F421451
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 359 | 175 | 359 | 116 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10100992|Ga0070681_101009922 |
| Length | 141 |
| Sequence | MISALYFMLTLGAWLLNLDFTSYFSQMTVYGITNCNTVKKALDWLKENNIKYAFHDFKKLGISEEKLNEWDKKAGFEKFLNKQGLTWKQLDPQIKVSVKTNTDALKLLREKTSMIKRPVIEDNGFLFFGFDEEVYHNHFGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 111 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 112 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 114 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 115 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 116 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 117 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 118 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 119 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 120 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 121 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 122 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 123 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 124 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 125 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 126 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 127 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 128 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 129 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 130 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 131 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 132 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 133 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 164 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 165 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 166 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 167 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 168 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 169 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 170 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 171 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 172 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 173 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 174 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 175 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.72 |
| Metatranscriptomes | 0.28 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.03 |
| Nodule | 0 |
| Rhizoplane | 0.84 |
| Rhizosphere | 84.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1003095 | 3300001904 | Bacteria | 2901 |
| 2 | JGI24741J21665_1027162 | 3300001915 | Unclassified | 869 |
| 3 | JGI24740J21852_10018282 | 3300001979 | Bacteria | 2491 |
| 4 | JGI24737J22298_10000098 | 3300001990 | Bacteria | 25831 |
| 5 | JGI24735J21928_10000009 | 3300002067 | Bacteria | 247425 |
| 6 | JGI24735J21928_10000036 | 3300002067 | Bacteria | 65596 |
| 7 | JGI24735J21928_10038630 | 3300002067 | Bacteria | 1396 |
| 8 | JGI24744J21845_10005483 | 3300002077 | Bacteria | 2626 |
| 9 | JGI25162J39368_1000005 | 3300002737 | Bacteria | 435925 |
| 10 | JGI25162J39368_1000383 | 3300002737 | Bacteria | 37576 |
| 11 | JGI25162J39368_1000527 | 3300002737 | Bacteria | 28507 |
| 12 | JGI25164J39214_1000502 | 3300002772 | Bacteria | 19101 |
| 13 | JGI25165J46597_1000435 | 3300003214 | Bacteria | 42373 |
| 14 | rootH2_10002127 | 3300003320 | Bacteria | 66384 |
| 15 | rootH2_10024209 | 3300003320 | Bacteria | 4196 |
| 16 | rootH2_10073956 | 3300003320 | Bacteria | 3903 |
| 17 | rootH2_10145839 | 3300003320 | Bacteria | 2084 |
| 18 | rootL2_10101326 | 3300003322 | Bacteria | 1872 |
| 19 | rootH1_10230029 | 3300003323 | Bacteria | 3154 |
| 20 | Ga0055529_1013554 | 3300003763 | Unclassified | 1037 |
| 21 | Ga0065714_10011202 | 3300005288 | Bacteria | 3767 |
| 22 | Ga0070658_10071432 | 3300005327 | Bacteria | 2843 |
| 23 | Ga0070658_10342314 | 3300005327 | Unclassified | 1279 |
| 24 | Ga0070658_10605162 | 3300005327 | Unclassified | 950 |
| 25 | Ga0070658_11429758 | 3300005327 | Bacteria | 600 |
| 26 | Ga0070676_10000283 | 3300005328 | Bacteria | 22555 |
| 27 | Ga0068868_100030589 | 3300005338 | Bacteria | 4129 |
| 28 | Ga0068868_100077234 | 3300005338 | Bacteria | 2664 |
| 29 | Ga0070660_100089376 | 3300005339 | Bacteria | 2427 |
| 30 | Ga0070660_100207227 | 3300005339 | Bacteria | 1591 |
| 31 | Ga0070661_100363150 | 3300005344 | Unclassified | 1138 |
| 32 | Ga0070671_100024558 | 3300005355 | Bacteria | 4936 |
| 33 | Ga0070674_100548912 | 3300005356 | Bacteria | 969 |
| 34 | Ga0070659_100000465 | 3300005366 | Bacteria | 29940 |
| 35 | Ga0070659_100049237 | 3300005366 | Bacteria | 3313 |
| 36 | Ga0070663_100118845 | 3300005455 | Bacteria | 1994 |
| 37 | Ga0070678_100008034 | 3300005456 | Bacteria | 6291 |
| 38 | Ga0070662_100001823 | 3300005457 | Bacteria | 13070 |
| 39 | Ga0070681_10100992 | 3300005458 | Bacteria | 2830 |
| 40 | Ga0070681_10748826 | 3300005458 | Bacteria | 894 |
| 41 | Ga0068867_100000696 | 3300005459 | Bacteria | 22392 |
| 42 | Ga0070679_100004019 | 3300005530 | Bacteria | 13550 |
| 43 | Ga0070679_100964313 | 3300005530 | Bacteria | 796 |
| 44 | Ga0070679_101096364 | 3300005530 | Bacteria | 741 |
| 45 | Ga0070684_102371938 | 3300005535 | Bacteria | 500 |
| 46 | Ga0068853_100028092 | 3300005539 | Unclassified | 4731 |
| 47 | Ga0068853_100194461 | 3300005539 | Bacteria | 1844 |
| 48 | Ga0068853_100576138 | 3300005539 | Bacteria | 1068 |
| 49 | Ga0068853_101369407 | 3300005539 | Bacteria | 684 |
| 50 | Ga0070672_100059409 | 3300005543 | Bacteria | 3008 |
| 51 | Ga0070665_100000096 | 3300005548 | Bacteria | 166864 |
| 52 | Ga0068855_100003097 | 3300005563 | Bacteria | 20360 |
| 53 | Ga0068855_100003604 | 3300005563 | Bacteria | 18925 |
| 54 | Ga0068855_100023475 | 3300005563 | Bacteria | 7386 |
| 55 | Ga0068855_100250869 | 3300005563 | Bacteria | 1974 |
| 56 | Ga0068855_100859333 | 3300005563 | Bacteria | 961 |
| 57 | Ga0068857_100040426 | 3300005577 | Bacteria | 4135 |
| 58 | Ga0068857_100378182 | 3300005577 | Bacteria | 1315 |
| 59 | Ga0068857_100416992 | 3300005577 | Bacteria | 1251 |
| 60 | Ga0068857_101024579 | 3300005577 | Bacteria | 795 |
| 61 | Ga0068854_101483937 | 3300005578 | Bacteria | 615 |
| 62 | Ga0068856_100000164 | 3300005614 | Bacteria | 68790 |
| 63 | Ga0068856_100282607 | 3300005614 | Bacteria | 1676 |
| 64 | Ga0068856_100612956 | 3300005614 | Bacteria | 1109 |
