F421278

General Info

Members Datasets Scaffolds Average Seq Length
358 233 355 136

Family's Representative Sequence

Representative Sequence 3300046473|Ga0495582_0099205|Ga0495582_0099205_49_495
Length 148
Sequence VNAAITPPSHEEDTMAKYLLLKHYRGAPAPVNDVPMDRWQPDEVEDHIRFMQEFAARLEASGEFVDAQALAPEGVWVRSDGEGSPPVDGPFAETKDLIAGWMVIDVDSYERAIELAGELSAAPGAGGEPIHEWLELRPFMAAPPTVTE

Samples

Sample ID Description Type Environment
1 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
2 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
127 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
128 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
129 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
132 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
133 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
227 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
228 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
233 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.59
Nodule 0
Rhizoplane 7.54
Rhizosphere 82.4
Stem 0
Stem Tuber 0
Unclassified 4.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10029238 3300002239 Bacteria 892
2 Ga0070676_10757939 3300005328 Bacteria 713
3 Ga0070670_100459815 3300005331 Bacteria 1129
4 Ga0070670_100633753 3300005331 Bacteria 958
5 Ga0068868_101597426 3300005338 Bacteria 613
6 Ga0070689_101986980 3300005340 Bacteria 532
7 Ga0070687_100778403 3300005343 Bacteria 676
8 Ga0070687_101323373 3300005343 Bacteria 536
9 Ga0070668_100160318 3300005347 Bacteria 1825
10 Ga0070669_100147921 3300005353 Bacteria 1816
11 Ga0070675_100086983 3300005354 Bacteria 2613
12 Ga0070675_100466736 3300005354 Bacteria 1134
13 Ga0070671_100069984 3300005355 Bacteria 2927
14 Ga0070673_101334383 3300005364 Bacteria 674
15 Ga0070688_100646302 3300005365 Bacteria 814
16 Ga0070667_100025713 3300005367 Bacteria 4896
17 Ga0070667_100847466 3300005367 Bacteria 850
18 Ga0070667_101134956 3300005367 Bacteria 731
19 Ga0070714_100105381 3300005435 Bacteria 2489
20 Ga0070700_100330609 3300005441 Bacteria 1123
21 Ga0070700_100661873 3300005441 Bacteria 826
22 Ga0070663_100001060 3300005455 Bacteria 15053
23 Ga0070678_100320421 3300005456 Bacteria 1324
24 Ga0070685_10479088 3300005466 Bacteria 877
25 Ga0070685_10752261 3300005466 Bacteria 715
26 Ga0070707_101778654 3300005468 Bacteria 583
27 Ga0070698_101378888 3300005471 Bacteria 656
28 Ga0070699_100653907 3300005518 Bacteria 959
29 Ga0070684_100808067 3300005535 Bacteria 877
30 Ga0070684_101026442 3300005535 Bacteria 774
31 Ga0070684_101449921 3300005535 Bacteria 647
32 Ga0070672_100689903 3300005543 Bacteria 894
33 Ga0070665_100814451 3300005548 Bacteria 947
34 Ga0070665_102045098 3300005548 Bacteria 578
35 Ga0070664_101597261 3300005564 Bacteria 618
36 Ga0068864_100709348 3300005618 Bacteria 983
37 Ga0068866_10986208 3300005718 Bacteria 598
38 Ga0068863_100033366 3300005841 Bacteria 4904
39 Ga0068863_100036821 3300005841 Bacteria 4660
40 Ga0068858_100057891 3300005842 Bacteria 3582
41 Ga0068858_101019772 3300005842 Bacteria 811
42 Ga0068860_100011195 3300005843 Bacteria 8841
43 Ga0068860_100229051 3300005843 Bacteria 1806
44 Ga0068860_100500855 3300005843 Bacteria 1212
45 Ga0068860_100963027 3300005843 Bacteria 871
46 Ga0081455_10026530 3300005937 Bacteria 5324
47 Ga0081455_10840906 3300005937 Bacteria 574
48 Ga0075365_10041144 3300006038 Bacteria 3018
49 Ga0075363_100008753 3300006048 Bacteria 4730
50 Ga0075363_100950857 3300006048 Bacteria 528
51 Ga0075364_10069633 3300006051 Bacteria 2315
52 Ga0075369_10173395 3300006186 Bacteria 991
53 Ga0075370_10924386 3300006353 Bacteria 534
54 Ga0075428_100000027 3300006844 Bacteria 123143
55 Ga0075428_100283174 3300006844 Bacteria 1783
56 Ga0075428_100421150 3300006844 Bacteria 1431
57 Ga0075428_100813563 3300006844 Bacteria 993
58 Ga0075430_100160000 3300006846 Bacteria 1874
59 Ga0075431_100189226 3300006847 Bacteria 2109
60 Ga0099794_10570918 3300007265 Bacteria 598
61 Ga0105244_10483904 3300009036 Bacteria 569
62 Ga0111539_10640143 3300009094 Bacteria 1238
63 Ga0111539_10894238 3300009094 Bacteria 1033
64 Ga0105245_10696415 3300009098 Bacteria 1049
65 Ga0114129_10795188 3300009147 Bacteria 1207
66 Ga0114129_10847095 3300009147 Bacteria 1163
67 Ga0114129_12361625 3300009147 Bacteria 637
68 Ga0105243_10503048 3300009148 Bacteria 1149
69 Ga0105242_10305516 3300009176 Bacteria 1453
70 Ga0105242_12448012 3300009176 Bacteria 570
71 Ga0105248_10195844 3300009177 Bacteria 2277
72 Ga0105238_11226122 3300009551 Bacteria 775
73 Ga0105249_10051126 3300009553 Bacteria 3769
74 Ga0105249_10065681 3300009553 Bacteria 3338
75 Ga0105239_11523672 3300010375 Bacteria 773
76 Ga0105239_12404683 3300010375 Bacteria 614
77 Ga0105239_12484991 3300010375 Bacteria 604
78 Ga0105246_10621537 3300011119 Bacteria 936
79 Ga0157341_1026068 3300012494 Bacteria 606
80 Ga0157370_11866553 3300013104 Bacteria 539
81 Ga0157369_10954962 3300013105 Bacteria 878
82 Ga0157378_10901865 3300013297 Bacteria 915
83 Ga0157378_11048242 3300013297 Bacteria 851
84 Ga0163162_10543462 3300013306 Bacteria 1290
85 Ga0157375_11418844 3300013308 Bacteria 818
86 Ga0157375_13433614 3300013308 Bacteria 527
