757
324 Ga0495661_0017852 3300046665 Bacteria 4677
325 Ga0495661_0019448 3300046665 Bacteria 4450
326 Ga0495661_0300965 3300046665 Bacteria 802
327 Ga0495661_0507618 3300046665 Unclassified 574
328 Ga0495670_0114476 3300046691 Bacteria 1398
329 Ga0495649_0000014 3300046694 Bacteria 287408
330 Ga0495660_0021758 3300046810 Bacteria 3668
331 Ga0495660_0096988 3300046810 Bacteria 1523
332 Ga0495687_001035 3300047443 Bacteria 27615
333 Ga0495687_001403 3300047443 Bacteria 22225
334 Ga0495677_0022844 3300047445 Bacteria 2270
335 Ga0495685_038870 3300047447 Bacteria 1629
336 Ga0495673_0018223 3300047469 Bacteria 3547
337 Ga0495686_0000913 3300047472 Bacteria 37043
338 Ga0495686_0032008 3300047472 Bacteria 3406
339 Ga0495686_0099175 3300047472 Bacteria 1759
340 Ga0495686_0124677 3300047472 Unclassified 1532
341 Ga0495686_0134197 3300047472 Bacteria 1465
342 Ga0495686_0190269 3300047472 Unclassified 1183
343 Ga0495686_0255454 3300047472 Bacteria 983
344 Ga0495678_005816 3300049459 Bacteria 6687
345 nmdc:mga0k408_6028_c1 3300050493 Bacteria 6461
346 nmdc:mga0k408_82_c1 3300050493 Bacteria 45008
347 nmdc:mga07m45_172446_c1 3300050496 Bacteria 1257
348 nmdc:mga07m45_397544_c1 3300050496 Bacteria 800
349 Ga0500635_0007513 3300053080 Bacteria 2957
350 Ga0500594_0340618 3300053118 Bacteria 505
351 Ga0500608_005547 3300053122 Bacteria 5030
352 Ga0500614_048793 3300053123 Bacteria 1104
353 Ga0500618_000005 3300053125 Bacteria 253092
354 Ga0500642_0106188 3300053130 Bacteria 1309
355 Ga0500564_175839 3300053138 Bacteria 896
356 Ga0500616_0164664 3300053153 Bacteria 1013
357 Ga0500622_0002780 3300053156 Bacteria 12301
358 Ga0500624_000133 3300053157 Bacteria 32143
359 Ga0500634_0140251 3300053161 Bacteria 1146

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002737 JGI25162J39368_1000383 JGI25162J39368_100038317 114
2 3300002772 JGI25164J39214_1000502 JGI25164J39214_10005021 114
3 3300003214 JGI25165J46597_1000435 JGI25165J46597_100043527 114
4 3300003320 rootH2_10024209 rootH2_100242094 114
5 3300005288 Ga0065714_10011202 Ga0065714_100112023 114
6 3300005327 Ga0070658_10071432 Ga0070658_100714322 114
7 3300005327 Ga0070658_11429758 Ga0070658_114297581 114
8 3300005339 Ga0070660_100207227 Ga0070660_1002072272 114
9 3300005366 Ga0070659_100000465 Ga0070659_1000004652 114
10 3300005530 Ga0070679_100964313 Ga0070679_1009643132 114
11 3300005614 Ga0068856_100000164 Ga0068856_10000016411 114
12 3300005616 Ga0068852_100184469 Ga0068852_1001844692 114
13 3300009093 Ga0105240_10275390 Ga0105240_102753902 114
14 3300009545 Ga0105237_10313934 Ga0105237_103139342 114
15 3300013296 Ga0157374_10038094 Ga0157374_100380942 114
16 3300013296 Ga0157374_10797743 Ga0157374_107977432 114
17 3300013296 Ga0157374_10992753 Ga0157374_109927532 114
18 3300025231 Ga0207427_100025 Ga0207427_100025356 114
19 3300025233 Ga0209437_100010 Ga0209437_100010618 114
20 3300025261 Ga0209233_1000017 Ga0209233_1000017631 114
21 3300025909 Ga0207705_10066674 Ga0207705_100666742 114
22 3300025913 Ga0207695_10498381 Ga0207695_104983812 114
23 3300025919 Ga0207657_10192820 Ga0207657_101928202 114