| 65 | Ga0068856_101012040 | 3300005614 | Bacteria | 849 |
| 66 | Ga0068852_100184469 | 3300005616 | Bacteria | 1964 |
| 67 | Ga0068852_101241904 | 3300005616 | Bacteria | 766 |
| 68 | Ga0068852_101391598 | 3300005616 | Bacteria | 723 |
| 69 | Ga0068866_10023241 | 3300005718 | Bacteria | 2881 |
| 70 | Ga0068866_10560440 | 3300005718 | Unclassified | 765 |
| 71 | Ga0068870_10360505 | 3300005840 | Bacteria | 935 |
| 72 | Ga0068863_101429734 | 3300005841 | Bacteria | 699 |
| 73 | Ga0068858_100512063 | 3300005842 | Bacteria | 1160 |
| 74 | Ga0075366_10000170 | 3300006195 | Bacteria | 27881 |
| 75 | Ga0075366_10008109 | 3300006195 | Bacteria | 5826 |
| 76 | Ga0075366_10038634 | 3300006195 | Bacteria | 2820 |
| 77 | Ga0075366_10725671 | 3300006195 | Bacteria | 617 |
| 78 | Ga0097621_100001557 | 3300006237 | Bacteria | 15672 |
| 79 | Ga0097621_100928984 | 3300006237 | Bacteria | 811 |
| 80 | Ga0097621_101064346 | 3300006237 | Bacteria | 758 |
| 81 | Ga0075370_10140591 | 3300006353 | Bacteria | 1411 |
| 82 | Ga0075370_10552812 | 3300006353 | Bacteria | 696 |
| 83 | Ga0068871_100001732 | 3300006358 | Bacteria | 14696 |
| 84 | Ga0068865_100000377 | 3300006881 | Bacteria | 24723 |
| 85 | Ga0068865_100854496 | 3300006881 | Bacteria | 788 |
| 86 | Ga0105240_10002021 | 3300009093 | Bacteria | 33455 |
| 87 | Ga0105240_10008785 | 3300009093 | Bacteria | 14391 |
| 88 | Ga0105240_10015598 | 3300009093 | Bacteria | 10324 |
| 89 | Ga0105240_10028966 | 3300009093 | Bacteria | 7222 |
| 90 | Ga0105240_10115148 | 3300009093 | Bacteria | 3246 |
| 91 | Ga0105240_10248868 | 3300009093 | Unclassified | 2057 |
| 92 | Ga0105240_10275390 | 3300009093 | Bacteria | 1936 |
| 93 | Ga0105240_10572104 | 3300009093 | Bacteria | 1247 |
| 94 | Ga0105240_11150195 | 3300009093 | Bacteria | 824 |
| 95 | Ga0105240_11367976 | 3300009093 | Bacteria | 745 |
| 96 | Ga0105240_12131410 | 3300009093 | Bacteria | 582 |
| 97 | Ga0105245_10233862 | 3300009098 | Bacteria | 1778 |
| 98 | Ga0105245_10307359 | 3300009098 | Bacteria | 1558 |
| 99 | Ga0105243_10053814 | 3300009148 | Unclassified | 3193 |
| 100 | Ga0105241_10002990 | 3300009174 | Bacteria | 12621 |
| 101 | Ga0105241_10074540 | 3300009174 | Bacteria | 2643 |
| 102 | Ga0105241_10193351 | 3300009174 | Bacteria | 1695 |
| 103 | Ga0105241_10287088 | 3300009174 | Bacteria | 1407 |
| 104 | Ga0105241_10306100 | 3300009174 | Bacteria | 1365 |
| 105 | Ga0105242_10073991 | 3300009176 | Bacteria | 2834 |
| 106 | Ga0105237_10000762 | 3300009545 | Bacteria | 44209 |
| 107 | Ga0105237_10001136 | 3300009545 | Bacteria | 35738 |
| 108 | Ga0105237_10008171 | 3300009545 | Bacteria | 11369 |
| 109 | Ga0105237_10008218 | 3300009545 | Bacteria | 11333 |
| 110 | Ga0105237_10008779 | 3300009545 | Bacteria | 10902 |
| 111 | Ga0105237_10313934 | 3300009545 | Bacteria | 1571 |
| 112 | Ga0105237_10588050 | 3300009545 | Bacteria | 1120 |
| 113 | Ga0105237_10716814 | 3300009545 | Bacteria | 1007 |
| 114 | Ga0105237_11204401 | 3300009545 | Bacteria | 764 |
| 115 | Ga0105238_10003629 | 3300009551 | Bacteria | 15388 |
| 116 | Ga0105238_10092340 | 3300009551 | Bacteria | 3015 |
| 117 | Ga0105238_12554036 | 3300009551 | Bacteria | 547 |
| 118 | Ga0105238_12565896 | 3300009551 | Bacteria | 546 |
| 119 | Ga0105239_10000004 | 3300010375 | Bacteria | 532483 |
| 120 | Ga0105239_10000015 | 3300010375 | Bacteria | 319892 |
| 121 | Ga0105239_10000655 | 3300010375 | Bacteria | 49317 |
| 122 | Ga0105239_10004803 | 3300010375 | Bacteria | 16040 |
| 123 | Ga0105239_10012919 | 3300010375 | Bacteria | 9289 |
| 124 | Ga0105239_10026197 | 3300010375 | Bacteria | 6417 |
| 125 | Ga0105239_10074842 | 3300010375 | Bacteria | 3723 |
| 126 | Ga0105239_10144792 | 3300010375 | Bacteria | 2649 |
| 127 | Ga0105239_10154939 | 3300010375 | Bacteria | 2558 |
| 128 | Ga0105246_10248354 | 3300011119 | Bacteria | 1411 |
| 129 | Ga0157373_10009645 | 3300013100 | Bacteria | 7125 |
| 130 | Ga0157373_10573990 | 3300013100 | Unclassified | 819 |
| 131 | Ga0157371_10004364 | 3300013102 | Bacteria | 12384 |
| 132 | Ga0157371_10004859 | 3300013102 | Bacteria | 11556 |
| 133 | Ga0157371_10169604 | 3300013102 | Bacteria | 1559 |
| 134 | Ga0157371_10755840 | 3300013102 | Bacteria | 730 |
| 135 | Ga0157371_11193541 | 3300013102 | Bacteria | 586 |
| 136 | Ga0157370_10013983 | 3300013104 | Bacteria | 8241 |
| 137 | Ga0157370_10601563 | 3300013104 | Unclassified | 1007 |
| 138 | Ga0157370_11277864 | 3300013104 | Bacteria | 661 |
| 139 | Ga0157369_10002582 | 3300013105 | Bacteria | 21679 |
| 140 | Ga0157369_10418939 | 3300013105 | Bacteria | 1388 |
| 141 | Ga0157369_10533992 | 3300013105 | Bacteria | 1213 |
| 142 | Ga0157369_11025223 | 3300013105 | Bacteria | 844 |
| 143 | Ga0157369_11235094 | 3300013105 | Bacteria | 762 |
| 144 | Ga0157374_10012002 | 3300013296 | Bacteria | 7522 |
| 145 | Ga0157374_10038094 | 3300013296 | Bacteria | 4418 |
| 146 | Ga0157374_10670060 | 3300013296 | Bacteria | 1050 |
| 147 | Ga0157374_10732300 | 3300013296 | Bacteria | 1003 |
| 148 | Ga0157374_10797743 | 3300013296 | Bacteria | 960 |
| 149 | Ga0157374_10992753 | 3300013296 | Bacteria | 858 |
| 150 | Ga0157374_11270549 | 3300013296 | Bacteria | 758 |
| 151 | Ga0157374_11978654 | 3300013296 | Bacteria | 609 |
| 152 | Ga0157378_10129392 | 3300013297 | Bacteria | 2335 |
| 153 | Ga0157378_10267338 | 3300013297 | Bacteria | 1643 |
| 154 | Ga0157378_13289017 | 3300013297 | Bacteria | 502 |
| 155 | Ga0163162_10000005 | 3300013306 | Bacteria | 447195 |
| 156 | Ga0163162_10017567 | 3300013306 | Bacteria | 7000 |
| 157 | Ga0163162_10128747 | 3300013306 | Bacteria | 2639 |
| 158 | Ga0157372_10000030 | 3300013307 | Bacteria | 179925 |
| 159 | Ga0157372_10001737 | 3300013307 | Bacteria | 23642 |
| 160 | Ga0157372_10015310 | 3300013307 | Bacteria | 8217 |
| 161 | Ga0157372_10018963 | 3300013307 | Bacteria | 7404 |
| 162 | Ga0157372_10136319 | 3300013307 | Unclassified | 2827 |
| 163 | Ga0157372_10298437 | 3300013307 | Bacteria | 1874 |
| 164 | Ga0157375_10057947 | 3300013308 | Bacteria | 3831 |
| 165 | Ga0157375_10710653 | 3300013308 | Bacteria | 1158 |
| 166 | Ga0157377_10010093 | 3300014745 | Bacteria | 4661 |
| 167 | Ga0157376_11599164 | 3300014969 | Bacteria | 686 |
| 168 | Ga0163161_10004267 | 3300017792 | Bacteria | 9967 |
| 169 | Ga0163161_10787915 | 3300017792 | Bacteria | 798 |
| 170 | Ga0206351_10627478 | 3300020077 | Bacteria | 889 |
| 171 | Ga0207427_100025 | 3300025231 | Bacteria | 433726 |
| 172 | Ga0209437_100010 | 3300025233 | Bacteria | 838447 |
