F421193

General Info

Members Datasets Scaffolds Average Seq Length
358 216 698 276

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10097017|Ga0182008_100970171
Length 331
Sequence LTRRAKQAAGFRQLPVAAASVRDAMANWGPDATRLRQLSLFRHDLIQPEQKSGGAPMKIIDAQVHIWSQTVVPTSGLHRKVDKFTAEELLKDMDEAAVDAALIHPPAGWDPNSNTVAIEAVKKHPGRFAIMGNFPLQNPDNRKLIHGWRKQPGMMGLRWPLLLEEHQKWLHDGSLDWLWPAAEQEGLPIAMMGGLFLKKFREIAEHHPHLNMIVDHCGLNRHGRDAEAFIHLDELVAMAKLPNVAIKATGAPHYSTQGYPFKNIQDGLHRIYDAYGPKRFFWGTDITRMPCSYRQCVTFFTEELRWLNGKDLEDVMGRGLCAWIGWDYKFD

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
70 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
118 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
119 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
199 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
203 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
208 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
212 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
215 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.1
Nodule 0
Rhizoplane 4.75
Rhizosphere 84.36
Stem 0
Stem Tuber 0
Unclassified 2.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10097017 3300014497 Bacteria 1455
2 rootH1_10099225 3300003323 Bacteria 2289
3 Ga0070658_10224863 3300005327 Bacteria 1588
4 Ga0070683_100016766 3300005329 Bacteria 6463
5 Ga0070683_100179201 3300005329 Bacteria 2011
6 Ga0070680_100076177 3300005336 Bacteria 2761
7 Ga0070682_100072344 3300005337 Bacteria 2209
8 Ga0070691_10019706 3300005341 Bacteria 3114
9 Ga0070659_100604606 3300005366 Bacteria 943
10 Ga0070709_10110967 3300005434 Bacteria 1844
11 Ga0070713_100007157 3300005436 Bacteria 7805
12 Ga0070713_100021644 3300005436 Bacteria 4951
13 Ga0070713_100073751 3300005436 Bacteria 2890
14 Ga0070713_100284883 3300005436 Bacteria 1517
15 Ga0070713_100399158 3300005436 Bacteria 1284
16 Ga0070710_10006269 3300005437 Bacteria 5699
17 Ga0070710_10144467 3300005437 Bacteria 1462
18 Ga0070711_100008821 3300005439 Bacteria 6187
19 Ga0070711_100012767 3300005439 Bacteria 5258
20 Ga0070711_100016820 3300005439 Bacteria 4649
21 Ga0070678_100020428 3300005456 Bacteria 4345
22 Ga0070681_10002147 3300005458 Bacteria 17936
23 Ga0070681_10142100 3300005458 Bacteria 2330
24 Ga0070681_10435296 3300005458 Bacteria 1223
25 Ga0070706_100108430 3300005467 Bacteria 2584
26 Ga0070707_100110129 3300005468 Bacteria 2670
27 Ga0070679_100045138 3300005530 Bacteria 4391
28 Ga0070684_100001310 3300005535 Bacteria 17824
29 Ga0070684_100179234 3300005535 Unclassified 1926
30 Ga0070684_100442188 3300005535 Bacteria 1201
31 Ga0068853_100125348 3300005539 Bacteria 2294
32 Ga0070672_100112615 3300005543 Bacteria 2220
33 Ga0070665_100011881 3300005548 Bacteria 8794
34 Ga0070665_100027638 3300005548 Bacteria 5713
35 Ga0068855_100047971 3300005563 Bacteria 5043
36 Ga0068855_100914026 3300005563 Bacteria 926
37 Ga0070664_100518050 3300005564 Bacteria 1100
38 Ga0068857_100129687 3300005577 Bacteria 2274
39 Ga0068854_100182554 3300005578 Bacteria 1640
40 Ga0068856_100000020 3300005614 Bacteria 146775
41 Ga0068856_100013629 3300005614 Bacteria 7866
42 Ga0068856_100393944 3300005614 Bacteria 1405
43 Ga0068852_100021702 3300005616 Bacteria 5134
44 Ga0068851_10214504 3300005834 Bacteria 1079
45 Ga0068860_100129107 3300005843 Bacteria 2424
46 Ga0081455_10023627 3300005937 Bacteria 5715
47 Ga0081455_10183344 3300005937 Bacteria 1583