24 3300025921 Ga0207652_10874541 Ga0207652_108745412 114
25 3300025932 Ga0207690_10000669 Ga0207690_1000066913 114
26 3300025949 Ga0207667_10000266 Ga0207667_1000026667 114
27 3300026078 Ga0207702_10000262 Ga0207702_1000026250 114
28 3300026142 Ga0207698_10178811 Ga0207698_101788112 114
29 3300028794 Ga0307515_10059546 Ga0307515_100595466 114
30 3300028800 Ga0265338_10026846 Ga0265338_100268463 114
31 3300047472 Ga0495686_0124677 Ga0495686_0124677_549_893 114
32 3300001904 JGI24736J21556_1003095 JGI24736J21556_10030952 115
33 3300001915 JGI24741J21665_1027162 JGI24741J21665_10271622 115
34 3300001979 JGI24740J21852_10018282 JGI24740J21852_100182822 115
35 3300001990 JGI24737J22298_10000098 JGI24737J22298_100000988 115
36 3300002067 JGI24735J21928_10000009 JGI24735J21928_1000000920 115
37 3300002067 JGI24735J21928_10000036 JGI24735J21928_1000003665 115
38 3300002067 JGI24735J21928_10038630 JGI24735J21928_100386302 115
39 3300002077 JGI24744J21845_10005483 JGI24744J21845_100054831 115
40 3300002737 JGI25162J39368_1000005 JGI25162J39368_1000005393 115
41 3300002737 JGI25162J39368_1000527 JGI25162J39368_100052715 115
42 3300003320 rootH2_10002127 rootH2_1000212716 115
43 3300003320 rootH2_10073956 rootH2_100739562 115
44 3300003320 rootH2_10145839 rootH2_101458392 115
45 3300003322 rootL2_10101326 rootL2_101013261 115
46 3300003323 rootH1_10230029 rootH1_102300293 115
47 3300003763 Ga0055529_1013554 Ga0055529_10135541 115
48 3300005327 Ga0070658_10342314 Ga0070658_103423142 115
49 3300005327 Ga0070658_10605162 Ga0070658_106051622 115
50 3300005328 Ga0070676_10000283 Ga0070676_100002838 115
51 3300005338 Ga0068868_100030589 Ga0068868_1000305892 115
52 3300005338 Ga0068868_100077234 Ga0068868_1000772342 115
53 3300005339 Ga0070660_100089376 Ga0070660_1000893762 115
54 3300005344 Ga0070661_100363150 Ga0070661_1003631502 115
55 3300005355 Ga0070671_100024558 Ga0070671_1000245584 115
56 3300005356 Ga0070674_100548912 Ga0070674_1005489121 115
57 3300005366 Ga0070659_100049237 Ga0070659_1000492373 115
58 3300005455 Ga0070663_100118845 Ga0070663_1001188451 115
59 3300005456 Ga0070678_100008034 Ga0070678_1000080343 115
60 3300005457 Ga0070662_100001823 Ga0070662_1000018232 115
61 3300005458 Ga0070681_10100992 Ga0070681_101009922 115
62 3300005458 Ga0070681_10748826 Ga0070681_107488262 115
63 3300005459 Ga0068867_100000696 Ga0068867_10000069614 115
64 3300005530 Ga0070679_100004019 Ga0070679_1000040192 115
65 3300005530 Ga0070679_101096364 Ga0070679_1010963642 115
66 3300005535 Ga0070684_102371938 Ga0070684_1023719381 115
67 3300005539 Ga0068853_100028092 Ga0068853_1000280922 115
68 3300005539 Ga0068853_100194461 Ga0068853_1001944612 115
69 3300005539 Ga0068853_100576138 Ga0068853_1005761382 115
70 3300005539 Ga0068853_101369407 Ga0068853_1013694072 115
71 3300005543 Ga0070672_100059409 Ga0070672_1000594092 115
72 3300005548 Ga0070665_100000096 Ga0070665_100000096134 115
73 3300005563 Ga0068855_100003097 Ga0068855_10000309711 115
74 3300005563 Ga0068855_100003604 Ga0068855_1000036048 115
75 3300005563 Ga0068855_100023475 Ga0068855_1000234756 115