| 173 | Ga0209437_100043 | 3300025233 | Bacteria | 440454 |
| 174 | Ga0209026_1000310 | 3300025250 | Bacteria | 52783 |
| 175 | Ga0209026_1004191 | 3300025250 | Bacteria | 4399 |
| 176 | Ga0209026_1032827 | 3300025250 | Bacteria | 766 |
| 177 | Ga0209129_1006299 | 3300025258 | Bacteria | 3886 |
| 178 | Ga0209233_1000017 | 3300025261 | Bacteria | 898076 |
| 179 | Ga0209233_1000685 | 3300025261 | Bacteria | 16074 |
| 180 | Ga0209233_1006175 | 3300025261 | Bacteria | 3882 |
| 181 | Ga0209233_1020942 | 3300025261 | Bacteria | 1704 |
| 182 | Ga0209455_1003999 | 3300025272 | Bacteria | 4994 |
| 183 | Ga0207642_10023966 | 3300025899 | Bacteria | 2447 |
| 184 | Ga0207647_10000206 | 3300025904 | Bacteria | 48374 |
| 185 | Ga0207647_10002696 | 3300025904 | Bacteria | 13406 |
| 186 | Ga0207647_10058022 | 3300025904 | Bacteria | 2371 |
| 187 | Ga0207647_10141433 | 3300025904 | Bacteria | 1410 |
| 188 | Ga0207645_10000035 | 3300025907 | Bacteria | 89345 |
| 189 | Ga0207643_10453511 | 3300025908 | Bacteria | 816 |
| 190 | Ga0207705_10066674 | 3300025909 | Bacteria | 2604 |
| 191 | Ga0207705_10219097 | 3300025909 | Unclassified | 1445 |
| 192 | Ga0207705_10571397 | 3300025909 | Unclassified | 879 |
| 193 | Ga0207654_10007566 | 3300025911 | Bacteria | 5478 |
| 194 | Ga0207654_10062787 | 3300025911 | Bacteria | 2178 |
| 195 | Ga0207654_10199474 | 3300025911 | Bacteria | 1317 |
| 196 | Ga0207654_11380531 | 3300025911 | Bacteria | 514 |
| 197 | Ga0207707_10636481 | 3300025912 | Unclassified | 900 |
| 198 | Ga0207695_10000142 | 3300025913 | Bacteria | 214715 |
| 199 | Ga0207695_10007936 | 3300025913 | Bacteria | 13394 |
| 200 | Ga0207695_10012264 | 3300025913 | Bacteria | 10297 |
| 201 | Ga0207695_10082657 | 3300025913 | Bacteria | 3246 |
| 202 | Ga0207695_10457407 | 3300025913 | Bacteria | 1159 |
| 203 | Ga0207695_10488929 | 3300025913 | Bacteria | 1113 |
| 204 | Ga0207695_10498381 | 3300025913 | Unclassified | 1100 |
| 205 | Ga0207671_10000110 | 3300025914 | Bacteria | 126480 |
| 206 | Ga0207671_10004130 | 3300025914 | Bacteria | 14037 |
| 207 | Ga0207671_10005696 | 3300025914 | Bacteria | 11383 |
| 208 | Ga0207671_10012608 | 3300025914 | Bacteria | 6789 |
| 209 | Ga0207671_10022184 | 3300025914 | Bacteria | 4804 |
| 210 | Ga0207671_11432140 | 3300025914 | Bacteria | 535 |
| 211 | Ga0207660_10007385 | 3300025917 | Bacteria | 7111 |
| 212 | Ga0207657_10094397 | 3300025919 | Bacteria | 2491 |
| 213 | Ga0207657_10192820 | 3300025919 | Bacteria | 1643 |
| 214 | Ga0207649_10654949 | 3300025920 | Unclassified | 812 |
| 215 | Ga0207652_10013033 | 3300025921 | Bacteria | 6729 |
| 216 | Ga0207652_10874541 | 3300025921 | Bacteria | 795 |
| 217 | Ga0207694_10180922 | 3300025924 | Bacteria | 1710 |
| 218 | Ga0207644_10009586 | 3300025931 | Bacteria | 6358 |
| 219 | Ga0207690_10000669 | 3300025932 | Bacteria | 21955 |
| 220 | Ga0207690_10108059 | 3300025932 | Bacteria | 1999 |
| 221 | Ga0207706_10000246 | 3300025933 | Bacteria | 59254 |
| 222 | Ga0207706_10267228 | 3300025933 | Bacteria | 1493 |
| 223 | Ga0207709_10011898 | 3300025935 | Unclassified | 4800 |
| 224 | Ga0207669_10503522 | 3300025937 | Bacteria | 969 |
| 225 | Ga0207704_10002980 | 3300025938 | Bacteria | 7656 |
| 226 | Ga0207704_10435533 | 3300025938 | Bacteria | 1043 |
| 227 | Ga0207704_10839086 | 3300025938 | Bacteria | 769 |
| 228 | Ga0207665_10717831 | 3300025939 | Bacteria | 786 |
| 229 | Ga0207691_10075943 | 3300025940 | Bacteria | 3028 |
| 230 | Ga0207667_10000266 | 3300025949 | Bacteria | 72382 |
| 231 | Ga0207667_10001136 | 3300025949 | Bacteria | 33505 |
| 232 | Ga0207667_10018471 | 3300025949 | Bacteria | 7818 |
| 233 | Ga0207667_10039320 | 3300025949 | Bacteria | 5042 |
| 234 | Ga0207667_10049435 | 3300025949 | Bacteria | 4441 |
| 235 | Ga0207667_10231097 | 3300025949 | Bacteria | 1894 |
| 236 | Ga0207667_11103862 | 3300025949 | Bacteria | 776 |
| 237 | Ga0207651_10203052 | 3300025960 | Bacteria | 1590 |
| 238 | Ga0207677_10074138 | 3300026023 | Bacteria | 2413 |
| 239 | Ga0207677_10100189 | 3300026023 | Bacteria | 2129 |
| 240 | Ga0207703_11413327 | 3300026035 | Bacteria | 669 |
| 241 | Ga0207639_10589208 | 3300026041 | Bacteria | 1024 |
| 242 | Ga0207639_10967303 | 3300026041 | Bacteria | 797 |
| 243 | Ga0207639_11872496 | 3300026041 | Bacteria | 561 |
| 244 | Ga0207678_10213285 | 3300026067 | Bacteria | 1652 |
| 245 | Ga0207702_10000262 | 3300026078 | Bacteria | 60584 |
| 246 | Ga0207702_10529496 | 3300026078 | Bacteria | 1151 |
| 247 | Ga0207641_11385911 | 3300026088 | Bacteria | 704 |
| 248 | Ga0207648_10004436 | 3300026089 | Bacteria | 14401 |
| 249 | Ga0207674_10120082 | 3300026116 | Bacteria | 2597 |
| 250 | Ga0207674_10422473 | 3300026116 | Bacteria | 1288 |
| 251 | Ga0207683_10015828 | 3300026121 | Bacteria | 6421 |
| 252 | Ga0207698_10178811 | 3300026142 | Bacteria | 1877 |
| 253 | Ga0207698_11239168 | 3300026142 | Bacteria | 760 |
| 254 | Ga0268266_10000032 | 3300028379 | Bacteria | 395079 |
| 255 | Ga0307517_10004407 | 3300028786 | Bacteria | 21615 |
| 256 | Ga0307515_10001308 | 3300028794 | Bacteria | 56577 |
| 257 | Ga0307515_10059546 | 3300028794 | Bacteria | 5470 |
| 258 | Ga0265338_10026846 | 3300028800 | Bacteria | 5794 |
| 259 | Ga0265338_10282331 | 3300028800 | Bacteria | 1213 |
| 260 | Ga0307509_10393926 | 3300031507 | Bacteria | 1094 |
| 261 | Ga0307516_10734271 | 3300031730 | Bacteria | 646 |
| 262 | Ga0307412_11364502 | 3300031911 | Unclassified | 640 |
| 263 | Ga0307507_10000309 | 3300033179 | Bacteria | 98028 |
| 264 | Ga0307510_10000366 | 3300033180 | Bacteria | 42784 |
| 265 | Ga0395899_0000034 | 3300037312 | Bacteria | 302623 |
| 266 | Ga0395899_0000199 | 3300037312 | Bacteria | 87960 |
| 267 | Ga0395899_0000201 | 3300037312 | Bacteria | 87516 |
| 268 | Ga0395900_0000157 | 3300037418 | Bacteria | 112131 |
| 269 | Ga0395900_0607078 | 3300037418 | Bacteria | 1034 |
| 270 | Ga0395898_0003116 | 3300037466 | Bacteria | 18720 |
| 271 | Ga0395905_0000195 | 3300037471 | Bacteria | 95130 |
| 272 | Ga0395905_1002887 | 3300037471 | Bacteria | 738 |
| 273 | Ga0395901_0000283 | 3300038443 | Bacteria | 62908 |
| 274 | Ga0395901_0120011 | 3300038443 | Bacteria | 2763 |
| 275 | Ga0436361_0401394 | 3300039447 | Bacteria | 4019 |
| 276 | Ga0436361_0572910 | 3300039447 | Bacteria | 677 |
| 277 | Ga0451793_0547719 | 3300041452 | Bacteria | 506 |
| 278 | Ga0451795_0883339 | 3300041456 | Bacteria | 595 |
| 279 | Ga0451807_1676689 | 3300041486 | Bacteria | 588 |