48 Ga0081538_10013063 3300005981 Bacteria 6605
49 Ga0081540_1037560 3300005983 Bacteria 2565
50 Ga0081540_1040779 3300005983 Bacteria 2415
51 Ga0070717_10005022 3300006028 Bacteria 9636
52 Ga0070717_10062799 3300006028 Bacteria 3081
53 Ga0070717_10293514 3300006028 Bacteria 1444
54 Ga0075365_10033284 3300006038 Bacteria 3320
55 Ga0075365_10103470 3300006038 Bacteria 1951
56 Ga0075368_10124946 3300006042 Bacteria 1067
57 Ga0075363_100111325 3300006048 Bacteria 1522
58 Ga0075364_10021201 3300006051 Unclassified 4094
59 Ga0070712_100001463 3300006175 Bacteria 14404
60 Ga0070712_100044103 3300006175 Bacteria 3073
61 Ga0075362_10000566 3300006177 Bacteria 10781
62 Ga0075367_10003166 3300006178 Bacteria 7757
63 Ga0075369_10003019 3300006186 Bacteria 6087
64 Ga0075366_10032251 3300006195 Bacteria 3084
65 Ga0075366_10079720 3300006195 Bacteria 1955
66 Ga0075434_100078209 3300006871 Bacteria 3303
67 Ga0068865_100042193 3300006881 Bacteria 3110
68 Ga0075435_100028153 3300007076 Bacteria 4405
69 Ga0105240_10072737 3300009093 Bacteria 4248
70 Ga0105240_10143177 3300009093 Bacteria 2856
71 Ga0105240_10170542 3300009093 Bacteria 2578
72 Ga0105240_10237367 3300009093 Bacteria 2115
73 Ga0105240_10326308 3300009093 Bacteria 1748
74 Ga0105240_10360543 3300009093 Bacteria 1647
75 Ga0105245_10035532 3300009098 Bacteria 4423
76 Ga0105247_10072438 3300009101 Bacteria 2157
77 Ga0105241_10226021 3300009174 Bacteria 1576
78 Ga0105241_10453826 3300009174 Bacteria 1134
79 Ga0105248_10651837 3300009177 Bacteria 1188
80 Ga0105248_10652634 3300009177 Bacteria 1187
81 Ga0105237_10081292 3300009545 Bacteria 3231
82 Ga0105237_10231687 3300009545 Bacteria 1848
83 Ga0105237_10240232 3300009545 Bacteria 1812
84 Ga0105238_10028782 3300009551 Bacteria 5658
85 Ga0105238_10435262 3300009551 Bacteria 1307
86 Ga0105249_10270825 3300009553 Bacteria 1692
87 Ga0105239_10020601 3300010375 Bacteria 7276
88 Ga0105239_10079024 3300010375 Bacteria 3620
89 Ga0105239_10373262 3300010375 Bacteria 1612
90 Ga0105246_10469469 3300011119 Bacteria 1062
91 Ga0157371_10135057 3300013102 Bacteria 1756
92 Ga0157370_10186002 3300013104 Bacteria 1928
93 Ga0157369_10007324 3300013105 Bacteria 12701
94 Ga0157369_10056393 3300013105 Bacteria 4240
95 Ga0157369_10590873 3300013105 Bacteria 1146
96 Ga0157374_10244230 3300013296 Bacteria 1766
97 Ga0157378_10220404 3300013297 Bacteria 1803
98 Ga0163162_10052416 3300013306 Bacteria 4097
99 Ga0163162_10103652 3300013306 Bacteria 2939
100 Ga0163162_10663530 3300013306 Bacteria 1166
101 Ga0157372_10057938 3300013307 Bacteria 4330
102 Ga0157372_10254101 3300013307 Bacteria 2040
103 Ga0157372_10345957 3300013307 Bacteria 1732
104 Ga0157375_10036416 3300013308 Bacteria 4707
105 Ga0163163_10361648 3300014325 Bacteria 1508
106 Ga0157380_10174668 3300014326 Bacteria 1881
107 Ga0157379_10448226 3300014968 Bacteria 1191
108 Ga0157376_10021479 3300014969 Bacteria 5013
109 Ga0157376_10637449 3300014969 Bacteria 1065
110 Ga0163161_10339767 3300017792 Bacteria 1191
111 Ga0213871_10000402 3300021441 Bacteria 5756
112 Ga0224712_10047631 3300022467 Bacteria 1651
113 Ga0207426_1023617 3300025302 Bacteria 2096
114 Ga0207692_10032608 3300025898 Bacteria 2505
115 Ga0207692_10118938 3300025898 Bacteria 1476
116 Ga0207642_10089541 3300025899 Bacteria 1516
117 Ga0207647_10075160 3300025904 Bacteria 2034
118 Ga0207647_10109701 3300025904 Bacteria 1632
119 Ga0207699_10089473 3300025906 Bacteria 1930