87 Ga0163163_10008913 3300014325 Bacteria 8937
88 Ga0157380_10602896 3300014326 Bacteria 1087
89 Ga0157380_10770913 3300014326 Bacteria 976
90 Ga0182008_10630487 3300014497 Bacteria 605
91 Ga0157377_10202444 3300014745 Bacteria 1261
92 Ga0157377_11414497 3300014745 Bacteria 549
93 Ga0157379_11452836 3300014968 Bacteria 666
94 Ga0157376_10997558 3300014969 Bacteria 860
95 Ga0213876_10017552 3300021384 Bacteria 3778
96 Ga0213876_10088338 3300021384 Bacteria 1641
97 Ga0207696_1060584 3300025711 Bacteria 1065
98 Ga0207710_10346370 3300025900 Bacteria 756
99 Ga0207645_11230347 3300025907 Bacteria 502
100 Ga0207684_10165502 3300025910 Bacteria 1905
101 Ga0207662_10769061 3300025918 Bacteria 678
102 Ga0207652_10423442 3300025921 Bacteria 1201
103 Ga0207646_10315167 3300025922 Bacteria 1413
104 Ga0207681_10285682 3300025923 Bacteria 1301
105 Ga0207650_10990535 3300025925 Bacteria 715
106 Ga0207659_10448388 3300025926 Bacteria 1086
107 Ga0207659_11106245 3300025926 Bacteria 682
108 Ga0207700_10248451 3300025928 Bacteria 1519
109 Ga0207644_10213371 3300025931 Bacteria 1527
110 Ga0207644_10518308 3300025931 Bacteria 985
111 Ga0207690_10817127 3300025932 Bacteria 771
112 Ga0207706_11406459 3300025933 Bacteria 573
113 Ga0207686_10496275 3300025934 Bacteria 946
114 Ga0207669_10150667 3300025937 Bacteria 1629
115 Ga0207665_10165250 3300025939 Bacteria 1595
116 Ga0207661_11010503 3300025944 Bacteria 766
117 Ga0207667_10245816 3300025949 Bacteria 1831
118 Ga0207651_10751138 3300025960 Bacteria 862
119 Ga0207712_10232771 3300025961 Bacteria 1480
120 Ga0207712_10249880 3300025961 Bacteria 1433
121 Ga0207668_10099937 3300025972 Bacteria 2153
122 Ga0207668_11894952 3300025972 Bacteria 538
123 Ga0207658_10178535 3300025986 Bacteria 1755
124 Ga0207677_10347588 3300026023 Bacteria 1241
125 Ga0207703_10195773 3300026035 Bacteria 1793
126 Ga0207703_10315287 3300026035 Bacteria 1430
127 Ga0207678_10001206 3300026067 Bacteria 23747
128 Ga0207678_11078123 3300026067 Bacteria 711
129 Ga0207708_10200844 3300026075 Bacteria 1591
130 Ga0207648_12008875 3300026089 Bacteria 539
131 Ga0207674_11633442 3300026116 Bacteria 613
132 Ga0207674_11688045 3300026116 Bacteria 602
133 Ga0207675_100429178 3300026118 Bacteria 1306
134 Ga0207675_101396875 3300026118 Bacteria 721
135 Ga0207683_10461836 3300026121 Bacteria 1171
136 Ga0207683_11025161 3300026121 Bacteria 766
137 Ga0209813_10395620 3300027866 Bacteria 556
138 Ga0268265_11740482 3300028380 Bacteria 629
139 Ga0268265_12642474 3300028380 Bacteria 508
140 Ga0268264_10006676 3300028381 Bacteria 9705
141 Ga0268264_10115775 3300028381 Bacteria 2355
142 Ga0268264_12190317 3300028381 Bacteria 561
143 Ga0307508_10079733 3300031616 Bacteria 2855
144 Ga0307410_10508582 3300031852 Bacteria 992
145 Ga0307406_10770267 3300031901 Bacteria 810
146 Ga0307409_100206559 3300031995 Bacteria 1762
147 Ga0307416_100127960 3300032002 Bacteria 2279
148 Ga0307411_10816813 3300032005 Bacteria 822
149 Ga0307415_101070641 3300032126 Bacteria 753
150 Ga0373930_0156891 3300034816 Bacteria 574
151 Ga0373923_0701301 3300035111 Bacteria 503
152 Ga0373936_0109670 3300035113 Bacteria 1171
153 Ga0373953_0103333 3300035117 Bacteria 1201
154 Ga0373954_0330356 3300035118 Bacteria 753
155 Ga0373943_0075170 3300035170 Bacteria 1720
156 Ga0373943_0799591 3300035170 Bacteria 561
157 Ga0373946_0248622 3300035171 Bacteria 867
158 Ga0373955_0057953 3300035172 Bacteria 2130
159 Ga0373924_0383988 3300035410 Bacteria 627
160 Ga0373935_0220735 3300035692 Bacteria 1316
161 Ga0373935_1177283 3300035692 Bacteria 571
162 Ga0373927_0374211 3300035695 Bacteria 939
163 Ga0373933_0148176 3300035724 Bacteria 1485
164 Ga0373937_0074862 3300036401 Bacteria 3125
165 Ga0373937_0210429 3300036401 Bacteria 1830
166 Ga0373925_0000783 3300037068 Bacteria 29275
167 Ga0373925_0245371 3300037068 Bacteria 1435
168 Ga0373925_1155449 3300037068 Bacteria 637
169 Ga0395905_0204362 3300037471 Bacteria 1852
170 Ga0436365_0374138 3300039437 Bacteria 1012
171 Ga0436365_1531752 3300039437 Bacteria 1639
172 Ga0436365_1932353 3300039437 Bacteria 4159
173 Ga0436363_0282197 3300039450 Bacteria 665
174 Ga0436363_0397196 3300039450 Bacteria 743
175 Ga0436363_1036803 3300039450 Bacteria 715
176 Ga0436362_1231461 3300039453 Bacteria 936
177 Ga0436362_1239172 3300039453 Bacteria 514
178 Ga0439466_0017028 3300041411 Bacteria 2620
179 Ga0439465_0009901 3300041413 Bacteria 3002
180 Ga0451851_0389499 3300041507 Bacteria 1072
181 Ga0451851_0489108 3300041507 Bacteria 679
182 Ga0451851_0561799 3300041507 Bacteria 717
183 Ga0451851_1313647 3300041507 Bacteria 569
184 Ga0451855_1733970 3300041511 Bacteria 739
185 Ga0451853_0034245 3300041512 Bacteria 977
186 Ga0439445_0110017 3300042004 Bacteria 786
187 Ga0439464_0322466 3300042439 Bacteria 507
188 Ga0466972_0010057 3300044658 Bacteria 4752
189 Ga0466972_0035660 3300044658 Bacteria 2434
190 Ga0466972_0150544 3300044658 Bacteria 1094
191 Ga0466965_0000874 3300044683 Bacteria 11497
192 Ga0466965_0006165 3300044683 Bacteria 5424
193 Ga0466965_0025606 3300044683 Bacteria 2856
194 Ga0466965_0517437 3300044683 Bacteria 671
195 Ga0466966_0020119 3300044684 Bacteria 4392
196 Ga0466961_0052419 3300044693 Bacteria 2603