| 280 | Ga0451851_1268722 | 3300041507 | Bacteria | 596 |
| 281 | Ga0466969_0069927 | 3300044656 | Bacteria | 1689 |
| 282 | Ga0466966_0019674 | 3300044684 | Bacteria | 4441 |
| 283 | Ga0466966_0153009 | 3300044684 | Bacteria | 1406 |
| 284 | Ga0466961_0096596 | 3300044693 | Bacteria | 1863 |
| 285 | Ga0466959_0414009 | 3300045049 | Bacteria | 915 |
| 286 | Ga0466958_0097949 | 3300045836 | Bacteria | 1820 |
| 287 | Ga0495592_0161769 | 3300046454 | Bacteria | 1540 |
| 288 | Ga0495641_0534216 | 3300046461 | Bacteria | 535 |
| 289 | Ga0495651_0227333 | 3300046462 | Bacteria | 1287 |
| 290 | Ga0495650_0000447 | 3300046471 | Bacteria | 65735 |
| 291 | Ga0495650_0033928 | 3300046471 | Bacteria | 2265 |
| 292 | Ga0495585_0000116 | 3300046492 | Bacteria | 86272 |
| 293 | Ga0495585_0000658 | 3300046492 | Bacteria | 31746 |
| 294 | Ga0495596_0104241 | 3300046500 | Bacteria | 1101 |
| 295 | Ga0495583_0079273 | 3300046506 | Bacteria | 1429 |
| 296 | Ga0495606_0000844 | 3300046507 | Bacteria | 46120 |
| 297 | Ga0495606_0004887 | 3300046507 | Bacteria | 13131 |
| 298 | Ga0495606_0005006 | 3300046507 | Bacteria | 12923 |
| 299 | Ga0495606_0018248 | 3300046507 | Bacteria | 5270 |
| 300 | Ga0495606_0152378 | 3300046507 | Bacteria | 1356 |
| 301 | Ga0495610_0025468 | 3300046512 | Bacteria | 3174 |
| 302 | Ga0495616_0000538 | 3300046513 | Bacteria | 28605 |
| 303 | Ga0495616_0003682 | 3300046513 | Bacteria | 9787 |
| 304 | Ga0495631_0036199 | 3300046518 | Bacteria | 2205 |
| 305 | Ga0495631_0148678 | 3300046518 | Bacteria | 1005 |
| 306 | Ga0495644_0011232 | 3300046523 | Bacteria | 3451 |
| 307 | Ga0495648_0014307 | 3300046524 | Bacteria | 5816 |
| 308 | Ga0495648_0063408 | 3300046524 | Bacteria | 2182 |
| 309 | Ga0495642_0264928 | 3300046528 | Bacteria | 752 |
| 310 | Ga0495652_0153469 | 3300046529 | Bacteria | 1796 |
| 311 | Ga0495652_0256565 | 3300046529 | Bacteria | 1293 |
| 312 | Ga0495609_0017608 | 3300046538 | Bacteria | 3317 |
| 313 | Ga0495633_0000026 | 3300046558 | Bacteria | 204722 |
| 314 | Ga0495633_0003682 | 3300046558 | Bacteria | 10122 |
| 315 | Ga0495668_0000054 | 3300046616 | Bacteria | 203960 |
| 316 | Ga0495611_0023748 | 3300046648 | Bacteria | 2663 |
| 317 | Ga0495625_0000972 | 3300046660 | Bacteria | 38083 |
| 318 | Ga0495625_0003592 | 3300046660 | Bacteria | 15260 |
| 319 | Ga0495625_0006420 | 3300046660 | Bacteria | 10472 |
| 320 | Ga0495625_0066711 | 3300046660 | Bacteria | 2534 |
| 321 | Ga0495625_0111254 | 3300046660 | Bacteria | 1872 |
| 322 | Ga0495625_0220855 | 3300046660 | Bacteria | 1242 |
| 323 | Ga0495661_0007204 | 3300046665 | Bacteria | 7757 |
| 324 | Ga0495661_0017852 | 3300046665 | Bacteria | 4677 |
| 325 | Ga0495661_0019448 | 3300046665 | Bacteria | 4450 |
| 326 | Ga0495661_0300965 | 3300046665 | Bacteria | 802 |
| 327 | Ga0495661_0507618 | 3300046665 | Unclassified | 574 |
| 328 | Ga0495670_0114476 | 3300046691 | Bacteria | 1398 |
| 329 | Ga0495649_0000014 | 3300046694 | Bacteria | 287408 |
| 330 | Ga0495660_0021758 | 3300046810 | Bacteria | 3668 |
| 331 | Ga0495660_0096988 | 3300046810 | Bacteria | 1523 |
| 332 | Ga0495687_001035 | 3300047443 | Bacteria | 27615 |
| 333 | Ga0495687_001403 | 3300047443 | Bacteria | 22225 |
| 334 | Ga0495677_0022844 | 3300047445 | Bacteria | 2270 |
| 335 | Ga0495685_038870 | 3300047447 | Bacteria | 1629 |
| 336 | Ga0495673_0018223 | 3300047469 | Bacteria | 3547 |
| 337 | Ga0495686_0000913 | 3300047472 | Bacteria | 37043 |
| 338 | Ga0495686_0032008 | 3300047472 | Bacteria | 3406 |
| 339 | Ga0495686_0099175 | 3300047472 | Bacteria | 1759 |
| 340 | Ga0495686_0124677 | 3300047472 | Unclassified | 1532 |
| 341 | Ga0495686_0134197 | 3300047472 | Bacteria | 1465 |
| 342 | Ga0495686_0190269 | 3300047472 | Unclassified | 1183 |
| 343 | Ga0495686_0255454 | 3300047472 | Bacteria | 983 |
| 344 | Ga0495678_005816 | 3300049459 | Bacteria | 6687 |
| 345 | nmdc:mga0k408_6028_c1 | 3300050493 | Bacteria | 6461 |
| 346 | nmdc:mga0k408_82_c1 | 3300050493 | Bacteria | 45008 |
| 347 | nmdc:mga07m45_172446_c1 | 3300050496 | Bacteria | 1257 |
| 348 | nmdc:mga07m45_397544_c1 | 3300050496 | Bacteria | 800 |
| 349 | Ga0500635_0007513 | 3300053080 | Bacteria | 2957 |
| 350 | Ga0500594_0340618 | 3300053118 | Bacteria | 505 |
| 351 | Ga0500608_005547 | 3300053122 | Bacteria | 5030 |
| 352 | Ga0500614_048793 | 3300053123 | Bacteria | 1104 |
| 353 | Ga0500618_000005 | 3300053125 | Bacteria | 253092 |
| 354 | Ga0500642_0106188 | 3300053130 | Bacteria | 1309 |
| 355 | Ga0500564_175839 | 3300053138 | Bacteria | 896 |
| 356 | Ga0500616_0164664 | 3300053153 | Bacteria | 1013 |
| 357 | Ga0500622_0002780 | 3300053156 | Bacteria | 12301 |
| 358 | Ga0500624_000133 | 3300053157 | Bacteria | 32143 |
| 359 | Ga0500634_0140251 | 3300053161 | Bacteria | 1146 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002737 | JGI25162J39368_1000383 | JGI25162J39368_100038317 | 114 |
| 2 | 3300002772 | JGI25164J39214_1000502 | JGI25164J39214_10005021 | 114 |
| 3 | 3300003214 | JGI25165J46597_1000435 | JGI25165J46597_100043527 | 114 |
| 4 | 3300003320 | rootH2_10024209 | rootH2_100242094 | 114 |
| 5 | 3300005288 | Ga0065714_10011202 | Ga0065714_100112023 | 114 |
| 6 | 3300005327 | Ga0070658_10071432 | Ga0070658_100714322 | 114 |
| 7 | 3300005327 | Ga0070658_11429758 | Ga0070658_114297581 | 114 |
| 8 | 3300005339 | Ga0070660_100207227 | Ga0070660_1002072272 | 114 |
| 9 | 3300005366 | Ga0070659_100000465 | Ga0070659_1000004652 | 114 |
| 10 | 3300005530 | Ga0070679_100964313 | Ga0070679_1009643132 | 114 |
| 11 | 3300005614 | Ga0068856_100000164 | Ga0068856_10000016411 | 114 |
| 12 | 3300005616 | Ga0068852_100184469 | Ga0068852_1001844692 | 114 |
| 13 | 3300009093 | Ga0105240_10275390 | Ga0105240_102753902 | 114 |
| 14 | 3300009545 | Ga0105237_10313934 | Ga0105237_103139342 | 114 |
| 15 | 3300013296 | Ga0157374_10038094 | Ga0157374_100380942 | 114 |
| 16 | 3300013296 | Ga0157374_10797743 | Ga0157374_107977432 | 114 |
| 17 | 3300013296 | Ga0157374_10992753 | Ga0157374_109927532 | 114 |
| 18 | 3300025231 | Ga0207427_100025 | Ga0207427_100025356 | 114 |
| 19 | 3300025233 | Ga0209437_100010 | Ga0209437_100010618 | 114 |
| 20 | 3300025261 | Ga0209233_1000017 | Ga0209233_1000017631 | 114 |
| 21 | 3300025909 | Ga0207705_10066674 | Ga0207705_100666742 | 114 |
| 22 | 3300025913 | Ga0207695_10498381 | Ga0207695_104983812 | 114 |
| 23 | 3300025919 | Ga0207657_10192820 | Ga0207657_101928202 | 114 |
| 24 | 3300025921 | Ga0207652_10874541 | Ga0207652_108745412 | 114 |