76 3300005563 Ga0068855_100250869 Ga0068855_1002508692 115
77 3300005563 Ga0068855_100859333 Ga0068855_1008593331 115
78 3300005577 Ga0068857_100040426 Ga0068857_1000404265 115
79 3300005577 Ga0068857_100378182 Ga0068857_1003781822 115
80 3300005577 Ga0068857_100416992 Ga0068857_1004169922 115
81 3300005577 Ga0068857_101024579 Ga0068857_1010245792 115
82 3300005578 Ga0068854_101483937 Ga0068854_1014839372 115
83 3300005614 Ga0068856_100282607 Ga0068856_1002826072 115
84 3300005614 Ga0068856_100612956 Ga0068856_1006129562 115
85 3300005614 Ga0068856_101012040 Ga0068856_1010120402 115
86 3300005616 Ga0068852_101241904 Ga0068852_1012419041 115
87 3300005616 Ga0068852_101391598 Ga0068852_1013915981 115
88 3300005718 Ga0068866_10023241 Ga0068866_100232412 115
89 3300005718 Ga0068866_10560440 Ga0068866_105604402 115
90 3300005840 Ga0068870_10360505 Ga0068870_103605052 115
91 3300005841 Ga0068863_101429734 Ga0068863_1014297341 115
92 3300005842 Ga0068858_100512063 Ga0068858_1005120631 115
93 3300006195 Ga0075366_10000170 Ga0075366_1000017026 115
94 3300006195 Ga0075366_10008109 Ga0075366_100081094 115
95 3300006195 Ga0075366_10038634 Ga0075366_100386342 115
96 3300006195 Ga0075366_10725671 Ga0075366_107256712 115
97 3300006237 Ga0097621_100001557 Ga0097621_10000155714 115
98 3300006237 Ga0097621_100928984 Ga0097621_1009289841 115
99 3300006237 Ga0097621_101064346 Ga0097621_1010643461 115
100 3300006353 Ga0075370_10140591 Ga0075370_101405912 115
101 3300006353 Ga0075370_10552812 Ga0075370_105528122 115
102 3300006358 Ga0068871_100001732 Ga0068871_10000173213 115
103 3300006881 Ga0068865_100000377 Ga0068865_10000037714 115
104 3300006881 Ga0068865_100854496 Ga0068865_1008544962 115
105 3300009093 Ga0105240_10002021 Ga0105240_1000202127 115
106 3300009093 Ga0105240_10008785 Ga0105240_1000878510 115
107 3300009093 Ga0105240_10015598 Ga0105240_100155982 115
108 3300009093 Ga0105240_10028966 Ga0105240_100289662 115
109 3300009093 Ga0105240_10115148 Ga0105240_101151482 115
110 3300009093 Ga0105240_10248868 Ga0105240_102488682 115
111 3300009093 Ga0105240_10572104 Ga0105240_105721042 115
112 3300009093 Ga0105240_11150195 Ga0105240_111501952 115
113 3300009093 Ga0105240_11367976 Ga0105240_113679761 115
114 3300009093 Ga0105240_12131410 Ga0105240_121314101 115
115 3300009098 Ga0105245_10233862 Ga0105245_102338622 115
116 3300009098 Ga0105245_10307359 Ga0105245_103073592 115
117 3300009148 Ga0105243_10053814 Ga0105243_100538143 115
118 3300009174 Ga0105241_10002990 Ga0105241_1000299010 115
119 3300009174 Ga0105241_10074540 Ga0105241_100745402 115
120 3300009174 Ga0105241_10193351 Ga0105241_101933512 115
121 3300009174 Ga0105241_10287088 Ga0105241_102870881 115
122 3300009174 Ga0105241_10306100 Ga0105241_103061001 115
123 3300009176 Ga0105242_10073991 Ga0105242_100739912 115
124 3300009545 Ga0105237_10000762 Ga0105237_100007625 115
125 3300009545 Ga0105237_10001136 Ga0105237_1000113623 115
126 3300009545 Ga0105237_10008171 Ga0105237_100081718 115
127 3300009545 Ga0105237_10008218 Ga0105237_100082181 115
128 3300009545 Ga0105237_10008779 Ga0105237_100087791 115
129 3300009545 Ga0105237_10588050 Ga0105237_105880502 115