120 Ga0207699_10154613 3300025906 Bacteria 1521
121 Ga0207645_10169831 3300025907 Bacteria 1429
122 Ga0207684_10064263 3300025910 Bacteria 3116
123 Ga0207654_10256154 3300025911 Bacteria 1175
124 Ga0207707_10000482 3300025912 Bacteria 41345
125 Ga0207707_10056004 3300025912 Bacteria 3429
126 Ga0207707_10065082 3300025912 Bacteria 3175
127 Ga0207695_10081996 3300025913 Bacteria 3263
128 Ga0207695_10291134 3300025913 Bacteria 1525
129 Ga0207671_10059794 3300025914 Bacteria 2826
130 Ga0207671_10079475 3300025914 Bacteria 2457
131 Ga0207671_10273185 3300025914 Bacteria 1332
132 Ga0207693_10003098 3300025915 Bacteria 14323
133 Ga0207693_10035405 3300025915 Bacteria 3936
134 Ga0207693_10162908 3300025915 Bacteria 1755
135 Ga0207663_10029984 3300025916 Bacteria 3203
136 Ga0207663_10129191 3300025916 Bacteria 1743
137 Ga0207660_10008967 3300025917 Bacteria 6472
138 Ga0207660_10228973 3300025917 Unclassified 1461
139 Ga0207657_10072820 3300025919 Bacteria 2905
140 Ga0207652_10005552 3300025921 Bacteria 10223
141 Ga0207652_10011262 3300025921 Bacteria 7206
142 Ga0207652_10061405 3300025921 Bacteria 3245
143 Ga0207652_10121218 3300025921 Bacteria 2327
144 Ga0207652_10142379 3300025921 Bacteria 2145
145 Ga0207652_10374893 3300025921 Bacteria 1284
146 Ga0207646_10515952 3300025922 Bacteria 1076
147 Ga0207694_10076388 3300025924 Bacteria 2623
148 Ga0207694_10228160 3300025924 Bacteria 1520
149 Ga0207694_10297287 3300025924 Bacteria 1329
150 Ga0207700_10017135 3300025928 Bacteria 4831
151 Ga0207700_10150501 3300025928 Bacteria 1922
152 Ga0207700_10508246 3300025928 Bacteria 1067
153 Ga0207664_10049083 3300025929 Plasmid 3321
154 Ga0207686_10090275 3300025934 Bacteria 2021
155 Ga0207670_10290314 3300025936 Bacteria 1277
156 Ga0207691_10090011 3300025940 Bacteria 2751
157 Ga0207711_10040944 3300025941 Bacteria 3943
158 Ga0207661_10016371 3300025944 Bacteria 5468
159 Ga0207661_10017589 3300025944 Bacteria 5295
160 Ga0207661_10204153 3300025944 Bacteria 1739
161 Ga0207679_10135756 3300025945 Bacteria 1981
162 Ga0207667_10033027 3300025949 Bacteria 5568
163 Ga0207667_10102805 3300025949 Bacteria 2947
164 Ga0207640_10043780 3300025981 Bacteria 2863
165 Ga0207640_10086863 3300025981 Bacteria 2155
166 Ga0207639_10067207 3300026041 Bacteria 2789
167 Ga0207639_10214204 3300026041 Bacteria 1660
168 Ga0207639_10219556 3300026041 Bacteria 1641
169 Ga0207639_10228388 3300026041 Bacteria 1612
170 Ga0207639_10269979 3300026041 Bacteria 1492
171 Ga0207708_10152441 3300026075 Bacteria 1820
172 Ga0207702_10002142 3300026078 Bacteria 18978
173 Ga0207702_10234105 3300026078 Bacteria 1718
174 Ga0207702_10321828 3300026078 Bacteria 1473
175 Ga0207648_10281919 3300026089 Bacteria 1486
176 Ga0207676_10018997 3300026095 Bacteria 5007
177 Ga0207683_10042199 3300026121 Bacteria 3984
178 Ga0207683_10055786 3300026121 Bacteria 3465
179 Ga0207683_10063562 3300026121 Bacteria 3251
180 Ga0207683_10093489 3300026121 Bacteria 2679
181 Ga0207683_10517396 3300026121 Bacteria 1103
182 Ga0207698_10021065 3300026142 Bacteria 4501
183 Ga0207698_10057300 3300026142 Bacteria 3014
184 Ga0209813_10016185 3300027866 Bacteria 2032
185 Ga0268266_10002130 3300028379 Bacteria 21838
186 Ga0268266_10065953 3300028379 Bacteria 3130
187 Ga0268264_10141653 3300028381 Bacteria 2145
188 Ga0265334_10004520 3300028573 Bacteria 6167
189 Ga0265338_10433472 3300028800 Bacteria 933
190 Ga0265340_10029714 3300031247 Bacteria 2745