| 25 | 3300025932 | Ga0207690_10000669 | Ga0207690_1000066913 | 114 |
| 26 | 3300025949 | Ga0207667_10000266 | Ga0207667_1000026667 | 114 |
| 27 | 3300026078 | Ga0207702_10000262 | Ga0207702_1000026250 | 114 |
| 28 | 3300026142 | Ga0207698_10178811 | Ga0207698_101788112 | 114 |
| 29 | 3300028794 | Ga0307515_10059546 | Ga0307515_100595466 | 114 |
| 30 | 3300028800 | Ga0265338_10026846 | Ga0265338_100268463 | 114 |
| 31 | 3300047472 | Ga0495686_0124677 | Ga0495686_0124677_549_893 | 114 |
| 32 | 3300001904 | JGI24736J21556_1003095 | JGI24736J21556_10030952 | 115 |
| 33 | 3300001915 | JGI24741J21665_1027162 | JGI24741J21665_10271622 | 115 |
| 34 | 3300001979 | JGI24740J21852_10018282 | JGI24740J21852_100182822 | 115 |
| 35 | 3300001990 | JGI24737J22298_10000098 | JGI24737J22298_100000988 | 115 |
| 36 | 3300002067 | JGI24735J21928_10000009 | JGI24735J21928_1000000920 | 115 |
| 37 | 3300002067 | JGI24735J21928_10000036 | JGI24735J21928_1000003665 | 115 |
| 38 | 3300002067 | JGI24735J21928_10038630 | JGI24735J21928_100386302 | 115 |
| 39 | 3300002077 | JGI24744J21845_10005483 | JGI24744J21845_100054831 | 115 |
| 40 | 3300002737 | JGI25162J39368_1000005 | JGI25162J39368_1000005393 | 115 |
| 41 | 3300002737 | JGI25162J39368_1000527 | JGI25162J39368_100052715 | 115 |
| 42 | 3300003320 | rootH2_10002127 | rootH2_1000212716 | 115 |
| 43 | 3300003320 | rootH2_10073956 | rootH2_100739562 | 115 |
| 44 | 3300003320 | rootH2_10145839 | rootH2_101458392 | 115 |
| 45 | 3300003322 | rootL2_10101326 | rootL2_101013261 | 115 |
| 46 | 3300003323 | rootH1_10230029 | rootH1_102300293 | 115 |
| 47 | 3300003763 | Ga0055529_1013554 | Ga0055529_10135541 | 115 |
| 48 | 3300005327 | Ga0070658_10342314 | Ga0070658_103423142 | 115 |
| 49 | 3300005327 | Ga0070658_10605162 | Ga0070658_106051622 | 115 |
| 50 | 3300005328 | Ga0070676_10000283 | Ga0070676_100002838 | 115 |
| 51 | 3300005338 | Ga0068868_100030589 | Ga0068868_1000305892 | 115 |
| 52 | 3300005338 | Ga0068868_100077234 | Ga0068868_1000772342 | 115 |
| 53 | 3300005339 | Ga0070660_100089376 | Ga0070660_1000893762 | 115 |
| 54 | 3300005344 | Ga0070661_100363150 | Ga0070661_1003631502 | 115 |
| 55 | 3300005355 | Ga0070671_100024558 | Ga0070671_1000245584 | 115 |
| 56 | 3300005356 | Ga0070674_100548912 | Ga0070674_1005489121 | 115 |
| 57 | 3300005366 | Ga0070659_100049237 | Ga0070659_1000492373 | 115 |
| 58 | 3300005455 | Ga0070663_100118845 | Ga0070663_1001188451 | 115 |
| 59 | 3300005456 | Ga0070678_100008034 | Ga0070678_1000080343 | 115 |
| 60 | 3300005457 | Ga0070662_100001823 | Ga0070662_1000018232 | 115 |
| 61 | 3300005458 | Ga0070681_10100992 | Ga0070681_101009922 | 115 |
| 62 | 3300005458 | Ga0070681_10748826 | Ga0070681_107488262 | 115 |
| 63 | 3300005459 | Ga0068867_100000696 | Ga0068867_10000069614 | 115 |
| 64 | 3300005530 | Ga0070679_100004019 | Ga0070679_1000040192 | 115 |
| 65 | 3300005530 | Ga0070679_101096364 | Ga0070679_1010963642 | 115 |
| 66 | 3300005535 | Ga0070684_102371938 | Ga0070684_1023719381 | 115 |
| 67 | 3300005539 | Ga0068853_100028092 | Ga0068853_1000280922 | 115 |
| 68 | 3300005539 | Ga0068853_100194461 | Ga0068853_1001944612 | 115 |
| 69 | 3300005539 | Ga0068853_100576138 | Ga0068853_1005761382 | 115 |
| 70 | 3300005539 | Ga0068853_101369407 | Ga0068853_1013694072 | 115 |
| 71 | 3300005543 | Ga0070672_100059409 | Ga0070672_1000594092 | 115 |
| 72 | 3300005548 | Ga0070665_100000096 | Ga0070665_100000096134 | 115 |
| 73 | 3300005563 | Ga0068855_100003097 | Ga0068855_10000309711 | 115 |
| 74 | 3300005563 | Ga0068855_100003604 | Ga0068855_1000036048 | 115 |
| 75 | 3300005563 | Ga0068855_100023475 | Ga0068855_1000234756 | 115 |
| 76 | 3300005563 | Ga0068855_100250869 | Ga0068855_1002508692 | 115 |
| 77 | 3300005563 | Ga0068855_100859333 | Ga0068855_1008593331 | 115 |
| 78 | 3300005577 | Ga0068857_100040426 | Ga0068857_1000404265 | 115 |
| 79 | 3300005577 | Ga0068857_100378182 | Ga0068857_1003781822 | 115 |
| 80 | 3300005577 | Ga0068857_100416992 | Ga0068857_1004169922 | 115 |
| 81 | 3300005577 | Ga0068857_101024579 | Ga0068857_1010245792 | 115 |
| 82 | 3300005578 | Ga0068854_101483937 | Ga0068854_1014839372 | 115 |
| 83 | 3300005614 | Ga0068856_100282607 | Ga0068856_1002826072 | 115 |
| 84 | 3300005614 | Ga0068856_100612956 | Ga0068856_1006129562 | 115 |
| 85 | 3300005614 | Ga0068856_101012040 | Ga0068856_1010120402 | 115 |
| 86 | 3300005616 | Ga0068852_101241904 | Ga0068852_1012419041 | 115 |
| 87 | 3300005616 | Ga0068852_101391598 | Ga0068852_1013915981 | 115 |
| 88 | 3300005718 | Ga0068866_10023241 | Ga0068866_100232412 | 115 |
| 89 | 3300005718 | Ga0068866_10560440 | Ga0068866_105604402 | 115 |
| 90 | 3300005840 | Ga0068870_10360505 | Ga0068870_103605052 | 115 |
| 91 | 3300005841 | Ga0068863_101429734 | Ga0068863_1014297341 | 115 |
| 92 | 3300005842 | Ga0068858_100512063 | Ga0068858_1005120631 | 115 |
| 93 | 3300006195 | Ga0075366_10000170 | Ga0075366_1000017026 | 115 |
| 94 | 3300006195 | Ga0075366_10008109 | Ga0075366_100081094 | 115 |
| 95 | 3300006195 | Ga0075366_10038634 | Ga0075366_100386342 | 115 |
| 96 | 3300006195 | Ga0075366_10725671 | Ga0075366_107256712 | 115 |
| 97 | 3300006237 | Ga0097621_100001557 | Ga0097621_10000155714 | 115 |
| 98 | 3300006237 | Ga0097621_100928984 | Ga0097621_1009289841 | 115 |
| 99 | 3300006237 | Ga0097621_101064346 | Ga0097621_1010643461 | 115 |
| 100 | 3300006353 | Ga0075370_10140591 | Ga0075370_101405912 | 115 |
| 101 | 3300006353 | Ga0075370_10552812 | Ga0075370_105528122 | 115 |
| 102 | 3300006358 | Ga0068871_100001732 | Ga0068871_10000173213 | 115 |
| 103 | 3300006881 | Ga0068865_100000377 | Ga0068865_10000037714 | 115 |
| 104 | 3300006881 | Ga0068865_100854496 | Ga0068865_1008544962 | 115 |
| 105 | 3300009093 | Ga0105240_10002021 | Ga0105240_1000202127 | 115 |
| 106 | 3300009093 | Ga0105240_10008785 | Ga0105240_1000878510 | 115 |
| 107 | 3300009093 | Ga0105240_10015598 | Ga0105240_100155982 | 115 |
| 108 | 3300009093 | Ga0105240_10028966 | Ga0105240_100289662 | 115 |
| 109 | 3300009093 | Ga0105240_10115148 | Ga0105240_101151482 | 115 |
| 110 | 3300009093 | Ga0105240_10248868 | Ga0105240_102488682 | 115 |
| 111 | 3300009093 | Ga0105240_10572104 | Ga0105240_105721042 | 115 |
| 112 | 3300009093 | Ga0105240_11150195 | Ga0105240_111501952 | 115 |
| 113 | 3300009093 | Ga0105240_11367976 | Ga0105240_113679761 | 115 |
| 114 | 3300009093 | Ga0105240_12131410 | Ga0105240_121314101 | 115 |