197 Ga0466963_0967978 3300044694 Bacteria 599
198 Ga0466963_0971362 3300044694 Bacteria 598
199 Ga0466964_0624212 3300044706 Bacteria 593
200 Ga0466971_0012915 3300044719 Bacteria 3663
201 Ga0466968_0008020 3300044735 Bacteria 4036
202 Ga0466968_0011856 3300044735 Bacteria 3402
203 Ga0466970_0010360 3300044765 Bacteria 4731
204 Ga0466970_0038684 3300044765 Bacteria 2530
205 Ga0466957_0052055 3300044842 Bacteria 2492
206 Ga0466957_0207352 3300044842 Bacteria 1289
207 Ga0466957_0544042 3300044842 Bacteria 809
208 Ga0466959_0013323 3300045049 Bacteria 5958
209 Ga0466959_0136224 3300045049 Bacteria 1738
210 Ga0466958_0023568 3300045836 Bacteria 3615
211 Ga0466958_0039200 3300045836 Bacteria 2845
212 Ga0466958_0658261 3300045836 Bacteria 682
213 Ga0466967_0266683 3300045976 Bacteria 1639
214 Ga0466967_0350744 3300045976 Bacteria 1428
215 Ga0495603_0383927 3300046455 Bacteria 805
216 Ga0495629_0204512 3300046459 Bacteria 1365
217 Ga0495629_0539399 3300046459 Bacteria 784
218 Ga0495651_0002012 3300046462 Bacteria 15684
219 Ga0495651_0209988 3300046462 Bacteria 1356
220 Ga0495651_0574566 3300046462 Bacteria 714
221 Ga0495653_0069512 3300046463 Bacteria 2638
222 Ga0495653_0256446 3300046463 Bacteria 1158
223 Ga0495582_0099205 3300046473 Bacteria 1630
224 Ga0495582_0416889 3300046473 Bacteria 775
225 Ga0495582_0694892 3300046473 Bacteria 589
226 Ga0495639_0070011 3300046475 Bacteria 1619
227 Ga0495608_0141045 3300046511 Bacteria 1538
228 Ga0495618_0274882 3300046514 Bacteria 1052
229 Ga0495618_0375789 3300046514 Bacteria 873
230 Ga0495630_0023116 3300046517 Bacteria 4594
231 Ga0495630_0127489 3300046517 Bacteria 1932
232 Ga0495630_0247400 3300046517 Bacteria 1362
233 Ga0495663_0190425 3300046525 Bacteria 713
234 Ga0495642_0419656 3300046528 Bacteria 591
235 Ga0495652_0147057 3300046529 Bacteria 1846
236 Ga0495652_0550046 3300046529 Bacteria 794
237 Ga0495652_0698358 3300046529 Bacteria 683
238 Ga0495640_0158652 3300046533 Bacteria 1451
239 Ga0495586_0181775 3300046535 Bacteria 1190
240 Ga0495586_0398080 3300046535 Bacteria 792
241 Ga0495587_0052508 3300046536 Bacteria 2405
242 Ga0495621_0009322 3300046539 Bacteria 2977
243 Ga0495645_0219113 3300046543 Bacteria 1281
244 Ga0495633_0337992 3300046558 Bacteria 683
245 Ga0495667_0009753 3300046559 Bacteria 6508
246 Ga0495634_0060399 3300046642 Bacteria 2522
247 Ga0495611_0525505 3300046648 Bacteria 537
248 Ga0495635_0061080 3300046663 Bacteria 2589
249 Ga0495635_0306468 3300046663 Bacteria 1064
250 Ga0495588_0084076 3300046674 Bacteria 1663
251 Ga0495657_0007921 3300046675 Bacteria 8150
252 Ga0495657_0593489 3300046675 Bacteria 641
253 Ga0495599_0509084 3300046678 Bacteria 708
254 Ga0495599_0681725 3300046678 Bacteria 594
255 Ga0495646_0173277 3300046680 Bacteria 1188
256 Ga0495658_0325955 3300046683 Bacteria 974
257 Ga0495658_0358871 3300046683 Bacteria 927
258 Ga0495658_0400566 3300046683 Bacteria 875
259 Ga0495613_0000622 3300046689 Bacteria 28216
260 Ga0495613_0487960 3300046689 Bacteria 831
261 Ga0495624_0195600 3300046690 Bacteria 1229
262 Ga0495581_0128532 3300047315 Bacteria 1476
263 Ga0495581_0204600 3300047315 Bacteria 1155
264 Ga0495604_0201960 3300047317 Bacteria 1378
265 Ga0495604_0620102 3300047317 Bacteria 692
266 Ga0495636_0175442 3300047318 Bacteria 971
267 Ga0495674_0262180 3300047319 Bacteria 1420
268 Ga0495674_0393659 3300047319 Bacteria 1119
269 Ga0495674_0803805 3300047319 Bacteria 731
270 Ga0495672_0454570 3300047320 Bacteria 577
271 Ga0495676_0216870 3300047321 Bacteria 1321
272 Ga0495676_0239020 3300047321 Bacteria 1244
273 Ga0495680_0016774 3300047322 Bacteria 6279
274 Ga0495675_0057695 3300047444 Bacteria 2462
275 Ga0495684_0313675 3300047471 Bacteria 1123
276 Ga0495684_0519065 3300047471 Bacteria 816
277 Ga0495593_0176904 3300047673 Bacteria 1075
278 Ga0495593_0433297 3300047673 Bacteria 658
279 Ga0495614_0122849 3300048089 Bacteria 1146
280 Ga0495614_0295531 3300048089 Bacteria 748
281 Ga0496102_0268968 3300048905 Bacteria 1607
282 Ga0496103_0347071 3300048906 Bacteria 954
283 Ga0496103_0542984 3300048906 Bacteria 742
284 Ga0496104_0090888 3300048907 Bacteria 2918
285 Ga0496104_1347182 3300048907 Bacteria 617
286 Ga0496104_1553332 3300048907 Bacteria 565
287 Ga0496104_1587791 3300048907 Bacteria 557
288 Ga0496104_1823755 3300048907 Bacteria 510
289 Ga0496105_0037851 3300048908 Bacteria 3974
290 Ga0496108_0813740 3300048911 Bacteria 805
291 Ga0496108_0872857 3300048911 Bacteria 773
292 Ga0496108_1152661 3300048911 Bacteria 657
293 Ga0496109_0413523 3300048912 Bacteria 1274
294 Ga0496109_1206277 3300048912 Bacteria 693
295 Ga0496109_1889595 3300048912 Bacteria 530
296 Ga0496110_0139503 3300048913 Bacteria 2191
297 Ga0496110_0987645 3300048913 Bacteria 749
298 Ga0496110_1574207 3300048913 Bacteria 567
299 Ga0496110_1861795 3300048913 Bacteria 512
300 Ga0496112_0000680 3300048915 Bacteria 23756
301 Ga0496112_0019188 3300048915 Bacteria 6448
302 Ga0496112_0026005 3300048915 Bacteria 5626
303 Ga0496112_1061956 3300048915 Bacteria 729
304 Ga0496113_0193662 3300048916 Bacteria 1614
305 Ga0496113_0869229 3300048916 Bacteria 714
306 Ga0496114_0040297 3300048917 Bacteria 3867
307 Ga0496114_1089606 3300048917 Bacteria 683