191 Ga0265316_10108450 3300031344 Bacteria 2105
192 Ga0265314_10012120 3300031711 Bacteria 7062
193 Ga0307412_10618021 3300031911 Bacteria 920
194 Ga0307416_100244705 3300032002 Bacteria 1741
195 Ga0307415_100468448 3300032126 Bacteria 1094
196 Ga0373926_0020167 3300035083 Bacteria 2302
197 Ga0373940_0053340 3300035088 Bacteria 1141
198 Ga0373923_0002896 3300035111 Bacteria 5386
199 Ga0373923_0005439 3300035111 Bacteria 4326
200 Ga0373936_0013726 3300035113 Bacteria 3092
201 Ga0373936_0050683 3300035113 Bacteria 1679
202 Ga0373953_0007952 3300035117 Bacteria 3578
203 Ga0373954_0023872 3300035118 Bacteria 2785
204 Ga0373954_0057872 3300035118 Bacteria 1826
205 Ga0373956_0040386 3300035119 Bacteria 2069
206 Ga0373957_0016655 3300035120 Plasmid 2548
207 Ga0373957_0066796 3300035120 Bacteria 1401
208 Ga0373942_0033619 3300035207 Bacteria 1368
209 Ga0373931_0000989 3300035691 Bacteria 12014
210 Ga0373931_0070463 3300035691 Bacteria 1908
211 Ga0373935_0027582 3300035692 Bacteria 3511
212 Ga0373935_0108671 3300035692 Bacteria 1838
213 Ga0373927_0062332 3300035695 Bacteria 2411
214 Ga0373927_0138446 3300035695 Bacteria 1591
215 Ga0373927_0173926 3300035695 Bacteria 1412
216 Ga0373933_0000333 3300035724 Bacteria 30309
217 Ga0373933_0016560 3300035724 Bacteria 4125
218 Ga0373933_0031279 3300035724 Plasmid 3087
219 Ga0373947_0128737 3300035725 Bacteria 1614
220 Ga0373947_0274080 3300035725 Bacteria 1121
221 Ga0373937_0010847 3300036401 Bacteria 7975
222 Ga0373937_0014195 3300036401 Bacteria 7028
223 Ga0373937_0088722 3300036401 Bacteria 2863
224 Ga0373925_0018984 3300037068 Bacteria 4997
225 Ga0373925_0107026 3300037068 Bacteria 2157
226 Ga0373925_0241639 3300037068 Unclassified 1446
227 Ga0373925_0507753 3300037068 Bacteria 990
228 Ga0395899_0072517 3300037312 Bacteria 2519
229 Ga0395899_0133472 3300037312 Bacteria 1771
230 Ga0395899_0143632 3300037312 Bacteria 1696
231 Ga0395899_0189103 3300037312 Bacteria 1441
232 Ga0395900_0025882 3300037418 Bacteria 6006
233 Ga0395900_0038372 3300037418 Bacteria 4936
234 Ga0395900_0119420 3300037418 Bacteria 2706
235 Ga0395900_0123423 3300037418 Bacteria 2656
236 Ga0395898_0054685 3300037466 Bacteria 3895
237 Ga0395898_0147320 3300037466 Bacteria 2253
238 Ga0395898_0264724 3300037466 Bacteria 1640
239 Ga0395898_0427921 3300037466 Bacteria 1261
240 Ga0436364_0364177 3300037853 Unclassified 2465
241 Ga0395901_0003364 3300038443 Bacteria 16107
242 Ga0395901_0038962 3300038443 Bacteria 4916
243 Ga0395901_0367388 3300038443 Bacteria 1482
244 Ga0436365_0581088 3300039437 Bacteria 1946
245 Ga0436360_0801408 3300039438 Bacteria 7324
246 Ga0436360_0992428 3300039438 Bacteria 1457
247 Ga0436363_0721025 3300039450 Bacteria 1022
248 Ga0436363_0730022 3300039450 Bacteria 1504
249 Ga0436363_1318780 3300039450 Bacteria 3243
250 Ga0451853_0431649 3300041512 Bacteria 2216
251 Ga0466963_0151884 3300044694 Bacteria 1608
252 Ga0466959_0054883 3300045049 Bacteria 2910
253 Ga0466967_0201688 3300045976 Bacteria 1884
254 Ga0495592_0044930 3300046454 Bacteria 3298
255 Ga0495592_0061099 3300046454 Bacteria 2770
256 Ga0495651_0013368 3300046462 Bacteria 6350
257 Ga0495651_0099773 3300046462 Unclassified 2165
258 Ga0495651_0244220 3300046462 Bacteria 1230
259 Ga0495651_0327286 3300046462 Bacteria 1020
260 Ga0495653_0091597 3300046463 Bacteria 2222
261 Ga0495653_0092457 3300046463 Bacteria 2209
262 Ga0495580_0015205 3300046472 Bacteria 5817
263 Ga0495582_0087641 3300046473 Bacteria 1733