| 115 | 3300009098 | Ga0105245_10233862 | Ga0105245_102338622 | 115 |
| 116 | 3300009098 | Ga0105245_10307359 | Ga0105245_103073592 | 115 |
| 117 | 3300009148 | Ga0105243_10053814 | Ga0105243_100538143 | 115 |
| 118 | 3300009174 | Ga0105241_10002990 | Ga0105241_1000299010 | 115 |
| 119 | 3300009174 | Ga0105241_10074540 | Ga0105241_100745402 | 115 |
| 120 | 3300009174 | Ga0105241_10193351 | Ga0105241_101933512 | 115 |
| 121 | 3300009174 | Ga0105241_10287088 | Ga0105241_102870881 | 115 |
| 122 | 3300009174 | Ga0105241_10306100 | Ga0105241_103061001 | 115 |
| 123 | 3300009176 | Ga0105242_10073991 | Ga0105242_100739912 | 115 |
| 124 | 3300009545 | Ga0105237_10000762 | Ga0105237_100007625 | 115 |
| 125 | 3300009545 | Ga0105237_10001136 | Ga0105237_1000113623 | 115 |
| 126 | 3300009545 | Ga0105237_10008171 | Ga0105237_100081718 | 115 |
| 127 | 3300009545 | Ga0105237_10008218 | Ga0105237_100082181 | 115 |
| 128 | 3300009545 | Ga0105237_10008779 | Ga0105237_100087791 | 115 |
| 129 | 3300009545 | Ga0105237_10588050 | Ga0105237_105880502 | 115 |
| 130 | 3300009545 | Ga0105237_10716814 | Ga0105237_107168142 | 115 |
| 131 | 3300009545 | Ga0105237_11204401 | Ga0105237_112044012 | 115 |
| 132 | 3300009551 | Ga0105238_10003629 | Ga0105238_100036295 | 115 |
| 133 | 3300009551 | Ga0105238_10092340 | Ga0105238_100923402 | 115 |
| 134 | 3300009551 | Ga0105238_12554036 | Ga0105238_125540361 | 115 |
| 135 | 3300009551 | Ga0105238_12565896 | Ga0105238_125658962 | 115 |
| 136 | 3300010375 | Ga0105239_10000004 | Ga0105239_1000000418 | 115 |
| 137 | 3300010375 | Ga0105239_10000015 | Ga0105239_10000015241 | 115 |
| 138 | 3300010375 | Ga0105239_10000655 | Ga0105239_1000065520 | 115 |
| 139 | 3300010375 | Ga0105239_10004803 | Ga0105239_100048039 | 115 |
| 140 | 3300010375 | Ga0105239_10012919 | Ga0105239_100129194 | 115 |
| 141 | 3300010375 | Ga0105239_10026197 | Ga0105239_100261974 | 115 |
| 142 | 3300010375 | Ga0105239_10074842 | Ga0105239_100748423 | 115 |
| 143 | 3300010375 | Ga0105239_10144792 | Ga0105239_101447922 | 115 |
| 144 | 3300010375 | Ga0105239_10154939 | Ga0105239_101549392 | 115 |
| 145 | 3300011119 | Ga0105246_10248354 | Ga0105246_102483542 | 115 |
| 146 | 3300013100 | Ga0157373_10009645 | Ga0157373_100096457 | 115 |
| 147 | 3300013100 | Ga0157373_10573990 | Ga0157373_105739901 | 115 |
| 148 | 3300013102 | Ga0157371_10004364 | Ga0157371_100043645 | 115 |
| 149 | 3300013102 | Ga0157371_10004859 | Ga0157371_100048594 | 115 |
| 150 | 3300013102 | Ga0157371_10169604 | Ga0157371_101696041 | 115 |
| 151 | 3300013102 | Ga0157371_10755840 | Ga0157371_107558402 | 115 |
| 152 | 3300013102 | Ga0157371_11193541 | Ga0157371_111935411 | 115 |
| 153 | 3300013104 | Ga0157370_10013983 | Ga0157370_100139837 | 115 |
| 154 | 3300013104 | Ga0157370_10601563 | Ga0157370_106015632 | 115 |
| 155 | 3300013104 | Ga0157370_11277864 | Ga0157370_112778641 | 115 |
| 156 | 3300013105 | Ga0157369_10002582 | Ga0157369_1000258225 | 115 |
| 157 | 3300013105 | Ga0157369_10418939 | Ga0157369_104189392 | 115 |
| 158 | 3300013105 | Ga0157369_10533992 | Ga0157369_105339922 | 115 |
| 159 | 3300013105 | Ga0157369_11025223 | Ga0157369_110252232 | 115 |
| 160 | 3300013105 | Ga0157369_11235094 | Ga0157369_112350942 | 115 |
| 161 | 3300013296 | Ga0157374_10012002 | Ga0157374_100120025 | 115 |
| 162 | 3300013296 | Ga0157374_10670060 | Ga0157374_106700602 | 115 |
| 163 | 3300013296 | Ga0157374_10732300 | Ga0157374_107323002 | 115 |
| 164 | 3300013296 | Ga0157374_11270549 | Ga0157374_112705492 | 115 |
| 165 | 3300013296 | Ga0157374_11978654 | Ga0157374_119786541 | 115 |
| 166 | 3300013297 | Ga0157378_10129392 | Ga0157378_101293922 | 115 |
| 167 | 3300013297 | Ga0157378_10267338 | Ga0157378_102673382 | 115 |
| 168 | 3300013297 | Ga0157378_13289017 | Ga0157378_132890172 | 115 |
| 169 | 3300013306 | Ga0163162_10000005 | Ga0163162_10000005253 | 115 |
| 170 | 3300013306 | Ga0163162_10017567 | Ga0163162_100175672 | 115 |
| 171 | 3300013306 | Ga0163162_10128747 | Ga0163162_101287472 | 115 |
| 172 | 3300013307 | Ga0157372_10000030 | Ga0157372_1000003063 | 115 |
| 173 | 3300013307 | Ga0157372_10001737 | Ga0157372_100017373 | 115 |
| 174 | 3300013307 | Ga0157372_10015310 | Ga0157372_100153104 | 115 |
| 175 | 3300013307 | Ga0157372_10018963 | Ga0157372_100189635 | 115 |
| 176 | 3300013307 | Ga0157372_10136319 | Ga0157372_101363192 | 115 |
| 177 | 3300013307 | Ga0157372_10298437 | Ga0157372_102984372 | 115 |
| 178 | 3300013308 | Ga0157375_10057947 | Ga0157375_100579472 | 115 |
| 179 | 3300013308 | Ga0157375_10710653 | Ga0157375_107106532 | 115 |
| 180 | 3300014745 | Ga0157377_10010093 | Ga0157377_100100933 | 115 |
| 181 | 3300014969 | Ga0157376_11599164 | Ga0157376_115991642 | 115 |
| 182 | 3300017792 | Ga0163161_10004267 | Ga0163161_100042677 | 115 |
| 183 | 3300017792 | Ga0163161_10787915 | Ga0163161_107879151 | 115 |
| 184 | 3300020077 | Ga0206351_10627478 | Ga0206351_106274782 | 115 |
| 185 | 3300025233 | Ga0209437_100043 | Ga0209437_10004315 | 115 |
| 186 | 3300025250 | Ga0209026_1000310 | Ga0209026_100031012 | 115 |
| 187 | 3300025250 | Ga0209026_1004191 | Ga0209026_10041912 | 115 |
| 188 | 3300025250 | Ga0209026_1032827 | Ga0209026_10328271 | 115 |
| 189 | 3300025258 | Ga0209129_1006299 | Ga0209129_10062992 | 115 |
| 190 | 3300025261 | Ga0209233_1000685 | Ga0209233_10006856 | 115 |
| 191 | 3300025261 | Ga0209233_1006175 | Ga0209233_10061755 | 115 |
| 192 | 3300025261 | Ga0209233_1020942 | Ga0209233_10209422 | 115 |
| 193 | 3300025272 | Ga0209455_1003999 | Ga0209455_10039992 | 115 |
| 194 | 3300025899 | Ga0207642_10023966 | Ga0207642_100239662 | 115 |
| 195 | 3300025904 | Ga0207647_10000206 | Ga0207647_1000020646 | 115 |
| 196 | 3300025904 | Ga0207647_10002696 | Ga0207647_1000269611 | 115 |
| 197 | 3300025904 | Ga0207647_10058022 | Ga0207647_100580222 | 115 |
| 198 | 3300025904 | Ga0207647_10141433 | Ga0207647_101414332 | 115 |
| 199 | 3300025907 | Ga0207645_10000035 | Ga0207645_1000003514 | 115 |
| 200 | 3300025908 | Ga0207643_10453511 | Ga0207643_104535112 | 115 |
| 201 | 3300025909 | Ga0207705_10219097 | Ga0207705_102190972 | 115 |
| 202 | 3300025909 | Ga0207705_10571397 | Ga0207705_105713972 | 115 |
| 203 | 3300025911 | Ga0207654_10007566 | Ga0207654_100075662 | 115 |
| 204 | 3300025911 | Ga0207654_10062787 | Ga0207654_100627872 | 115 |
| 205 | 3300025911 | Ga0207654_10199474 | Ga0207654_101994742 | 115 |
| 206 | 3300025911 | Ga0207654_11380531 | Ga0207654_113805311 | 115 |
| 207 | 3300025912 | Ga0207707_10636481 | Ga0207707_106364812 | 115 |