130 3300009545 Ga0105237_10716814 Ga0105237_107168142 115
131 3300009545 Ga0105237_11204401 Ga0105237_112044012 115
132 3300009551 Ga0105238_10003629 Ga0105238_100036295 115
133 3300009551 Ga0105238_10092340 Ga0105238_100923402 115
134 3300009551 Ga0105238_12554036 Ga0105238_125540361 115
135 3300009551 Ga0105238_12565896 Ga0105238_125658962 115
136 3300010375 Ga0105239_10000004 Ga0105239_1000000418 115
137 3300010375 Ga0105239_10000015 Ga0105239_10000015241 115
138 3300010375 Ga0105239_10000655 Ga0105239_1000065520 115
139 3300010375 Ga0105239_10004803 Ga0105239_100048039 115
140 3300010375 Ga0105239_10012919 Ga0105239_100129194 115
141 3300010375 Ga0105239_10026197 Ga0105239_100261974 115
142 3300010375 Ga0105239_10074842 Ga0105239_100748423 115
143 3300010375 Ga0105239_10144792 Ga0105239_101447922 115
144 3300010375 Ga0105239_10154939 Ga0105239_101549392 115
145 3300011119 Ga0105246_10248354 Ga0105246_102483542 115
146 3300013100 Ga0157373_10009645 Ga0157373_100096457 115
147 3300013100 Ga0157373_10573990 Ga0157373_105739901 115
148 3300013102 Ga0157371_10004364 Ga0157371_100043645 115
149 3300013102 Ga0157371_10004859 Ga0157371_100048594 115
150 3300013102 Ga0157371_10169604 Ga0157371_101696041 115
151 3300013102 Ga0157371_10755840 Ga0157371_107558402 115
152 3300013102 Ga0157371_11193541 Ga0157371_111935411 115
153 3300013104 Ga0157370_10013983 Ga0157370_100139837 115
154 3300013104 Ga0157370_10601563 Ga0157370_106015632 115
155 3300013104 Ga0157370_11277864 Ga0157370_112778641 115
156 3300013105 Ga0157369_10002582 Ga0157369_1000258225 115
157 3300013105 Ga0157369_10418939 Ga0157369_104189392 115
158 3300013105 Ga0157369_10533992 Ga0157369_105339922 115
159 3300013105 Ga0157369_11025223 Ga0157369_110252232 115
160 3300013105 Ga0157369_11235094 Ga0157369_112350942 115
161 3300013296 Ga0157374_10012002 Ga0157374_100120025 115
162 3300013296 Ga0157374_10670060 Ga0157374_106700602 115
163 3300013296 Ga0157374_10732300 Ga0157374_107323002 115
164 3300013296 Ga0157374_11270549 Ga0157374_112705492 115
165 3300013296 Ga0157374_11978654 Ga0157374_119786541 115
166 3300013297 Ga0157378_10129392 Ga0157378_101293922 115
167 3300013297 Ga0157378_10267338 Ga0157378_102673382 115
168 3300013297 Ga0157378_13289017 Ga0157378_132890172 115
169 3300013306 Ga0163162_10000005 Ga0163162_10000005253 115
170 3300013306 Ga0163162_10017567 Ga0163162_100175672 115
171 3300013306 Ga0163162_10128747 Ga0163162_101287472 115
172 3300013307 Ga0157372_10000030 Ga0157372_1000003063 115
173 3300013307 Ga0157372_10001737 Ga0157372_100017373 115
174 3300013307 Ga0157372_10015310 Ga0157372_100153104 115
175 3300013307 Ga0157372_10018963 Ga0157372_100189635 115
176 3300013307 Ga0157372_10136319 Ga0157372_101363192 115
177 3300013307 Ga0157372_10298437 Ga0157372_102984372 115
178 3300013308 Ga0157375_10057947 Ga0157375_100579472 115
179 3300013308 Ga0157375_10710653 Ga0157375_107106532 115
180 3300014745 Ga0157377_10010093 Ga0157377_100100933 115
181 3300014969 Ga0157376_11599164 Ga0157376_115991642 115
182 3300017792 Ga0163161_10004267 Ga0163161_100042677 115