308 Ga0501032_0018907 3300049569 Bacteria 4821
309 Ga0501037_0026044 3300049573 Bacteria 4322
310 Ga0501042_1390628 3300049578 Bacteria 512
311 Ga0501068_0961024 3300049584 Bacteria 563
312 Ga0501070_0011597 3300049586 Bacteria 7440
313 Ga0501070_1020663 3300049586 Bacteria 641
314 Ga0501072_0007257 3300049588 Bacteria 8411
315 Ga0501074_0244889 3300049590 Bacteria 1275
316 Ga0501075_0754209 3300049591 Bacteria 741
317 Ga0501080_0691864 3300049742 Bacteria 900
318 Ga0501083_1087069 3300049744 Bacteria 521
319 Ga0501044_0228227 3300049823 Bacteria 1810
320 nmdc:mga03683_551291_c1 3300050489 Bacteria 561
321 nmdc:mga03n38_1120_c1 3300050490 Bacteria 7407
322 nmdc:mga00v17_179299_c1 3300050491 Bacteria 1367
323 nmdc:mga0yw44_302565_c1 3300050492 Bacteria 1072
324 nmdc:mga06z11_33380_c1 3300050494 Bacteria 2517
325 nmdc:mga04h51_212725_c1 3300050495 Bacteria 763
326 nmdc:mga07m45_198305_c1 3300050496 Bacteria 1167
327 nmdc:mga05p37_269909_c1 3300050507 Bacteria 2033
328 nmdc:mga09592_227373_c1 3300050508 Bacteria 1616
329 nmdc:mga0qj67_489411_c1 3300050509 Bacteria 989
330 nmdc:mga06r32_594702_c1 3300050510 Bacteria 1078
331 nmdc:mga08y16_1090441_c1 3300050511 Bacteria 774
332 nmdc:mga08y16_1118194_c1 3300050511 Bacteria 762
333 nmdc:mga08y16_655391_c1 3300050511 Bacteria 1053
334 nmdc:mga0n895_892279_c1 3300050512 Bacteria 875
335 nmdc:mga0sz30_189452_c1 3300050516 Bacteria 913
336 Ga0495601_0118535 3300053077 Bacteria 1718
337 Ga0495612_0161584 3300053078 Bacteria 978
338 Ga0495612_0312005 3300053078 Bacteria 706
339 Ga0500635_0057708 3300053080 Bacteria 1346
340 Ga0495595_0001602 3300053084 Bacteria 8824
341 Ga0495595_0018232 3300053084 Bacteria 3032
342 Ga0495595_0287228 3300053084 Bacteria 826
343 Ga0495619_0046805 3300053085 Bacteria 2846
344 Ga0495619_0059586 3300053085 Bacteria 2536
345 Ga0495619_0180478 3300053085 Bacteria 1460
346 Ga0495619_0347619 3300053085 Bacteria 1026
347 Ga0500566_0104611 3300053094 Bacteria 1547
348 Ga0500562_010809 3300053108 Bacteria 2316
349 Ga0500652_001525 3300053131 Bacteria 7110
350 Ga0500616_0000491 3300053153 Bacteria 51066
351 Ga0501084_1308266 3300054114 Bacteria 608
352 Ga0501084_1722295 3300054114 Bacteria 524
353 Ga0501082_0865625 3300060353 Bacteria 790
354 Ga0466962_0038319 3300061719 Bacteria 2295
355 Ga0466962_0367685 3300061719 Bacteria 717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2932398195 2932400854 129
2 iso_pu_bacteria 2818991472 2819747213 131
3 iso_pu_bacteria 8047710418 8047719122 131
4 3300005328 Ga0070676_10757939 Ga0070676_107579391 134
5 3300013105 Ga0157369_10954962 Ga0157369_109549621 134
6 3300013308 Ga0157375_13433614 Ga0157375_134336141 134
7 3300025928 Ga0207700_10248451 Ga0207700_102484512 134
8 3300039450 Ga0436363_1036803 Ga0436363_1036803_291_695 134
9 3300041507 Ga0451851_1313647 Ga0451851_1313647_68_472 134
10 3300044658 Ga0466972_0150544 Ga0466972_0150544_58_462 134
11 3300046473 Ga0495582_0099205 Ga0495582_0099205_49_495 134
12 3300046517 Ga0495630_0023116 Ga0495630_0023116_3951_4397 134
13 3300002239 JGI24034J26672_10029238 JGI24034J26672_100292382 135
14 3300005331 Ga0070670_100459815 Ga0070670_1004598151 135
15 3300005331 Ga0070670_100633753 Ga0070670_1006337531 135
16 3300005338 Ga0068868_101597426 Ga0068868_1015974262 135
17 3300005340 Ga0070689_101986980 Ga0070689_1019869801 135
18 3300005343 Ga0070687_100778403 Ga0070687_1007784031 135
19 3300005343 Ga0070687_101323373 Ga0070687_1013233731 135
20 3300005347 Ga0070668_100160318 Ga0070668_1001603181 135
21 3300005353 Ga0070669_100147921 Ga0070669_1001479212 135
22 3300005354 Ga0070675_100086983 Ga0070675_1000869832 135
23 3300005354 Ga0070675_100466736 Ga0070675_1004667361 135
24 3300005355 Ga0070671_100069984 Ga0070671_1000699841 135
25 3300005364 Ga0070673_101334383 Ga0070673_1013343831 135
26 3300005365 Ga0070688_100646302 Ga0070688_1006463021 135
27 3300005367 Ga0070667_100025713 Ga0070667_1000257132 135
28 3300005367 Ga0070667_100847466 Ga0070667_1008474661 135
29 3300005367 Ga0070667_101134956 Ga0070667_1011349562 135
30 3300005435 Ga0070714_100105381 Ga0070714_1001053812 135
31 3300005441 Ga0070700_100330609 Ga0070700_1003306092 135
32 3300005441 Ga0070700_100661873 Ga0070700_1006618731 135
33 3300005455 Ga0070663_100001060 Ga0070663_1000010606 135
34 3300005456 Ga0070678_100320421 Ga0070678_1003204212 135
35 3300005466 Ga0070685_10479088 Ga0070685_104790882 135
36 3300005466 Ga0070685_10752261 Ga0070685_107522611 135
37 3300005468 Ga0070707_101778654 Ga0070707_1017786541 135
38 3300005471 Ga0070698_101378888 Ga0070698_1013788881 135
39 3300005518 Ga0070699_100653907 Ga0070699_1006539072 135
40 3300005535 Ga0070684_100808067 Ga0070684_1008080671 135
41 3300005535 Ga0070684_101026442 Ga0070684_1010264421 135
42 3300005535 Ga0070684_101449921 Ga0070684_1014499212 135
43 3300005543 Ga0070672_100689903 Ga0070672_1006899032 135
44 3300005548 Ga0070665_100814451 Ga0070665_1008144511 135
45 3300005548 Ga0070665_102045098 Ga0070665_1020450981 135
46 3300005564 Ga0070664_101597261 Ga0070664_1015972612 135
47 3300005618 Ga0068864_100709348 Ga0068864_1007093482 135
48 3300005718 Ga0068866_10986208 Ga0068866_109862081 135