264 Ga0495662_0176895 3300046476 Bacteria 1052
265 Ga0495664_0001938 3300046477 Bacteria 11029
266 Ga0495664_0009337 3300046477 Bacteria 5486
267 Ga0495608_0033440 3300046511 Bacteria 3475
268 Ga0495618_0010576 3300046514 Bacteria 5583
269 Ga0495618_0164509 3300046514 Bacteria 1413
270 Ga0495628_0037195 3300046516 Bacteria 3903
271 Ga0495628_0122606 3300046516 Bacteria 1993
272 Ga0495630_0106905 3300046517 Bacteria 2119
273 Ga0495652_0194853 3300046529 Bacteria 1543
274 Ga0495665_0007155 3300046531 Bacteria 6025
275 Ga0495640_0007236 3300046533 Bacteria 8741
276 Ga0495587_0043952 3300046536 Bacteria 2658
277 Ga0495645_0003766 3300046543 Bacteria 10301
278 Ga0495645_0006472 3300046543 Bacteria 8128
279 Ga0495667_0090558 3300046559 Unclassified 1982
280 Ga0495656_0095992 3300046615 Bacteria 1364
281 Ga0495634_0018044 3300046642 Bacteria 5028
282 Ga0495634_0218538 3300046642 Bacteria 1177
283 Ga0495635_0139710 3300046663 Bacteria 1650
284 Ga0495657_0063064 3300046675 Bacteria 2446
285 Ga0495599_0031201 3300046678 Bacteria 3345
286 Ga0495599_0141705 3300046678 Unclassified 1491
287 Ga0495646_0133851 3300046680 Bacteria 1393
288 Ga0495613_0238969 3300046689 Bacteria 1271
289 Ga0495581_0052530 3300047315 Bacteria 2354
290 Ga0495581_0071705 3300047315 Bacteria 2004
291 Ga0495604_0075233 3300047317 Unclassified 2543
292 Ga0495674_0063813 3300047319 Bacteria 3203
293 Ga0495672_0032803 3300047320 Bacteria 3224
294 Ga0495680_0008385 3300047322 Bacteria 9400
295 Ga0495684_0422687 3300047471 Bacteria 931
296 Ga0495593_0037317 3300047673 Bacteria 2629
297 Ga0495602_0000619 3300048088 Bacteria 33402
298 Ga0496101_0001791 3300048904 Bacteria 12922
299 Ga0496101_0008325 3300048904 Bacteria 6777
300 Ga0496102_0004772 3300048905 Bacteria 11468
301 Ga0496103_0364686 3300048906 Bacteria 929
302 Ga0496104_0064825 3300048907 Bacteria 3465
303 Ga0496105_0007746 3300048908 Bacteria 8334
304 Ga0496105_0043455 3300048908 Bacteria 3706
305 Ga0496106_0496477 3300048909 Bacteria 980
306 Ga0496107_0247332 3300048910 Bacteria 1327
307 Ga0496108_0298759 3300048911 Bacteria 1402
308 Ga0496111_0013664 3300048914 Bacteria 5532
309 Ga0496112_0087241 3300048915 Bacteria 3087
310 Ga0496112_0201101 3300048915 Bacteria 1951
311 Ga0496113_0159578 3300048916 Bacteria 1782
312 Ga0496114_0205655 3300048917 Bacteria 1725
313 Ga0496114_0467809 3300048917 Bacteria 1116
314 Ga0496115_0115998 3300048918 Bacteria 2202
315 Ga0496121_0074138 3300048924 Bacteria 2724
316 Ga0496126_0003477 3300048929 Bacteria 19884
317 Ga0496126_0057641 3300048929 Bacteria 3505
318 Ga0501033_0174472 3300049570 Bacteria 1543
319 Ga0501034_0001789 3300049571 Bacteria 27440
320 Ga0501034_0006403 3300049571 Bacteria 12683
321 Ga0501070_0041483 3300049586 Bacteria 3834
322 Ga0501070_0101245 3300049586 Bacteria 2383
323 Ga0501073_0100082 3300049589 Bacteria 2013
324 Ga0501074_0007681 3300049590 Bacteria 7809
325 Ga0501080_0028316 3300049742 Bacteria 5211
326 nmdc:mga03683_2784_c1 3300050489 Bacteria 5501
327 nmdc:mga03683_6918_c2 3300050489 Bacteria 1349
328 nmdc:mga03n38_8019_c1 3300050490 Bacteria 3767
329 nmdc:mga0yw44_100792_c1 3300050492 Bacteria 1839
330 nmdc:mga0yw44_17101_c1 3300050492 Bacteria 3937
331 nmdc:mga0yw44_345586_c1 3300050492 Bacteria 1001
332 nmdc:mga0k408_14341_c1 3300050493 Bacteria 4364
333 nmdc:mga06z11_1184_c1 3300050494 Bacteria 9592
334 nmdc:mga06z11_93759_c1 3300050494 Bacteria 1635