183 3300017792 Ga0163161_10787915 Ga0163161_107879151 115
184 3300020077 Ga0206351_10627478 Ga0206351_106274782 115
185 3300025233 Ga0209437_100043 Ga0209437_10004315 115
186 3300025250 Ga0209026_1000310 Ga0209026_100031012 115
187 3300025250 Ga0209026_1004191 Ga0209026_10041912 115
188 3300025250 Ga0209026_1032827 Ga0209026_10328271 115
189 3300025258 Ga0209129_1006299 Ga0209129_10062992 115
190 3300025261 Ga0209233_1000685 Ga0209233_10006856 115
191 3300025261 Ga0209233_1006175 Ga0209233_10061755 115
192 3300025261 Ga0209233_1020942 Ga0209233_10209422 115
193 3300025272 Ga0209455_1003999 Ga0209455_10039992 115
194 3300025899 Ga0207642_10023966 Ga0207642_100239662 115
195 3300025904 Ga0207647_10000206 Ga0207647_1000020646 115
196 3300025904 Ga0207647_10002696 Ga0207647_1000269611 115
197 3300025904 Ga0207647_10058022 Ga0207647_100580222 115
198 3300025904 Ga0207647_10141433 Ga0207647_101414332 115
199 3300025907 Ga0207645_10000035 Ga0207645_1000003514 115
200 3300025908 Ga0207643_10453511 Ga0207643_104535112 115
201 3300025909 Ga0207705_10219097 Ga0207705_102190972 115
202 3300025909 Ga0207705_10571397 Ga0207705_105713972 115
203 3300025911 Ga0207654_10007566 Ga0207654_100075662 115
204 3300025911 Ga0207654_10062787 Ga0207654_100627872 115
205 3300025911 Ga0207654_10199474 Ga0207654_101994742 115
206 3300025911 Ga0207654_11380531 Ga0207654_113805311 115
207 3300025912 Ga0207707_10636481 Ga0207707_106364812 115
208 3300025913 Ga0207695_10000142 Ga0207695_10000142109 115
209 3300025913 Ga0207695_10007936 Ga0207695_100079366 115
210 3300025913 Ga0207695_10012264 Ga0207695_100122642 115
211 3300025913 Ga0207695_10082657 Ga0207695_100826576 115
212 3300025913 Ga0207695_10457407 Ga0207695_104574072 115
213 3300025913 Ga0207695_10488929 Ga0207695_104889292 115
214 3300025914 Ga0207671_10000110 Ga0207671_1000011090 115
215 3300025914 Ga0207671_10004130 Ga0207671_1000413013 115
216 3300025914 Ga0207671_10005696 Ga0207671_100056961 115
217 3300025914 Ga0207671_10012608 Ga0207671_100126082 115
218 3300025914 Ga0207671_10022184 Ga0207671_100221843 115
219 3300025914 Ga0207671_11432140 Ga0207671_114321401 115
220 3300025917 Ga0207660_10007385 Ga0207660_100073852 115
221 3300025919 Ga0207657_10094397 Ga0207657_100943972 115
222 3300025920 Ga0207649_10654949 Ga0207649_106549492 115
223 3300025921 Ga0207652_10013033 Ga0207652_100130339 115
224 3300025924 Ga0207694_10180922 Ga0207694_101809222 115
225 3300025931 Ga0207644_10009586 Ga0207644_100095862 115
226 3300025932 Ga0207690_10108059 Ga0207690_101080593 115
227 3300025933 Ga0207706_10000246 Ga0207706_100002462 115
228 3300025933 Ga0207706_10267228 Ga0207706_102672282 115
229 3300025935 Ga0207709_10011898 Ga0207709_100118982 115
230 3300025937 Ga0207669_10503522 Ga0207669_105035221 115
231 3300025938 Ga0207704_10002980 Ga0207704_100029802 115
232 3300025938 Ga0207704_10435533 Ga0207704_104355332 115
233 3300025938 Ga0207704_10839086 Ga0207704_108390861 115
234 3300025939 Ga0207665_10717831 Ga0207665_107178311 115
235 3300025940 Ga0207691_10075943 Ga0207691_100759432 115
236 3300025949 Ga0207667_10001136 Ga0207667_1000113617 115