49 3300005841 Ga0068863_100033366 Ga0068863_1000333667 135
50 3300005841 Ga0068863_100036821 Ga0068863_1000368213 135
51 3300005842 Ga0068858_100057891 Ga0068858_1000578913 135
52 3300005842 Ga0068858_101019772 Ga0068858_1010197722 135
53 3300005843 Ga0068860_100011195 Ga0068860_10001119510 135
54 3300005843 Ga0068860_100229051 Ga0068860_1002290512 135
55 3300005843 Ga0068860_100500855 Ga0068860_1005008552 135
56 3300005843 Ga0068860_100963027 Ga0068860_1009630272 135
57 3300005937 Ga0081455_10026530 Ga0081455_100265306 135
58 3300005937 Ga0081455_10840906 Ga0081455_108409061 135
59 3300006038 Ga0075365_10041144 Ga0075365_100411443 135
60 3300006048 Ga0075363_100008753 Ga0075363_1000087534 135
61 3300006048 Ga0075363_100950857 Ga0075363_1009508571 135
62 3300006051 Ga0075364_10069633 Ga0075364_100696333 135
63 3300006186 Ga0075369_10173395 Ga0075369_101733951 135
64 3300006353 Ga0075370_10924386 Ga0075370_109243861 135
65 3300006844 Ga0075428_100000027 Ga0075428_10000002784 135
66 3300006844 Ga0075428_100283174 Ga0075428_1002831743 135
67 3300006844 Ga0075428_100421150 Ga0075428_1004211502 135
68 3300006844 Ga0075428_100813563 Ga0075428_1008135632 135
69 3300006846 Ga0075430_100160000 Ga0075430_1001600002 135
70 3300006847 Ga0075431_100189226 Ga0075431_1001892262 135
71 3300007265 Ga0099794_10570918 Ga0099794_105709181 135
72 3300009036 Ga0105244_10483904 Ga0105244_104839041 135
73 3300009094 Ga0111539_10640143 Ga0111539_106401431 135
74 3300009094 Ga0111539_10894238 Ga0111539_108942382 135
75 3300009098 Ga0105245_10696415 Ga0105245_106964151 135
76 3300009147 Ga0114129_10795188 Ga0114129_107951882 135
77 3300009147 Ga0114129_10847095 Ga0114129_108470952 135
78 3300009147 Ga0114129_12361625 Ga0114129_123616251 135
79 3300009148 Ga0105243_10503048 Ga0105243_105030482 135
80 3300009176 Ga0105242_10305516 Ga0105242_103055162 135
81 3300009176 Ga0105242_12448012 Ga0105242_124480122 135
82 3300009177 Ga0105248_10195844 Ga0105248_101958441 135
83 3300009551 Ga0105238_11226122 Ga0105238_112261221 135
84 3300009553 Ga0105249_10051126 Ga0105249_100511264 135
85 3300009553 Ga0105249_10065681 Ga0105249_100656812 135
86 3300010375 Ga0105239_11523672 Ga0105239_115236721 135
87 3300010375 Ga0105239_12404683 Ga0105239_124046831 135
88 3300010375 Ga0105239_12484991 Ga0105239_124849911 135
89 3300011119 Ga0105246_10621537 Ga0105246_106215372 135
90 3300012494 Ga0157341_1026068 Ga0157341_10260681 135
91 3300013104 Ga0157370_11866553 Ga0157370_118665532 135
92 3300013297 Ga0157378_10901865 Ga0157378_109018651 135
93 3300013297 Ga0157378_11048242 Ga0157378_110482421 135
94 3300013306 Ga0163162_10543462 Ga0163162_105434622 135
95 3300013308 Ga0157375_11418844 Ga0157375_114188442 135
96 3300014325 Ga0163163_10008913 Ga0163163_100089136 135
97 3300014326 Ga0157380_10602896 Ga0157380_106028963 135
98 3300014326 Ga0157380_10770913 Ga0157380_107709132 135
99 3300014497 Ga0182008_10630487 Ga0182008_106304871 135
100 3300014745 Ga0157377_10202444 Ga0157377_102024442 135
101 3300014745 Ga0157377_11414497 Ga0157377_114144971 135
102 3300014968 Ga0157379_11452836 Ga0157379_114528361 135
103 3300014969 Ga0157376_10997558 Ga0157376_109975582 135
104 3300021384 Ga0213876_10017552 Ga0213876_100175524 135
105 3300021384 Ga0213876_10088338 Ga0213876_100883382 135
106 3300025711 Ga0207696_1060584 Ga0207696_10605841 135
107 3300025900 Ga0207710_10346370 Ga0207710_103463702 135
108 3300025907 Ga0207645_11230347 Ga0207645_112303471 135
109 3300025910 Ga0207684_10165502 Ga0207684_101655022 135
110 3300025918 Ga0207662_10769061 Ga0207662_107690611 135
111 3300025921 Ga0207652_10423442 Ga0207652_104234422 135
112 3300025922 Ga0207646_10315167 Ga0207646_103151672 135
113 3300025923 Ga0207681_10285682 Ga0207681_102856821 135
114 3300025925 Ga0207650_10990535 Ga0207650_109905352 135
115 3300025926 Ga0207659_10448388 Ga0207659_104483882 135
116 3300025926 Ga0207659_11106245 Ga0207659_111062452 135
117 3300025931 Ga0207644_10213371 Ga0207644_102133712 135
118 3300025931 Ga0207644_10518308 Ga0207644_105183082 135
119 3300025932 Ga0207690_10817127 Ga0207690_108171272 135
120 3300025933 Ga0207706_11406459 Ga0207706_114064591 135
121 3300025934 Ga0207686_10496275 Ga0207686_104962751 135
122 3300025937 Ga0207669_10150667 Ga0207669_101506673 135
123 3300025939 Ga0207665_10165250 Ga0207665_101652502 135
124 3300025944 Ga0207661_11010503 Ga0207661_110105032 135
125 3300025949 Ga0207667_10245816 Ga0207667_102458162 135
126 3300025960 Ga0207651_10751138 Ga0207651_107511382 135
127 3300025961 Ga0207712_10232771 Ga0207712_102327712 135
128 3300025961 Ga0207712_10249880 Ga0207712_102498802 135
129 3300025972 Ga0207668_10099937 Ga0207668_100999372 135
130 3300025972 Ga0207668_11894952 Ga0207668_118949521 135
131 3300025986 Ga0207658_10178535 Ga0207658_101785352 135
132 3300026023 Ga0207677_10347588 Ga0207677_103475883 135
133 3300026035 Ga0207703_10195773 Ga0207703_101957734 135
134 3300026035 Ga0207703_10315287 Ga0207703_103152872 135
135 3300026067 Ga0207678_10001206 Ga0207678_100012063 135
136 3300026067 Ga0207678_11078123 Ga0207678_110781231 135
137 3300026075 Ga0207708_10200844 Ga0207708_102008442 135
138 3300026089 Ga0207648_12008875 Ga0207648_120088752 135
139 3300026116 Ga0207674_11633442 Ga0207674_116334421 135
140 3300026116 Ga0207674_11688045 Ga0207674_116880452 135
141 3300026118 Ga0207675_100429178 Ga0207675_1004291782 135
142 3300026118 Ga0207675_101396875 Ga0207675_1013968752 135
143 3300026121 Ga0207683_10461836 Ga0207683_104618362 135
144 3300026121 Ga0207683_11025161 Ga0207683_110251611 135
145 3300027866 Ga0209813_10395620 Ga0209813_103956201 135
146 3300028380 Ga0268265_11740482 Ga0268265_117404822 135
147 3300028380 Ga0268265_12642474 Ga0268265_126424741 135
148 3300028381 Ga0268264_10006676 Ga0268264_100066764 135
149 3300028381 Ga0268264_10115775 Ga0268264_101157751 135
150 3300028381 Ga0268264_12190317 Ga0268264_121903171 135
151 3300031616 Ga0307508_10079733 Ga0307508_100797332 135
152 3300031852 Ga0307410_10508582 Ga0307410_105085822 135
153 3300031901 Ga0307406_10770267 Ga0307406_107702671 135
154 3300031995 Ga0307409_100206559 Ga0307409_1002065592 135
155 3300032002 Ga0307416_100127960 Ga0307416_1001279602 135
156 3300032005 Ga0307411_10816813 Ga0307411_108168131 135
157 3300032126 Ga0307415_101070641 Ga0307415_1010706412 135
158 3300034816 Ga0373930_0156891 Ga0373930_0156891_132_539 135
159 3300035111 Ga0373923_0701301 Ga0373923_0701301_40_447 135
160 3300035113 Ga0373936_0109670 Ga0373936_0109670_695_1102 135
161 3300035117 Ga0373953_0103333 Ga0373953_0103333_400_807 135
162 3300035118 Ga0373954_0330356 Ga0373954_0330356_102_509 135
163 3300035170 Ga0373943_0075170 Ga0373943_0075170_763_1170 135
164 3300035170 Ga0373943_0799591 Ga0373943_0799591_64_471 135
165 3300035171 Ga0373946_0248622 Ga0373946_0248622_25_432 135
166 3300035172 Ga0373955_0057953 Ga0373955_0057953_1395_1802 135
167 3300035410 Ga0373924_0383988 Ga0373924_0383988_114_521 135
168 3300035692 Ga0373935_0220735 Ga0373935_0220735_111_518 135
169 3300035692 Ga0373935_1177283 Ga0373935_1177283_125_532 135
170 3300035695 Ga0373927_0374211 Ga0373927_0374211_196_603 135
171 3300035724 Ga0373933_0148176 Ga0373933_0148176_1049_1456 135
172 3300036401 Ga0373937_0074862 Ga0373937_0074862_1276_1683 135
173 3300036401 Ga0373937_0210429 Ga0373937_0210429_1052_1459 135
174 3300037068 Ga0373925_0000783 Ga0373925_0000783_11483_11890 135
175 3300037068 Ga0373925_0245371 Ga0373925_0245371_816_1223 135
176 3300037068 Ga0373925_1155449 Ga0373925_1155449_21_428 135
177 3300037471 Ga0395905_0204362 Ga0395905_0204362_120_527 135
178 3300039437 Ga0436365_0374138 Ga0436365_0374138_180_587 135
179 3300039437 Ga0436365_1531752 Ga0436365_1531752_683_1090 135
180 3300039437 Ga0436365_1932353 Ga0436365_1932353_2629_3036 135
181 3300039450 Ga0436363_0282197 Ga0436363_0282197_19_465 135
182 3300039450 Ga0436363_0397196 Ga0436363_0397196_206_613 135
183 3300039453 Ga0436362_1231461 Ga0436362_1231461_69_476 135
184 3300039453 Ga0436362_1239172 Ga0436362_1239172_92_499 135
185 3300041411 Ga0439466_0017028 Ga0439466_0017028_1115_1522 135
186 3300041413 Ga0439465_0009901 Ga0439465_0009901_1764_2171 135
187 3300041507 Ga0451851_0389499 Ga0451851_0389499_554_961 135
188 3300041507 Ga0451851_0489108 Ga0451851_0489108_32_439 135
189 3300041507 Ga0451851_0561799 Ga0451851_0561799_157_570 135
190 3300041511 Ga0451855_1733970 Ga0451855_1733970_53_505 135
191 3300041512 Ga0451853_0034245 Ga0451853_0034245_301_708 135
192 3300042004 Ga0439445_0110017 Ga0439445_0110017_368_775 135
193 3300042439 Ga0439464_0322466 Ga0439464_0322466_41_448 135
194 3300044658 Ga0466972_0010057 Ga0466972_0010057_539_946 135
195 3300044658 Ga0466972_0035660 Ga0466972_0035660_630_1040 135
196 3300044683 Ga0466965_0000874 Ga0466965_0000874_806_1213 135
197 3300044683 Ga0466965_0006165 Ga0466965_0006165_3533_3943 135
198 3300044683 Ga0466965_0025606 Ga0466965_0025606_1687_2094 135
199 3300044683 Ga0466965_0517437 Ga0466965_0517437_59_469 135
200 3300044684 Ga0466966_0020119 Ga0466966_0020119_3480_3890 135
201 3300044693 Ga0466961_0052419 Ga0466961_0052419_540_950 135
202 3300044694 Ga0466963_0967978 Ga0466963_0967978_81_488 135
203 3300044694 Ga0466963_0971362 Ga0466963_0971362_29_439 135
204 3300044706 Ga0466964_0624212 Ga0466964_0624212_153_563 135
205 3300044719 Ga0466971_0012915 Ga0466971_0012915_1320_1730 135
206 3300044735 Ga0466968_0008020 Ga0466968_0008020_2124_2531 135
207 3300044735 Ga0466968_0011856 Ga0466968_0011856_978_1388 135
208 3300044765 Ga0466970_0010360 Ga0466970_0010360_982_1389 135
209 3300044765 Ga0466970_0038684 Ga0466970_0038684_853_1263 135
210 3300044842 Ga0466957_0052055 Ga0466957_0052055_120_530 135
211 3300044842 Ga0466957_0207352 Ga0466957_0207352_382_789 135
212 3300044842 Ga0466957_0544042 Ga0466957_0544042_367_774 135
213 3300045049 Ga0466959_0013323 Ga0466959_0013323_3786_4196 135
214 3300045049 Ga0466959_0136224 Ga0466959_0136224_145_552 135
215 3300045836 Ga0466958_0023568 Ga0466958_0023568_3043_3450 135
216 3300045836 Ga0466958_0039200 Ga0466958_0039200_1603_2013 135
217 3300045836 Ga0466958_0658261 Ga0466958_0658261_60_467 135
218 3300045976 Ga0466967_0266683 Ga0466967_0266683_644_1051 135
219 3300045976 Ga0466967_0350744 Ga0466967_0350744_755_1165 135
220 3300046455 Ga0495603_0383927 Ga0495603_0383927_133_540 135