| 208 | 3300025913 | Ga0207695_10000142 | Ga0207695_10000142109 | 115 |
| 209 | 3300025913 | Ga0207695_10007936 | Ga0207695_100079366 | 115 |
| 210 | 3300025913 | Ga0207695_10012264 | Ga0207695_100122642 | 115 |
| 211 | 3300025913 | Ga0207695_10082657 | Ga0207695_100826576 | 115 |
| 212 | 3300025913 | Ga0207695_10457407 | Ga0207695_104574072 | 115 |
| 213 | 3300025913 | Ga0207695_10488929 | Ga0207695_104889292 | 115 |
| 214 | 3300025914 | Ga0207671_10000110 | Ga0207671_1000011090 | 115 |
| 215 | 3300025914 | Ga0207671_10004130 | Ga0207671_1000413013 | 115 |
| 216 | 3300025914 | Ga0207671_10005696 | Ga0207671_100056961 | 115 |
| 217 | 3300025914 | Ga0207671_10012608 | Ga0207671_100126082 | 115 |
| 218 | 3300025914 | Ga0207671_10022184 | Ga0207671_100221843 | 115 |
| 219 | 3300025914 | Ga0207671_11432140 | Ga0207671_114321401 | 115 |
| 220 | 3300025917 | Ga0207660_10007385 | Ga0207660_100073852 | 115 |
| 221 | 3300025919 | Ga0207657_10094397 | Ga0207657_100943972 | 115 |
| 222 | 3300025920 | Ga0207649_10654949 | Ga0207649_106549492 | 115 |
| 223 | 3300025921 | Ga0207652_10013033 | Ga0207652_100130339 | 115 |
| 224 | 3300025924 | Ga0207694_10180922 | Ga0207694_101809222 | 115 |
| 225 | 3300025931 | Ga0207644_10009586 | Ga0207644_100095862 | 115 |
| 226 | 3300025932 | Ga0207690_10108059 | Ga0207690_101080593 | 115 |
| 227 | 3300025933 | Ga0207706_10000246 | Ga0207706_100002462 | 115 |
| 228 | 3300025933 | Ga0207706_10267228 | Ga0207706_102672282 | 115 |
| 229 | 3300025935 | Ga0207709_10011898 | Ga0207709_100118982 | 115 |
| 230 | 3300025937 | Ga0207669_10503522 | Ga0207669_105035221 | 115 |
| 231 | 3300025938 | Ga0207704_10002980 | Ga0207704_100029802 | 115 |
| 232 | 3300025938 | Ga0207704_10435533 | Ga0207704_104355332 | 115 |
| 233 | 3300025938 | Ga0207704_10839086 | Ga0207704_108390861 | 115 |
| 234 | 3300025939 | Ga0207665_10717831 | Ga0207665_107178311 | 115 |
| 235 | 3300025940 | Ga0207691_10075943 | Ga0207691_100759432 | 115 |
| 236 | 3300025949 | Ga0207667_10001136 | Ga0207667_1000113617 | 115 |
| 237 | 3300025949 | Ga0207667_10018471 | Ga0207667_100184713 | 115 |
| 238 | 3300025949 | Ga0207667_10039320 | Ga0207667_100393202 | 115 |
| 239 | 3300025949 | Ga0207667_10049435 | Ga0207667_100494352 | 115 |
| 240 | 3300025949 | Ga0207667_10231097 | Ga0207667_102310972 | 115 |
| 241 | 3300025949 | Ga0207667_11103862 | Ga0207667_111038622 | 115 |
| 242 | 3300025960 | Ga0207651_10203052 | Ga0207651_102030522 | 115 |
| 243 | 3300026023 | Ga0207677_10074138 | Ga0207677_100741382 | 115 |
| 244 | 3300026023 | Ga0207677_10100189 | Ga0207677_101001892 | 115 |
| 245 | 3300026035 | Ga0207703_11413327 | Ga0207703_114133271 | 115 |
| 246 | 3300026041 | Ga0207639_10589208 | Ga0207639_105892081 | 115 |
| 247 | 3300026041 | Ga0207639_10967303 | Ga0207639_109673031 | 115 |
| 248 | 3300026041 | Ga0207639_11872496 | Ga0207639_118724961 | 115 |
| 249 | 3300026067 | Ga0207678_10213285 | Ga0207678_102132852 | 115 |
| 250 | 3300026078 | Ga0207702_10529496 | Ga0207702_105294962 | 115 |
| 251 | 3300026088 | Ga0207641_11385911 | Ga0207641_113859111 | 115 |
| 252 | 3300026089 | Ga0207648_10004436 | Ga0207648_100044362 | 115 |
| 253 | 3300026116 | Ga0207674_10120082 | Ga0207674_101200822 | 115 |
| 254 | 3300026116 | Ga0207674_10422473 | Ga0207674_104224732 | 115 |
| 255 | 3300026121 | Ga0207683_10015828 | Ga0207683_100158284 | 115 |
| 256 | 3300026142 | Ga0207698_11239168 | Ga0207698_112391681 | 115 |
| 257 | 3300028379 | Ga0268266_10000032 | Ga0268266_1000003247 | 115 |
| 258 | 3300028786 | Ga0307517_10004407 | Ga0307517_1000440727 | 115 |
| 259 | 3300028794 | Ga0307515_10001308 | Ga0307515_100013087 | 115 |
| 260 | 3300028800 | Ga0265338_10282331 | Ga0265338_102823312 | 115 |
| 261 | 3300031507 | Ga0307509_10393926 | Ga0307509_103939262 | 115 |
| 262 | 3300031730 | Ga0307516_10734271 | Ga0307516_107342712 | 115 |
| 263 | 3300031911 | Ga0307412_11364502 | Ga0307412_113645021 | 115 |
| 264 | 3300033179 | Ga0307507_10000309 | Ga0307507_1000030914 | 115 |
| 265 | 3300033180 | Ga0307510_10000366 | Ga0307510_1000036619 | 115 |
| 266 | 3300037312 | Ga0395899_0000034 | Ga0395899_0000034_55716_56063 | 115 |
| 267 | 3300037312 | Ga0395899_0000199 | Ga0395899_0000199_10842_11192 | 115 |
| 268 | 3300037312 | Ga0395899_0000201 | Ga0395899_0000201_75591_75938 | 115 |
| 269 | 3300037418 | Ga0395900_0000157 | Ga0395900_0000157_99179_99529 | 115 |
| 270 | 3300037418 | Ga0395900_0607078 | Ga0395900_0607078_502_849 | 115 |
| 271 | 3300037466 | Ga0395898_0003116 | Ga0395898_0003116_12588_12938 | 115 |
| 272 | 3300037471 | Ga0395905_0000195 | Ga0395905_0000195_12585_12935 | 115 |
| 273 | 3300037471 | Ga0395905_1002887 | Ga0395905_1002887_90_437 | 115 |
| 274 | 3300038443 | Ga0395901_0000283 | Ga0395901_0000283_49959_50309 | 115 |
| 275 | 3300038443 | Ga0395901_0120011 | Ga0395901_0120011_1801_2148 | 115 |
| 276 | 3300039447 | Ga0436361_0401394 | Ga0436361_0401394_3542_3889 | 115 |
| 277 | 3300039447 | Ga0436361_0572910 | Ga0436361_0572910_194_547 | 115 |
| 278 | 3300041452 | Ga0451793_0547719 | Ga0451793_0547719_47_397 | 115 |
| 279 | 3300041456 | Ga0451795_0883339 | Ga0451795_0883339_177_527 | 115 |
| 280 | 3300041486 | Ga0451807_1676689 | Ga0451807_1676689_16_363 | 115 |
| 281 | 3300041507 | Ga0451851_1268722 | Ga0451851_1268722_77_427 | 115 |
| 282 | 3300044656 | Ga0466969_0069927 | Ga0466969_0069927_1243_1590 | 115 |
| 283 | 3300044684 | Ga0466966_0019674 | Ga0466966_0019674_3222_3569 | 115 |
| 284 | 3300044684 | Ga0466966_0153009 | Ga0466966_0153009_984_1331 | 115 |
| 285 | 3300044693 | Ga0466961_0096596 | Ga0466961_0096596_373_720 | 115 |
| 286 | 3300045049 | Ga0466959_0414009 | Ga0466959_0414009_526_873 | 115 |
| 287 | 3300045836 | Ga0466958_0097949 | Ga0466958_0097949_865_1212 | 115 |
| 288 | 3300046454 | Ga0495592_0161769 | Ga0495592_0161769_1001_1348 | 115 |
| 289 | 3300046461 | Ga0495641_0534216 | Ga0495641_0534216_79_429 | 115 |
| 290 | 3300046462 | Ga0495651_0227333 | Ga0495651_0227333_866_1213 | 115 |
| 291 | 3300046471 | Ga0495650_0000447 | Ga0495650_0000447_15207_15557 | 115 |
| 292 | 3300046471 | Ga0495650_0033928 | Ga0495650_0033928_1407_1757 | 115 |
| 293 | 3300046492 | Ga0495585_0000116 | Ga0495585_0000116_80770_81120 | 115 |
| 294 | 3300046492 | Ga0495585_0000658 | Ga0495585_0000658_26204_26554 | 115 |
| 295 | 3300046500 | Ga0495596_0104241 | Ga0495596_0104241_619_966 | 115 |
| 296 | 3300046506 | Ga0495583_0079273 | Ga0495583_0079273_316_666 | 115 |