237 3300025949 Ga0207667_10018471 Ga0207667_100184713 115
238 3300025949 Ga0207667_10039320 Ga0207667_100393202 115
239 3300025949 Ga0207667_10049435 Ga0207667_100494352 115
240 3300025949 Ga0207667_10231097 Ga0207667_102310972 115
241 3300025949 Ga0207667_11103862 Ga0207667_111038622 115
242 3300025960 Ga0207651_10203052 Ga0207651_102030522 115
243 3300026023 Ga0207677_10074138 Ga0207677_100741382 115
244 3300026023 Ga0207677_10100189 Ga0207677_101001892 115
245 3300026035 Ga0207703_11413327 Ga0207703_114133271 115
246 3300026041 Ga0207639_10589208 Ga0207639_105892081 115
247 3300026041 Ga0207639_10967303 Ga0207639_109673031 115
248 3300026041 Ga0207639_11872496 Ga0207639_118724961 115
249 3300026067 Ga0207678_10213285 Ga0207678_102132852 115
250 3300026078 Ga0207702_10529496 Ga0207702_105294962 115
251 3300026088 Ga0207641_11385911 Ga0207641_113859111 115
252 3300026089 Ga0207648_10004436 Ga0207648_100044362 115
253 3300026116 Ga0207674_10120082 Ga0207674_101200822 115
254 3300026116 Ga0207674_10422473 Ga0207674_104224732 115
255 3300026121 Ga0207683_10015828 Ga0207683_100158284 115
256 3300026142 Ga0207698_11239168 Ga0207698_112391681 115
257 3300028379 Ga0268266_10000032 Ga0268266_1000003247 115
258 3300028786 Ga0307517_10004407 Ga0307517_1000440727 115
259 3300028794 Ga0307515_10001308 Ga0307515_100013087 115
260 3300028800 Ga0265338_10282331 Ga0265338_102823312 115
261 3300031507 Ga0307509_10393926 Ga0307509_103939262 115
262 3300031730 Ga0307516_10734271 Ga0307516_107342712 115
263 3300031911 Ga0307412_11364502 Ga0307412_113645021 115
264 3300033179 Ga0307507_10000309 Ga0307507_1000030914 115
265 3300033180 Ga0307510_10000366 Ga0307510_1000036619 115
266 3300037312 Ga0395899_0000034 Ga0395899_0000034_55716_56063 115
267 3300037312 Ga0395899_0000199 Ga0395899_0000199_10842_11192 115
268 3300037312 Ga0395899_0000201 Ga0395899_0000201_75591_75938 115
269 3300037418 Ga0395900_0000157 Ga0395900_0000157_99179_99529 115
270 3300037418 Ga0395900_0607078 Ga0395900_0607078_502_849 115
271 3300037466 Ga0395898_0003116 Ga0395898_0003116_12588_12938 115
272 3300037471 Ga0395905_0000195 Ga0395905_0000195_12585_12935 115
273 3300037471 Ga0395905_1002887 Ga0395905_1002887_90_437 115
274 3300038443 Ga0395901_0000283 Ga0395901_0000283_49959_50309 115
275 3300038443 Ga0395901_0120011 Ga0395901_0120011_1801_2148 115
276 3300039447 Ga0436361_0401394 Ga0436361_0401394_3542_3889 115
277 3300039447 Ga0436361_0572910 Ga0436361_0572910_194_547 115
278 3300041452 Ga0451793_0547719 Ga0451793_0547719_47_397 115
279 3300041456 Ga0451795_0883339 Ga0451795_0883339_177_527 115
280 3300041486 Ga0451807_1676689 Ga0451807_1676689_16_363 115
281 3300041507 Ga0451851_1268722 Ga0451851_1268722_77_427 115
282 3300044656 Ga0466969_0069927 Ga0466969_0069927_1243_1590 115
283 3300044684 Ga0466966_0019674 Ga0466966_0019674_3222_3569 115
284 3300044684 Ga0466966_0153009 Ga0466966_0153009_984_1331 115
285 3300044693 Ga0466961_0096596 Ga0466961_0096596_373_720 115
286 3300045049 Ga0466959_0414009 Ga0466959_0414009_526_873 115
287 3300045836 Ga0466958_0097949 Ga0466958_0097949_865_1212 115
288 3300046454 Ga0495592_0161769 Ga0495592_0161769_1001_1348 115
289 3300046461 Ga0495641_0534216 Ga0495641_0534216_79_429 115
290 3300046462 Ga0495651_0227333 Ga0495651_0227333_866_1213 115
291 3300046471 Ga0495650_0000447 Ga0495650_0000447_15207_15557 115
292 3300046471 Ga0495650_0033928 Ga0495650_0033928_1407_1757 115
293 3300046492 Ga0495585_0000116 Ga0495585_0000116_80770_81120 115
294 3300046492 Ga0495585_0000658 Ga0495585_0000658_26204_26554 115
295 3300046500 Ga0495596_0104241 Ga0495596_0104241_619_966 115
296 3300046506 Ga0495583_0079273 Ga0495583_0079273_316_666 115
297 3300046507 Ga0495606_0000844 Ga0495606_0000844_2347_2697 115
298 3300046507 Ga0495606_0004887 Ga0495606_0004887_3871_4218 115
299 3300046507 Ga0495606_0005006 Ga0495606_0005006_5212_5562 115
300 3300046507 Ga0495606_0018248 Ga0495606_0018248_1926_2276 115
301 3300046507 Ga0495606_0152378 Ga0495606_0152378_298_648 115
302 3300046512 Ga0495610_0025468 Ga0495610_0025468_2316_2666 115
303 3300046513 Ga0495616_0000538 Ga0495616_0000538_15187_15537 115
304 3300046513 Ga0495616_0003682 Ga0495616_0003682_4639_4989 115
305 3300046518 Ga0495631_0036199 Ga0495631_0036199_1181_1528 115
306 3300046518 Ga0495631_0148678 Ga0495631_0148678_525_875 115
307 3300046523 Ga0495644_0011232 Ga0495644_0011232_616_963 115
308 3300046524 Ga0495648_0014307 Ga0495648_0014307_5141_5491 115
309 3300046524 Ga0495648_0063408 Ga0495648_0063408_1627_1977 115
310 3300046528 Ga0495642_0264928 Ga0495642_0264928_27_374 115
311 3300046529 Ga0495652_0153469 Ga0495652_0153469_1277_1624 115
312 3300046529 Ga0495652_0256565 Ga0495652_0256565_379_729 115
313 3300046538 Ga0495609_0017608 Ga0495609_0017608_2355_2705 115
314 3300046558 Ga0495633_0000026 Ga0495633_0000026_135066_135416 115
315 3300046558 Ga0495633_0003682 Ga0495633_0003682_3300_3650 115
316 3300046616 Ga0495668_0000054 Ga0495668_0000054_104921_105271 115
317 3300046648 Ga0495611_0023748 Ga0495611_0023748_1959_2309 115
318 3300046660 Ga0495625_0000972 Ga0495625_0000972_22526_22876 115
319 3300046660 Ga0495625_0003592 Ga0495625_0003592_12279_12629 115
320 3300046660 Ga0495625_0006420 Ga0495625_0006420_2527_2877 115
321 3300046660 Ga0495625_0066711 Ga0495625_0066711_826_1176 115
322 3300046660 Ga0495625_0111254 Ga0495625_0111254_502_849 115
323 3300046660 Ga0495625_0220855 Ga0495625_0220855_101_448 115
324 3300046665 Ga0495661_0007204 Ga0495661_0007204_2322_2669 115
325 3300046665 Ga0495661_0017852 Ga0495661_0017852_1162_1509 115
326 3300046665 Ga0495661_0019448 Ga0495661_0019448_3756_4106 115
327 3300046665 Ga0495661_0300965 Ga0495661_0300965_351_701 115
328 3300046665 Ga0495661_0507618 Ga0495661_0507618_201_548 115
329 3300046691 Ga0495670_0114476 Ga0495670_0114476_361_711 115
330 3300046694 Ga0495649_0000014 Ga0495649_0000014_264599_264949 115
331 3300046810 Ga0495660_0021758 Ga0495660_0021758_711_1061 115
332 3300046810 Ga0495660_0096988 Ga0495660_0096988_893_1243 115
333 3300047443 Ga0495687_001035 Ga0495687_001035_92_442 115
334 3300047443 Ga0495687_001403 Ga0495687_001403_836_1189 115
335 3300047445 Ga0495677_0022844 Ga0495677_0022844_997_1344 115
336 3300047447 Ga0495685_038870 Ga0495685_038870_138_485 115
337 3300047469 Ga0495673_0018223 Ga0495673_0018223_72_422 115
338 3300047472 Ga0495686_0000913 Ga0495686_0000913_6816_7166 115
339 3300047472 Ga0495686_0032008 Ga0495686_0032008_1612_1962 115
340 3300047472 Ga0495686_0099175 Ga0495686_0099175_664_1014 115
341 3300047472 Ga0495686_0134197 Ga0495686_0134197_23_370 115
342 3300047472 Ga0495686_0190269 Ga0495686_0190269_379_729 115
343 3300047472 Ga0495686_0255454 Ga0495686_0255454_344_691 115
344 3300049459 Ga0495678_005816 Ga0495678_005816_1995_2345 115
345 3300050493 nmdc:mga0k408_6028_c1 nmdc:mga0k408_6028_c1_2132_2482 115
346 3300050493 nmdc:mga0k408_82_c1 nmdc:mga0k408_82_c1_20680_21030 115
347 3300050496 nmdc:mga07m45_172446_c1 nmdc:mga07m45_172446_c1_187_537 115
348 3300050496 nmdc:mga07m45_397544_c1 nmdc:mga07m45_397544_c1_163_516 115
349 3300053080 Ga0500635_0007513 Ga0500635_0007513_1158_1505 115
350 3300053118 Ga0500594_0340618 Ga0500594_0340618_130_480 115
351 3300053122 Ga0500608_005547 Ga0500608_005547_2542_2892 115
352 3300053123 Ga0500614_048793 Ga0500614_048793_340_690 115
353 3300053125 Ga0500618_000005 Ga0500618_000005_2573_2923 115
354 3300053130 Ga0500642_0106188 Ga0500642_0106188_438_785 115
355 3300053138 Ga0500564_175839 Ga0500564_175839_265_615 115
356 3300053153 Ga0500616_0164664 Ga0500616_0164664_546_896 115
357 3300053156 Ga0500622_0002780 Ga0500622_0002780_2861_3214 115
358 3300053157 Ga0500624_000133 Ga0500624_000133_6021_6371 115
359 3300053161 Ga0500634_0140251 Ga0500634_0140251_702_1052 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

30

138

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tou-assembly1.cif.gz_B crystal structure of glutathione transferase (target efi-501058) from ralstonia solanacearum gmi1000 with gsh bound 0.9676 2 28
7q6k-assembly1.cif.gz_A-2 crystal structure of the human gdap1 cmt2 mutant-r120w 0.9594 2 30
8exz-assembly1.cif.gz_A structure of gdap1 containing cmt mutant t157p 0.959 2 30
6nxv-assembly4.cif.gz_D crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form 0.9582 2 30
1rw1-assembly1.cif.gz_A yffb (pa3664) protein 0.9559 2 111
ID Description Score Start End Superfamily
af_Q4D776_60_147_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9726 2 30 3.40.30.10
4ke3D01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9716 2 29 3.40.30.10
af_Q9FHX0_75_159_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9708 2 30 3.40.30.10
3touB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9676 2 28 3.40.30.10
3touA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9672 2 28 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7W9XLX5-F1-model_v4 Spx/MgsR family transcriptional regulator 0.9831 2 114
AF-A0A270BW18-F1-model_v4 ArsC family reductase 0.9785 2 112
AF-A0A366L0C5-F1-model_v4 Arsenate reductase 0.9781 2 115
AF-A0A401JFT5-F1-model_v4 Glutathione-dependent thiol reductase 0.9757 2 111
AF-A0A511B3D3-F1-model_v4 Arsenate reductase 0.9739 2 114

Feature Viewer

pLDDT pTM Quality
95.92 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map