221 3300046459 Ga0495629_0204512 Ga0495629_0204512_680_1093 135
222 3300046459 Ga0495629_0539399 Ga0495629_0539399_27_434 135
223 3300046462 Ga0495651_0002012 Ga0495651_0002012_12450_12857 135
224 3300046462 Ga0495651_0209988 Ga0495651_0209988_726_1133 135
225 3300046462 Ga0495651_0574566 Ga0495651_0574566_222_629 135
226 3300046463 Ga0495653_0069512 Ga0495653_0069512_610_1017 135
227 3300046463 Ga0495653_0256446 Ga0495653_0256446_594_1001 135
228 3300046473 Ga0495582_0416889 Ga0495582_0416889_350_757 135
229 3300046473 Ga0495582_0694892 Ga0495582_0694892_16_423 135
230 3300046475 Ga0495639_0070011 Ga0495639_0070011_604_1011 135
231 3300046511 Ga0495608_0141045 Ga0495608_0141045_793_1200 135
232 3300046514 Ga0495618_0274882 Ga0495618_0274882_21_428 135
233 3300046514 Ga0495618_0375789 Ga0495618_0375789_451_858 135
234 3300046517 Ga0495630_0127489 Ga0495630_0127489_1067_1474 135
235 3300046517 Ga0495630_0247400 Ga0495630_0247400_781_1188 135
236 3300046525 Ga0495663_0190425 Ga0495663_0190425_89_496 135
237 3300046528 Ga0495642_0419656 Ga0495642_0419656_53_460 135
238 3300046529 Ga0495652_0147057 Ga0495652_0147057_896_1303 135
239 3300046529 Ga0495652_0550046 Ga0495652_0550046_192_599 135
240 3300046529 Ga0495652_0698358 Ga0495652_0698358_122_565 135
241 3300046533 Ga0495640_0158652 Ga0495640_0158652_140_547 135
242 3300046535 Ga0495586_0181775 Ga0495586_0181775_599_1012 135
243 3300046535 Ga0495586_0398080 Ga0495586_0398080_328_735 135
244 3300046536 Ga0495587_0052508 Ga0495587_0052508_1944_2351 135
245 3300046539 Ga0495621_0009322 Ga0495621_0009322_1403_1810 135
246 3300046543 Ga0495645_0219113 Ga0495645_0219113_264_671 135
247 3300046558 Ga0495633_0337992 Ga0495633_0337992_195_602 135
248 3300046559 Ga0495667_0009753 Ga0495667_0009753_2693_3100 135
249 3300046642 Ga0495634_0060399 Ga0495634_0060399_1092_1499 135
250 3300046648 Ga0495611_0525505 Ga0495611_0525505_76_483 135
251 3300046663 Ga0495635_0061080 Ga0495635_0061080_265_672 135
252 3300046663 Ga0495635_0306468 Ga0495635_0306468_26_433 135
253 3300046674 Ga0495588_0084076 Ga0495588_0084076_526_933 135
254 3300046675 Ga0495657_0007921 Ga0495657_0007921_7536_7943 135
255 3300046675 Ga0495657_0593489 Ga0495657_0593489_50_457 135
256 3300046678 Ga0495599_0509084 Ga0495599_0509084_85_492 135
257 3300046678 Ga0495599_0681725 Ga0495599_0681725_73_480 135
258 3300046680 Ga0495646_0173277 Ga0495646_0173277_424_831 135
259 3300046683 Ga0495658_0325955 Ga0495658_0325955_441_854 135
260 3300046683 Ga0495658_0358871 Ga0495658_0358871_476_883 135
261 3300046683 Ga0495658_0400566 Ga0495658_0400566_170_577 135
262 3300046689 Ga0495613_0000622 Ga0495613_0000622_19150_19557 135
263 3300046689 Ga0495613_0487960 Ga0495613_0487960_195_602 135
264 3300046690 Ga0495624_0195600 Ga0495624_0195600_549_956 135
265 3300047315 Ga0495581_0128532 Ga0495581_0128532_443_850 135
266 3300047315 Ga0495581_0204600 Ga0495581_0204600_199_606 135
267 3300047317 Ga0495604_0201960 Ga0495604_0201960_87_494 135
268 3300047317 Ga0495604_0620102 Ga0495604_0620102_76_483 135
269 3300047318 Ga0495636_0175442 Ga0495636_0175442_206_613 135
270 3300047319 Ga0495674_0262180 Ga0495674_0262180_184_591 135
271 3300047319 Ga0495674_0393659 Ga0495674_0393659_323_730 135
272 3300047319 Ga0495674_0803805 Ga0495674_0803805_100_507 135
273 3300047320 Ga0495672_0454570 Ga0495672_0454570_138_545 135
274 3300047321 Ga0495676_0216870 Ga0495676_0216870_99_506 135
275 3300047321 Ga0495676_0239020 Ga0495676_0239020_657_1070 135
276 3300047322 Ga0495680_0016774 Ga0495680_0016774_1070_1477 135
277 3300047444 Ga0495675_0057695 Ga0495675_0057695_1854_2261 135
278 3300047471 Ga0495684_0313675 Ga0495684_0313675_594_1049 135
279 3300047471 Ga0495684_0519065 Ga0495684_0519065_23_430 135
280 3300047673 Ga0495593_0176904 Ga0495593_0176904_609_1016 135
281 3300047673 Ga0495593_0433297 Ga0495593_0433297_35_442 135
282 3300048089 Ga0495614_0122849 Ga0495614_0122849_150_557 135
283 3300048089 Ga0495614_0295531 Ga0495614_0295531_297_704 135
284 3300048905 Ga0496102_0268968 Ga0496102_0268968_1173_1580 135
285 3300048906 Ga0496103_0347071 Ga0496103_0347071_532_939 135
286 3300048906 Ga0496103_0542984 Ga0496103_0542984_103_510 135
287 3300048907 Ga0496104_0090888 Ga0496104_0090888_836_1243 135
288 3300048907 Ga0496104_1347182 Ga0496104_1347182_146_553 135
289 3300048907 Ga0496104_1553332 Ga0496104_1553332_40_447 135
290 3300048907 Ga0496104_1587791 Ga0496104_1587791_57_470 135
291 3300048907 Ga0496104_1823755 Ga0496104_1823755_55_462 135
292 3300048908 Ga0496105_0037851 Ga0496105_0037851_151_585 135
293 3300048911 Ga0496108_0813740 Ga0496108_0813740_195_602 135
294 3300048911 Ga0496108_0872857 Ga0496108_0872857_295_702 135
295 3300048911 Ga0496108_1152661 Ga0496108_1152661_207_614 135
296 3300048912 Ga0496109_0413523 Ga0496109_0413523_99_506 135
297 3300048912 Ga0496109_1206277 Ga0496109_1206277_256_663 135
298 3300048912 Ga0496109_1889595 Ga0496109_1889595_96_503 135
299 3300048913 Ga0496110_0139503 Ga0496110_0139503_906_1313 135
300 3300048913 Ga0496110_0987645 Ga0496110_0987645_165_572 135
301 3300048913 Ga0496110_1574207 Ga0496110_1574207_46_453 135
302 3300048913 Ga0496110_1861795 Ga0496110_1861795_65_472 135
303 3300048915 Ga0496112_0000680 Ga0496112_0000680_17643_18050 135
304 3300048915 Ga0496112_0019188 Ga0496112_0019188_4407_4814 135
305 3300048915 Ga0496112_0026005 Ga0496112_0026005_2798_3244 135
306 3300048915 Ga0496112_1061956 Ga0496112_1061956_96_503 135
307 3300048916 Ga0496113_0193662 Ga0496113_0193662_370_777 135
308 3300048916 Ga0496113_0869229 Ga0496113_0869229_252_659 135
309 3300048917 Ga0496114_0040297 Ga0496114_0040297_3159_3566 135
310 3300048917 Ga0496114_1089606 Ga0496114_1089606_144_551 135
311 3300049569 Ga0501032_0018907 Ga0501032_0018907_285_692 135
312 3300049573 Ga0501037_0026044 Ga0501037_0026044_1477_1884 135
313 3300049578 Ga0501042_1390628 Ga0501042_1390628_30_437 135
314 3300049584 Ga0501068_0961024 Ga0501068_0961024_12_419 135
315 3300049586 Ga0501070_0011597 Ga0501070_0011597_2962_3369 135
316 3300049586 Ga0501070_1020663 Ga0501070_1020663_81_488 135
317 3300049588 Ga0501072_0007257 Ga0501072_0007257_1833_2240 135
318 3300049590 Ga0501074_0244889 Ga0501074_0244889_836_1243 135
319 3300049591 Ga0501075_0754209 Ga0501075_0754209_27_434 135
320 3300049742 Ga0501080_0691864 Ga0501080_0691864_352_759 135
321 3300049744 Ga0501083_1087069 Ga0501083_1087069_40_447 135
322 3300049823 Ga0501044_0228227 Ga0501044_0228227_588_995 135
323 3300050489 nmdc:mga03683_551291_c1 nmdc:mga03683_551291_c1_88_495 135
324 3300050490 nmdc:mga03n38_1120_c1 nmdc:mga03n38_1120_c1_4695_5102 135
325 3300050491 nmdc:mga00v17_179299_c1 nmdc:mga00v17_179299_c1_297_704 135
326 3300050492 nmdc:mga0yw44_302565_c1 nmdc:mga0yw44_302565_c1_512_919 135
327 3300050494 nmdc:mga06z11_33380_c1 nmdc:mga06z11_33380_c1_1179_1586 135
328 3300050495 nmdc:mga04h51_212725_c1 nmdc:mga04h51_212725_c1_303_710 135
329 3300050496 nmdc:mga07m45_198305_c1 nmdc:mga07m45_198305_c1_609_1016 135
330 3300050507 nmdc:mga05p37_269909_c1 nmdc:mga05p37_269909_c1_1439_1846 135
331 3300050508 nmdc:mga09592_227373_c1 nmdc:mga09592_227373_c1_627_1034 135
332 3300050509 nmdc:mga0qj67_489411_c1 nmdc:mga0qj67_489411_c1_85_492 135
333 3300050510 nmdc:mga06r32_594702_c1 nmdc:mga06r32_594702_c1_216_623 135
334 3300050511 nmdc:mga08y16_1090441_c1 nmdc:mga08y16_1090441_c1_336_743 135
335 3300050511 nmdc:mga08y16_1118194_c1 nmdc:mga08y16_1118194_c1_149_556 135
336 3300050511 nmdc:mga08y16_655391_c1 nmdc:mga08y16_655391_c1_618_1025 135
337 3300050512 nmdc:mga0n895_892279_c1 nmdc:mga0n895_892279_c1_433_840 135
338 3300050516 nmdc:mga0sz30_189452_c1 nmdc:mga0sz30_189452_c1_51_458 135
339 3300053077 Ga0495601_0118535 Ga0495601_0118535_1083_1490 135
340 3300053078 Ga0495612_0161584 Ga0495612_0161584_139_546 135
341 3300053078 Ga0495612_0312005 Ga0495612_0312005_109_516 135
342 3300053080 Ga0500635_0057708 Ga0500635_0057708_156_563 135
343 3300053084 Ga0495595_0001602 Ga0495595_0001602_5388_5795 135
344 3300053084 Ga0495595_0018232 Ga0495595_0018232_1664_2071 135
345 3300053084 Ga0495595_0287228 Ga0495595_0287228_299_706 135
346 3300053085 Ga0495619_0046805 Ga0495619_0046805_2369_2776 135
347 3300053085 Ga0495619_0059586 Ga0495619_0059586_1142_1549 135
348 3300053085 Ga0495619_0180478 Ga0495619_0180478_807_1214 135
349 3300053085 Ga0495619_0347619 Ga0495619_0347619_122_529 135
350 3300053094 Ga0500566_0104611 Ga0500566_0104611_999_1406 135
351 3300053108 Ga0500562_010809 Ga0500562_010809_787_1194 135
352 3300053131 Ga0500652_001525 Ga0500652_001525_4946_5353 135
353 3300053153 Ga0500616_0000491 Ga0500616_0000491_2677_3084 135
354 3300054114 Ga0501084_1308266 Ga0501084_1308266_68_475 135
355 3300054114 Ga0501084_1722295 Ga0501084_1722295_50_457 135
356 3300060353 Ga0501082_0865625 Ga0501082_0865625_65_478 135
357 3300061719 Ga0466962_0038319 Ga0466962_0038319_1297_1707 135
358 3300061719 Ga0466962_0367685 Ga0466962_0367685_230_637 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

16

134

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7236 2 125
8acu-assembly1.cif.gz_B structure of bacillus subtilis rel in complex with darb 0.6609 22 57
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.6558 2 125
4wws-assembly1.cif.gz_D structure of chlorite dismutase-like protein from listeria monocytogenes 0.6092 2 128
4wws-assembly1.cif.gz_B structure of chlorite dismutase-like protein from listeria monocytogenes 0.6068 2 122
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7236 2 125 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6558 2 125 3.30.70.1060
5xnxC02 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.6471 27 57 3.30.460.10
af_Q58727_7_92_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5962 1 128 3.30.70.100
1vdhA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.5754 2 127 3.30.70.1030
ID Description Score Start End GO Terms
AF-A0A810MPA5-F1-model_v4 YCII-related domain-containing protein 0.9302 1 128
AF-A0A7X7DDN9-F1-model_v4 YCII-related domain-containing protein 0.9232 1 125
AF-A0A7X8TGZ0-F1-model_v4 YCII-related domain-containing protein 0.9222 3 129
AF-Q0SKI6-F1-model_v4 YCII-related domain-containing protein 0.9163 1 134
AF-A0A1H6IZM8-F1-model_v4 Uncharacterized conserved protein 0.9149 1 134

Feature Viewer

pLDDT pTM Quality
85.37 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map