335 nmdc:mga04h51_19006_c1 3300050495 Bacteria 2032
336 nmdc:mga07m45_123781_c1 3300050496 Bacteria 1494
337 nmdc:mga0n895_77665_c1 3300050512 Bacteria 3303
338 nmdc:mga0rr50_8823_c1 3300050513 Bacteria 6293
339 nmdc:mga0sz30_3582_c1 3300050516 Bacteria 5275
340 Ga0495612_0004636 3300053078 Bacteria 5695
341 Ga0495612_0020057 3300053078 Bacteria 2678
342 Ga0495595_0066750 3300053084 Bacteria 1694
343 Ga0495619_0100295 3300053085 Bacteria 1970
344 Ga0500647_0092990 3300053091 Bacteria 1443
345 Ga0500604_0086172 3300053151 Bacteria 1021
346 Ga0500616_0000801 3300053153 Bacteria 35946
347 Ga0500639_071494 3300053163 Bacteria 1767
348 Ga0500552_000368 3300053733 Bacteria 4191
349 Ga0466962_0105669 3300061719 Bacteria 1354
350 Ga0182008_10097017
351 rootH1_10099225
352 Ga0070658_10224863
353 Ga0070683_100016766
354 Ga0070683_100179201
355 Ga0070680_100076177
356 Ga0070682_100072344
357 Ga0070691_10019706
358 Ga0070659_100604606
359 Ga0070709_10110967
360 Ga0070713_100007157
361 Ga0070713_100021644
362 Ga0070713_100073751
363 Ga0070713_100284883
364 Ga0070713_100399158
365 Ga0070710_10006269
366 Ga0070710_10144467
367 Ga0070711_100008821
368 Ga0070711_100012767
369 Ga0070711_100016820
370 Ga0070678_100020428
371 Ga0070681_10002147
372 Ga0070681_10142100
373 Ga0070681_10435296
374 Ga0070706_100108430
375 Ga0070707_100110129
376 Ga0070679_100045138
377 Ga0070684_100001310
378 Ga0070684_100179234
379 Ga0070684_100442188
380 Ga0068853_100125348
381 Ga0070672_100112615
382 Ga0070665_100011881
383 Ga0070665_100027638
384 Ga0068855_100047971
385 Ga0068855_100914026
386 Ga0070664_100518050
387 Ga0068857_100129687
388 Ga0068854_100182554
389 Ga0068856_100000020
390 Ga0068856_100013629
391 Ga0068856_100393944
392 Ga0068852_100021702
393 Ga0068851_10214504
394 Ga0068860_100129107
395 Ga0081455_10023627
396 Ga0081455_10183344
397 Ga0081538_10013063
398 Ga0081540_1037560
399 Ga0081540_1040779
400 Ga0070717_10005022
401 Ga0070717_10062799
402 Ga0070717_10293514
403 Ga0075365_10033284
404 Ga0075365_10103470
405 Ga0075368_10124946
406 Ga0075363_100111325
407 Ga0075364_10021201
408 Ga0070712_100001463
409 Ga0070712_100044103
410 Ga0075362_10000566
411 Ga0075367_10003166
412 Ga0075369_10003019
413 Ga0075366_10032251
414 Ga0075366_10079720
415 Ga0075434_100078209
416 Ga0068865_100042193
417 Ga0075435_100028153
418 Ga0105240_10072737
419 Ga0105240_10143177
420 Ga0105240_10170542
421 Ga0105240_10237367
422 Ga0105240_10326308
423 Ga0105240_10360543
424 Ga0105245_10035532
425 Ga0105247_10072438
426 Ga0105241_10226021
427 Ga0105241_10453826
428 Ga0105248_10651837
429 Ga0105248_10652634
430 Ga0105237_10081292
431 Ga0105237_10231687
432 Ga0105237_10240232
433 Ga0105238_10028782
434 Ga0105238_10435262
435 Ga0105249_10270825
436 Ga0105239_10020601
437 Ga0105239_10079024
438 Ga0105239_10373262
439 Ga0105246_10469469
440 Ga0157371_10135057
441 Ga0157370_10186002
442 Ga0157369_10007324
443 Ga0157369_10056393
444 Ga0157369_10590873
445 Ga0157374_10244230
446 Ga0157378_10220404
447 Ga0163162_10052416
448 Ga0163162_10103652
449 Ga0163162_10663530
450 Ga0157372_10057938
451 Ga0157372_10254101
452 Ga0157372_10345957
453 Ga0157375_10036416
454 Ga0163163_10361648
455 Ga0157380_10174668
456 Ga0157379_10448226
457 Ga0157376_10021479
458 Ga0157376_10637449
459 Ga0163161_10339767
460 Ga0213871_10000402
461 Ga0224712_10047631
462 Ga0207426_1023617
463 Ga0207692_10032608
464 Ga0207692_10118938
465 Ga0207642_10089541
466 Ga0207647_10075160
467 Ga0207647_10109701
468 Ga0207699_10089473
469 Ga0207699_10154613
470 Ga0207645_10169831
471 Ga0207684_10064263
472 Ga0207654_10256154
473 Ga0207707_10000482
474 Ga0207707_10056004
475 Ga0207707_10065082
476 Ga0207695_10081996
477 Ga0207695_10291134
478 Ga0207671_10059794
479 Ga0207671_10079475
480 Ga0207671_10273185
481 Ga0207693_10003098
482 Ga0207693_10035405
483 Ga0207693_10162908
484 Ga0207663_10029984
485 Ga0207663_10129191
486 Ga0207660_10008967
487 Ga0207660_10228973
488 Ga0207657_10072820
489 Ga0207652_10005552
490 Ga0207652_10011262
491 Ga0207652_10061405
492 Ga0207652_10121218
493 Ga0207652_10142379
494 Ga0207652_10374893
495 Ga0207646_10515952
496 Ga0207694_10076388
497 Ga0207694_10228160
498 Ga0207694_10297287
499 Ga0207700_10017135
500 Ga0207700_10150501
501 Ga0207700_10508246
502 Ga0207664_10049083
503 Ga0207686_10090275
504 Ga0207670_10290314
505 Ga0207691_10090011
506 Ga0207711_10040944
507 Ga0207661_10016371
508 Ga0207661_10017589
509 Ga0207661_10204153
510 Ga0207679_10135756
511 Ga0207667_10033027
512 Ga0207667_10102805
513 Ga0207640_10043780
514 Ga0207640_10086863
515 Ga0207639_10067207
516 Ga0207639_10214204
517 Ga0207639_10219556
518 Ga0207639_10228388
519 Ga0207639_10269979
520 Ga0207708_10152441
521 Ga0207702_10002142
522 Ga0207702_10234105
523 Ga0207702_10321828
524 Ga0207648_10281919
525 Ga0207676_10018997
526 Ga0207683_10042199
527 Ga0207683_10055786
528 Ga0207683_10063562
529 Ga0207683_10093489
530 Ga0207683_10517396
531 Ga0207698_10021065
532 Ga0207698_10057300
533 Ga0209813_10016185
534 Ga0268266_10002130
535 Ga0268266_10065953
536 Ga0268264_10141653
537 Ga0265334_10004520
538 Ga0265338_10433472
539 Ga0265340_10029714
540 Ga0265316_10108450
541 Ga0265314_10012120
542 Ga0307412_10618021
543 Ga0307416_100244705
544 Ga0307415_100468448
545 Ga0373926_0020167
546 Ga0373940_0053340
547 Ga0373923_0002896
548 Ga0373923_0005439
549 Ga0373936_0013726
550 Ga0373936_0050683
551 Ga0373953_0007952
552 Ga0373954_0023872
553 Ga0373954_0057872
554 Ga0373956_0040386
555 Ga0373957_0016655
556 Ga0373957_0066796
557 Ga0373942_0033619
558 Ga0373931_0000989
559 Ga0373931_0070463
560 Ga0373935_0027582
561 Ga0373935_0108671
562 Ga0373927_0062332
563 Ga0373927_0138446
564 Ga0373927_0173926
565 Ga0373933_0000333
566 Ga0373933_0016560
567 Ga0373933_0031279
568 Ga0373947_0128737
569 Ga0373947_0274080
570 Ga0373937_0010847
571 Ga0373937_0014195
572 Ga0373937_0088722
573 Ga0373925_0018984
574 Ga0373925_0107026
575 Ga0373925_0241639
576 Ga0373925_0507753
577 Ga0395899_0072517
578 Ga0395899_0133472
579 Ga0395899_0143632
580 Ga0395899_0189103
581 Ga0395900_0025882
582 Ga0395900_0038372
583 Ga0395900_0119420
584 Ga0395900_0123423
585 Ga0395898_0054685
586 Ga0395898_0147320
587 Ga0395898_0264724
588 Ga0395898_0427921
589 Ga0436364_0364177
590 Ga0395901_0003364
591 Ga0395901_0038962
592 Ga0395901_0367388
593 Ga0436365_0581088
594 Ga0436360_0801408
595 Ga0436360_0992428
596 Ga0436363_0721025
597 Ga0436363_0730022
598 Ga0436363_1318780
599 Ga0451853_0431649
600 Ga0466963_0151884
601 Ga0466959_0054883
602 Ga0466967_0201688
603 Ga0495592_0044930
604 Ga0495592_0061099
605 Ga0495651_0013368
606 Ga0495651_0099773
607 Ga0495651_0244220
608 Ga0495651_0327286
609 Ga0495653_0091597
610 Ga0495653_0092457
611 Ga0495580_0015205
612 Ga0495582_0087641
613 Ga0495662_0176895
614 Ga0495664_0001938
615 Ga0495664_0009337
616 Ga0495608_0033440
617 Ga0495618_0010576
618 Ga0495618_0164509
619 Ga0495628_0037195
620 Ga0495628_0122606
621 Ga0495630_0106905
622 Ga0495652_0194853
623 Ga0495665_0007155
624 Ga0495640_0007236
625 Ga0495587_0043952
626 Ga0495645_0003766
627 Ga0495645_0006472
628 Ga0495667_0090558
629 Ga0495656_0095992
630 Ga0495634_0018044
631 Ga0495634_0218538
632 Ga0495635_0139710
633 Ga0495657_0063064
634 Ga0495599_0031201
635 Ga0495599_0141705
636 Ga0495646_0133851
637 Ga0495613_0238969
638 Ga0495581_0052530
639 Ga0495581_0071705
640 Ga0495604_0075233
641 Ga0495674_0063813
642 Ga0495672_0032803
643 Ga0495680_0008385
644 Ga0495684_0422687
645 Ga0495593_0037317
646 Ga0495602_0000619
647 Ga0496101_0001791
648 Ga0496101_0008325
649 Ga0496102_0004772
650 Ga0496103_0364686
651 Ga0496104_0064825
652 Ga0496105_0007746
653 Ga0496105_0043455
654 Ga0496106_0496477
655 Ga0496107_0247332
656 Ga0496108_0298759
657 Ga0496111_0013664
658 Ga0496112_0087241
659 Ga0496112_0201101
660 Ga0496113_0159578
661 Ga0496114_0205655
662 Ga0496114_0467809
663 Ga0496115_0115998
664 Ga0496121_0074138
665 Ga0496126_0003477
666 Ga0496126_0057641
667 Ga0501033_0174472
668 Ga0501034_0001789
669 Ga0501034_0006403
670 Ga0501070_0041483
671 Ga0501070_0101245
672 Ga0501073_0100082
673 Ga0501074_0007681
674 Ga0501080_0028316
675 nmdc:mga03683_2784_c1
676 nmdc:mga03683_6918_c2
677 nmdc:mga03n38_8019_c1
678 nmdc:mga0yw44_100792_c1
679 nmdc:mga0yw44_17101_c1
680 nmdc:mga0yw44_345586_c1
681 nmdc:mga0k408_14341_c1
682 nmdc:mga06z11_1184_c1
683 nmdc:mga06z11_93759_c1
684 nmdc:mga04h51_19006_c1
685 nmdc:mga07m45_123781_c1
686 nmdc:mga0n895_77665_c1
687 nmdc:mga0rr50_8823_c1
688 nmdc:mga0sz30_3582_c1
689 Ga0495612_0004636
690 Ga0495612_0020057
691 Ga0495595_0066750
692 Ga0495619_0100295
693 Ga0500647_0092990
694 Ga0500604_0086172
695 Ga0500616_0000801
696 Ga0500639_071494
697 Ga0500552_000368
698 Ga0466962_0105669

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

60

329

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dnm-assembly1.cif.gz_A crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 0.8447 1 269
4dnm-assembly1.cif.gz_A crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 0.8251 1 269
4do7-assembly2.cif.gz_B crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 0.8204 1 269
4do7-assembly2.cif.gz_B crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 0.8012 1 269
4dia-assembly1.cif.gz_A crystal structure of the d248n mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 4.6 0.7655 3 269
ID Description Score Start End Superfamily
4do7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8204 1 269 3.20.20.140
4do7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8012 1 269 3.20.20.140
af_A0A0P0W9I9_79_364_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7956 2 267 3.20.20.140
af_A0A0P0W9I9_79_364_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7687 2 267 3.20.20.140
4mupC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7488 3 273 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A327M4R5-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9951 2 271 GO:0016787
GO:0016829
AF-A0A2V6SQI5-F1-model_v4 Amidohydrolase 0.9872 181 271 GO:0016787
AF-A0A840Y7B8-F1-model_v4 Putative TIM-barrel fold metal-dependent hydrolase 0.984 1 271 GO:0016787
GO:0016829
AF-A0A431RXH8-F1-model_v4 deleted 0.9806 168 268
AF-A0A2V6XJ43-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9776 75 275 GO:0016787

Map