| 297 | 3300046507 | Ga0495606_0000844 | Ga0495606_0000844_2347_2697 | 115 |
| 298 | 3300046507 | Ga0495606_0004887 | Ga0495606_0004887_3871_4218 | 115 |
| 299 | 3300046507 | Ga0495606_0005006 | Ga0495606_0005006_5212_5562 | 115 |
| 300 | 3300046507 | Ga0495606_0018248 | Ga0495606_0018248_1926_2276 | 115 |
| 301 | 3300046507 | Ga0495606_0152378 | Ga0495606_0152378_298_648 | 115 |
| 302 | 3300046512 | Ga0495610_0025468 | Ga0495610_0025468_2316_2666 | 115 |
| 303 | 3300046513 | Ga0495616_0000538 | Ga0495616_0000538_15187_15537 | 115 |
| 304 | 3300046513 | Ga0495616_0003682 | Ga0495616_0003682_4639_4989 | 115 |
| 305 | 3300046518 | Ga0495631_0036199 | Ga0495631_0036199_1181_1528 | 115 |
| 306 | 3300046518 | Ga0495631_0148678 | Ga0495631_0148678_525_875 | 115 |
| 307 | 3300046523 | Ga0495644_0011232 | Ga0495644_0011232_616_963 | 115 |
| 308 | 3300046524 | Ga0495648_0014307 | Ga0495648_0014307_5141_5491 | 115 |
| 309 | 3300046524 | Ga0495648_0063408 | Ga0495648_0063408_1627_1977 | 115 |
| 310 | 3300046528 | Ga0495642_0264928 | Ga0495642_0264928_27_374 | 115 |
| 311 | 3300046529 | Ga0495652_0153469 | Ga0495652_0153469_1277_1624 | 115 |
| 312 | 3300046529 | Ga0495652_0256565 | Ga0495652_0256565_379_729 | 115 |
| 313 | 3300046538 | Ga0495609_0017608 | Ga0495609_0017608_2355_2705 | 115 |
| 314 | 3300046558 | Ga0495633_0000026 | Ga0495633_0000026_135066_135416 | 115 |
| 315 | 3300046558 | Ga0495633_0003682 | Ga0495633_0003682_3300_3650 | 115 |
| 316 | 3300046616 | Ga0495668_0000054 | Ga0495668_0000054_104921_105271 | 115 |
| 317 | 3300046648 | Ga0495611_0023748 | Ga0495611_0023748_1959_2309 | 115 |
| 318 | 3300046660 | Ga0495625_0000972 | Ga0495625_0000972_22526_22876 | 115 |
| 319 | 3300046660 | Ga0495625_0003592 | Ga0495625_0003592_12279_12629 | 115 |
| 320 | 3300046660 | Ga0495625_0006420 | Ga0495625_0006420_2527_2877 | 115 |
| 321 | 3300046660 | Ga0495625_0066711 | Ga0495625_0066711_826_1176 | 115 |
| 322 | 3300046660 | Ga0495625_0111254 | Ga0495625_0111254_502_849 | 115 |
| 323 | 3300046660 | Ga0495625_0220855 | Ga0495625_0220855_101_448 | 115 |
| 324 | 3300046665 | Ga0495661_0007204 | Ga0495661_0007204_2322_2669 | 115 |
| 325 | 3300046665 | Ga0495661_0017852 | Ga0495661_0017852_1162_1509 | 115 |
| 326 | 3300046665 | Ga0495661_0019448 | Ga0495661_0019448_3756_4106 | 115 |
| 327 | 3300046665 | Ga0495661_0300965 | Ga0495661_0300965_351_701 | 115 |
| 328 | 3300046665 | Ga0495661_0507618 | Ga0495661_0507618_201_548 | 115 |
| 329 | 3300046691 | Ga0495670_0114476 | Ga0495670_0114476_361_711 | 115 |
| 330 | 3300046694 | Ga0495649_0000014 | Ga0495649_0000014_264599_264949 | 115 |
| 331 | 3300046810 | Ga0495660_0021758 | Ga0495660_0021758_711_1061 | 115 |
| 332 | 3300046810 | Ga0495660_0096988 | Ga0495660_0096988_893_1243 | 115 |
| 333 | 3300047443 | Ga0495687_001035 | Ga0495687_001035_92_442 | 115 |
| 334 | 3300047443 | Ga0495687_001403 | Ga0495687_001403_836_1189 | 115 |
| 335 | 3300047445 | Ga0495677_0022844 | Ga0495677_0022844_997_1344 | 115 |
| 336 | 3300047447 | Ga0495685_038870 | Ga0495685_038870_138_485 | 115 |
| 337 | 3300047469 | Ga0495673_0018223 | Ga0495673_0018223_72_422 | 115 |
| 338 | 3300047472 | Ga0495686_0000913 | Ga0495686_0000913_6816_7166 | 115 |
| 339 | 3300047472 | Ga0495686_0032008 | Ga0495686_0032008_1612_1962 | 115 |
| 340 | 3300047472 | Ga0495686_0099175 | Ga0495686_0099175_664_1014 | 115 |
| 341 | 3300047472 | Ga0495686_0134197 | Ga0495686_0134197_23_370 | 115 |
| 342 | 3300047472 | Ga0495686_0190269 | Ga0495686_0190269_379_729 | 115 |
| 343 | 3300047472 | Ga0495686_0255454 | Ga0495686_0255454_344_691 | 115 |
| 344 | 3300049459 | Ga0495678_005816 | Ga0495678_005816_1995_2345 | 115 |
| 345 | 3300050493 | nmdc:mga0k408_6028_c1 | nmdc:mga0k408_6028_c1_2132_2482 | 115 |
| 346 | 3300050493 | nmdc:mga0k408_82_c1 | nmdc:mga0k408_82_c1_20680_21030 | 115 |
| 347 | 3300050496 | nmdc:mga07m45_172446_c1 | nmdc:mga07m45_172446_c1_187_537 | 115 |
| 348 | 3300050496 | nmdc:mga07m45_397544_c1 | nmdc:mga07m45_397544_c1_163_516 | 115 |
| 349 | 3300053080 | Ga0500635_0007513 | Ga0500635_0007513_1158_1505 | 115 |
| 350 | 3300053118 | Ga0500594_0340618 | Ga0500594_0340618_130_480 | 115 |
| 351 | 3300053122 | Ga0500608_005547 | Ga0500608_005547_2542_2892 | 115 |
| 352 | 3300053123 | Ga0500614_048793 | Ga0500614_048793_340_690 | 115 |
| 353 | 3300053125 | Ga0500618_000005 | Ga0500618_000005_2573_2923 | 115 |
| 354 | 3300053130 | Ga0500642_0106188 | Ga0500642_0106188_438_785 | 115 |
| 355 | 3300053138 | Ga0500564_175839 | Ga0500564_175839_265_615 | 115 |
| 356 | 3300053153 | Ga0500616_0164664 | Ga0500616_0164664_546_896 | 115 |
| 357 | 3300053156 | Ga0500622_0002780 | Ga0500622_0002780_2861_3214 | 115 |
| 358 | 3300053157 | Ga0500624_000133 | Ga0500624_000133_6021_6371 | 115 |
| 359 | 3300053161 | Ga0500634_0140251 | Ga0500634_0140251_702_1052 | 115 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tou-assembly1.cif.gz_B | crystal structure of glutathione transferase (target efi-501058) from ralstonia solanacearum gmi1000 with gsh bound | 0.9676 | 2 | 28 |
| 7q6k-assembly1.cif.gz_A-2 | crystal structure of the human gdap1 cmt2 mutant-r120w | 0.9594 | 2 | 30 |
| 8exz-assembly1.cif.gz_A | structure of gdap1 containing cmt mutant t157p | 0.959 | 2 | 30 |
| 6nxv-assembly4.cif.gz_D | crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form | 0.9582 | 2 | 30 |
| 1rw1-assembly1.cif.gz_A | yffb (pa3664) protein | 0.9559 | 2 | 111 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4D776_60_147_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9726 | 2 | 30 | 3.40.30.10 |
| 4ke3D01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9716 | 2 | 29 | 3.40.30.10 |
| af_Q9FHX0_75_159_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9708 | 2 | 30 | 3.40.30.10 |
| 3touB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9676 | 2 | 28 | 3.40.30.10 |
| 3touA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9672 | 2 | 28 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W9XLX5-F1-model_v4 | Spx/MgsR family transcriptional regulator | 0.9831 | 2 | 114 |
|
| AF-A0A270BW18-F1-model_v4 | ArsC family reductase | 0.9785 | 2 | 112 |
|
| AF-A0A366L0C5-F1-model_v4 | Arsenate reductase | 0.9781 | 2 | 115 |
|
| AF-A0A401JFT5-F1-model_v4 | Glutathione-dependent thiol reductase | 0.9757 | 2 | 111 |
|
| AF-A0A511B3D3-F1-model_v4 | Arsenate reductase | 0.9739 | 2 | 114 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar