F421181

General Info

Members Datasets Scaffolds Average Seq Length
358 143 716 225

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10314980|Ga0157369_103149803
Length 241
Sequence MFTGIIEQTGTLVSLTDRGGVRRITVEAPGIANRLREGDSLAVSGVCLTALDVDPTYFHADLAQETLDRTSLGALKPGAKVNLELPTAAGSPLGGHVVQGHVDGTGIMTALEPVIPETSPHFNRETTDWTLKVRLPENVRQWMVPKGSVAIEGISLTIAAIEGPPGDSAYPLGASTGSQHDTISIAILPLTYWRTNLHTLAVGAPVNVEADVLVKLAYQQMQSTKKPDFDLTETWLVANGY

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
106 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
110 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
111 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
112 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
143 2881633906 Lactiplantibacillus garii FI11369 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 2.79
Rhizosphere 95.81
Stem 0
Stem Tuber 0
Unclassified 13.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10314980 3300013105 Bacteria 1627
2 rootH2_10101615 3300003320 Bacteria 4286
3 rootH2_10297605 3300003320 Bacteria 1445
4 rootH1_10258698 3300003323 Bacteria 1052
5 Ga0070658_10011219 3300005327 Bacteria 7182
6 Ga0070658_10108816 3300005327 Archaea 2294
7 Ga0070683_100006023 3300005329 Bacteria 10164
8 Ga0070683_100014078 3300005329 Bacteria 6987
9 Ga0070683_100028634 3300005329 Bacteria 5036
10 Ga0070683_100325746 3300005329 Bacteria 1463
11 Ga0070683_100652796 3300005329 Bacteria 1007
12 Ga0070690_100135201 3300005330 Bacteria 1669
13 Ga0070670_100011591 3300005331 Bacteria 7534
14 Ga0070670_100089146 3300005331 Bacteria 2652
15 Ga0068869_100603246 3300005334 Bacteria 928
16 Ga0070666_10077415 3300005335 Bacteria 2270
17 Ga0070680_100057277 3300005336 Unclassified 3186
18 Ga0070680_100220029 3300005336 Bacteria 1603
19 Ga0068868_100062980 3300005338 Bacteria 2941
20 Ga0068868_100142049 3300005338 Bacteria 1971
21 Ga0070660_100002524 3300005339 Bacteria 12537
22 Ga0070661_100002573 3300005344 Bacteria 12433
23 Ga0070661_100014913 3300005344 Bacteria 5480
24 Ga0070671_100001359 3300005355 Bacteria 18333
25 Ga0070671_100137691 3300005355 Bacteria 2059
26 Ga0070671_100375870 3300005355 Bacteria 1214
27 Ga0070673_100097458 3300005364 Bacteria 2415
28 Ga0070667_100005956 3300005367 Bacteria 10140
29 Ga0070714_100310515 3300005435 Unclassified 1472
30 Ga0070714_100793319 3300005435 Unclassified 917
31 Ga0070711_100289277 3300005439 Bacteria 1299
32 Ga0070678_100038151 3300005456 Bacteria 3380
33 Ga0070662_100020611 3300005457 Bacteria 4494
34 Ga0070681_10084052 3300005458 Bacteria 3135
35 Ga0070681_10258278 3300005458 Bacteria 1654
36 Ga0070679_100009151 3300005530 Bacteria 9348
37 Ga0070679_100754712 3300005530 Bacteria 916
38 Ga0070684_100018000 3300005535 Bacteria 5809
39 Ga0070684_100024735 3300005535 Bacteria 5040
40 Ga0070684_100078893 3300005535 Bacteria 2910
41 Ga0070684_100725410 3300005535 Bacteria 927
42 Ga0068853_100000048 3300005539 Bacteria 93122
43 Ga0068853_100020224 3300005539 Bacteria 5534
44 Ga0068853_100239836 3300005539 Archaea 1661
45 Ga0070672_100013927 3300005543 Bacteria 5689
46 Ga0070665_100030415 3300005548 Bacteria 5433
47 Ga0070665_100091298 3300005548 Bacteria 3051
48 Ga0070665_100178099 3300005548 Unclassified 2127
49 Ga0070665_100432304 3300005548 Unclassified 1325
50 Ga0070665_100432963 3300005548 Bacteria 1324
51 Ga0068855_100003334 3300005563 Bacteria 19648
52 Ga0068855_100004613 3300005563 Bacteria 16819
53 Ga0068855_100013025 3300005563 Bacteria 10033
54 Ga0068855_100021681 3300005563 Bacteria 7705
55 Ga0068855_100027525 3300005563 Bacteria 6799
56 Ga0068855_100950771 3300005563 Bacteria 905
57 Ga0070664_100087434 3300005564 Unclassified 2694
58 Ga0068857_100022568 3300005577 Bacteria 5535
59 Ga0068857_100028140 3300005577 Bacteria 4958
60 Ga0068857_100114638 3300005577 Bacteria 2424
61 Ga0068854_100071540 3300005578 Bacteria 2538
62 Ga0068854_100216301 3300005578 Bacteria 1514
63 Ga0068856_100001672 3300005614 Bacteria 23230
64 Ga0068856_100002877 3300005614 Bacteria 17612
65 Ga0068856_100024395 3300005614 Bacteria 5886
66 Ga0068856_100111064 3300005614 Bacteria 2738
67 Ga0068856_100130403 3300005614 Bacteria 2518
68 Ga0068856_100506007 3300005614 Bacteria 1229
69 Ga0068856_100593285 3300005614 Bacteria 1129
70 Ga0068852_100000020 3300005616 Bacteria 126369
71 Ga0068852_100000076 3300005616 Bacteria 69262
72 Ga0068852_100050663 3300005616 Bacteria 3559
73 Ga0068852_100185717 3300005616 Bacteria 1958
74 Ga0068859_101073052 3300005617 Bacteria 885
75 Ga0068864_100001563 3300005618 Bacteria 18850
76 Ga0068851_10015301 3300005834 Unclassified 3654
77 Ga0068851_10049173 3300005834 Bacteria 2138
78 Ga0068863_100002640 3300005841 Bacteria 17744
79 Ga0068858_100001937 3300005842 Bacteria 21103
80 Ga0068858_100507998 3300005842 Bacteria 1165
81 Ga0068860_100000881 3300005843 Bacteria 33318
82 Ga0068862_100186066 3300005844 Unclassified 1866
83 Ga0070712_100521807 3300006175 Bacteria 998
84 Ga0097621_100040565 3300006237 Bacteria 3743
85 Ga0097621_100143868 3300006237 Bacteria 2039
86 Ga0097621_100210532 3300006237 Bacteria 1691
87 Ga0068871_100007389 3300006358 Bacteria 7845
88 Ga0068871_100012754 3300006358 Bacteria 6215
89 Ga0068871_100063681 3300006358 Bacteria 3017
90 Ga0068865_100318256 3300006881 Bacteria 1250
91 Ga0097620_101073005 3300006931 Bacteria 885
92 Ga0105240_10000145 3300009093 Bacteria 143918
93 Ga0105240_10001837 3300009093 Bacteria 35573
94 Ga0105240_10006426 3300009093 Bacteria 17277
95 Ga0105240_10007803 3300009093 Bacteria 15461
96 Ga0105240_10022639 3300009093 Bacteria 8325
97 Ga0105240_10080576 3300009093 Bacteria 4003
98 Ga0105240_10165140 3300009093 Bacteria 2626
99 Ga0105240_10176090 3300009093 Unclassified 2529
100 Ga0105240_10253978 3300009093 Bacteria 2031
101 Ga0105240_10257661 3300009093 Unclassified 2014
102 Ga0105240_10485656 3300009093 Unclassified 1376
103 Ga0105245_10012815 3300009098 Bacteria 7304
104 Ga0105247_10001592 3300009101 Bacteria 16074
105 Ga0105241_10000021 3300009174 Bacteria 143251
106 Ga0105241_10001099 3300009174 Bacteria 20586
107 Ga0105241_10002039 3300009174 Bacteria 15278
108 Ga0105241_10028226 3300009174 Bacteria 4181
109 Ga0105241_10044357 3300009174 Bacteria 3369
110 Ga0105241_10062616 3300009174 Bacteria 2868
111 Ga0105241_10268910 3300009174 Bacteria 1452
112 Ga0105248_10000002 3300009177 Bacteria 1054120
113 Ga0105248_10092801 3300009177 Bacteria 3400
114 Ga0105237_10006704 3300009545 Bacteria 12728
115 Ga0105237_10040701 3300009545 Bacteria 4686
116 Ga0105237_10044257 3300009545 Bacteria 4482
117 Ga0105237_10229337 3300009545 Bacteria 1858
118 Ga0105238_10000251 3300009551 Bacteria 59944
119 Ga0105238_10000626 3300009551 Bacteria 37164
120 Ga0105238_10002554 3300009551 Bacteria 18184
121 Ga0105238_10009510 3300009551 Bacteria 9728
122 Ga0105238_10009744 3300009551 Bacteria 9621
123 Ga0105238_10018622 3300009551 Bacteria 7071
124 Ga0105238_10044545 3300009551 Bacteria 4485
125 Ga0105238_10100247 3300009551 Bacteria 2879
126 Ga0105238_10149559 3300009551 Bacteria 2310
127 Ga0105249_10186733 3300009553 Bacteria 2020
128 Ga0105239_10000725 3300010375 Bacteria 46872
129 Ga0105239_10008997 3300010375 Bacteria 11301
130 Ga0105239_10238785 3300010375 Bacteria 2040
131 Ga0105239_10264936 3300010375 Bacteria 1932
132 Ga0105239_10408134 3300010375 Bacteria 1538
133 Ga0105239_10742634 3300010375 Bacteria 1123
134 Ga0105239_11773346 3300010375 Bacteria 715
135 Ga0105239_11773347 3300010375 Unclassified 715
136 Ga0105246_10041038 3300011119 Bacteria 3126
137 Ga0105246_10379672 3300011119 Bacteria 1167
138 Ga0157373_10271730 3300013100 Unclassified 1200
139 Ga0157371_10018919 3300013102 Bacteria 5085
140 Ga0157371_10124778 3300013102 Bacteria 1831
141 Ga0157371_10437278 3300013102 Bacteria 961
142 Ga0157370_10000110 3300013104 Bacteria 95051
143 Ga0157370_10139489 3300013104 Bacteria 2259
144 Ga0157369_10000162 3300013105 Bacteria 94983
145 Ga0157369_10000369 3300013105 Bacteria 59934
146 Ga0157369_10003992 3300013105 Bacteria 17499
147 Ga0157369_10004534 3300013105 Bacteria 16345
148 Ga0157369_10009288 3300013105 Bacteria 11248
149 Ga0157369_10056299 3300013105 Bacteria 4243
150 Ga0157369_10111592 3300013105 Unclassified 2906
151 Ga0157369_10270141 3300013105 Bacteria 1772
152 Ga0157369_10515770 3300013105 Bacteria 1237
153 Ga0157369_10604110 3300013105 Unclassified 1132
154 Ga0157369_10882393 3300013105 Archaea 918
155 Ga0157374_10019189 3300013296 Bacteria 6050
156 Ga0157374_10029438 3300013296 Bacteria 4973
157 Ga0157374_10033123 3300013296 Bacteria 4712
158 Ga0157374_10273474 3300013296 Bacteria 1666
159 Ga0157378_10099841 3300013297 Bacteria 2648
160 Ga0157378_10102579 3300013297 Unclassified 2613
161 Ga0157378_10141075 3300013297 Bacteria 2238
162 Ga0157378_10587658 3300013297 Bacteria 1123
163 Ga0163162_10596395 3300013306 Bacteria 1231
164 Ga0163162_10994921 3300013306 Bacteria 948
165 Ga0157372_10000653 3300013307 Bacteria 38131
166 Ga0157372_10000659 3300013307 Bacteria 37935
167 Ga0157372_10071118 3300013307 Bacteria 3917
168 Ga0157372_10080407 3300013307 Bacteria 3687
169 Ga0157372_10156994 3300013307 Unclassified 2628
170 Ga0157372_10200718 3300013307 Bacteria 2310
171 Ga0157375_10009984 3300013308 Bacteria 8347
172 Ga0157375_10017429 3300013308 Bacteria 6481
173 Ga0163163_10000249 3300014325 Bacteria 54997
174 Ga0157379_10002268 3300014968 Bacteria 16026
175 Ga0157379_10083849 3300014968 Bacteria 2857
176 Ga0157379_10114653 3300014968 Bacteria 2422
177 Ga0157376_10023893 3300014969 Bacteria 4793
178 Ga0157376_10038564 3300014969 Bacteria 3888
179 Ga0157376_10137971 3300014969 Unclassified 2184
180 Ga0207697_10025963 3300025315 Bacteria 2395
181 Ga0207656_10004491 3300025321 Bacteria 4878
182 Ga0207656_10012893 3300025321 Bacteria 3184
183 Ga0207656_10045568 3300025321 Unclassified 1877
184 Ga0207710_10001603 3300025900 Bacteria 11070
185 Ga0207680_10091947 3300025903 Bacteria 1932
186 Ga0207705_10003726 3300025909 Bacteria 11602
187 Ga0207654_10000053 3300025911 Bacteria 83591
188 Ga0207654_10000548 3300025911 Bacteria 21477
189 Ga0207654_10009436 3300025911 Bacteria 4957
190 Ga0207654_10067595 3300025911 Bacteria 2112
191 Ga0207707_10006696 3300025912 Bacteria 10055
192 Ga0207695_10000035 3300025913 Bacteria 486590
193 Ga0207695_10000047 3300025913 Bacteria 422459
194 Ga0207695_10000162 3300025913 Bacteria 198155
195 Ga0207695_10001900 3300025913 Bacteria 32599
196 Ga0207695_10015343 3300025913 Bacteria 9021
197 Ga0207695_10025680 3300025913 Bacteria 6589
198 Ga0207695_10026662 3300025913 Bacteria 6448
199 Ga0207695_10120884 3300025913 Bacteria 2587
200 Ga0207695_10354573 3300025913 Unclassified 1354
201 Ga0207695_10518474 3300025913 Unclassified 1074
202 Ga0207671_10000155 3300025914 Bacteria 106931
203 Ga0207671_10001417 3300025914 Bacteria 27842
204 Ga0207671_10347141 3300025914 Bacteria 1176
205 Ga0207657_10006135 3300025919 Bacteria 12491
206 Ga0207649_10001760 3300025920 Bacteria 12425
207 Ga0207649_10053494 3300025920 Unclassified 2509
208 Ga0207649_10147821 3300025920 Unclassified 1615
209 Ga0207649_10179449 3300025920 Unclassified 1481
210 Ga0207652_10004080 3300025921 Bacteria 11912
211 Ga0207652_10539283 3300025921 Bacteria 1049
212 Ga0207694_10000142 3300025924 Bacteria 74189
213 Ga0207694_10000146 3300025924 Bacteria 72706
214 Ga0207694_10012878 3300025924 Bacteria 6299
215 Ga0207694_10023202 3300025924 Bacteria 4711
216 Ga0207694_10166292 3300025924 Bacteria 1784
217 Ga0207694_10209256 3300025924 Unclassified 1588
218 Ga0207650_10011790 3300025925 Bacteria 6026
219 Ga0207687_10023548 3300025927 Bacteria 4107
220 Ga0207687_10062807 3300025927 Bacteria 2628
221 Ga0207664_10497293 3300025929 Unclassified 1092
222 Ga0207664_10646504 3300025929 Bacteria 950
223 Ga0207644_10008731 3300025931 Bacteria 6633
224 Ga0207644_10066621 3300025931 Bacteria 2623
225 Ga0207706_10058014 3300025933 Bacteria 3410
226 Ga0207704_10550916 3300025938 Bacteria 937
227 Ga0207691_10010952 3300025940 Bacteria 8704
228 Ga0207711_10000052 3300025941 Bacteria 138437
229 Ga0207711_10445732 3300025941 Bacteria 1205
230 Ga0207689_10141656 3300025942 Unclassified 1981
231 Ga0207661_10002167 3300025944 Bacteria 13529
232 Ga0207661_10007197 3300025944 Bacteria 7906
233 Ga0207661_10215761 3300025944 Bacteria 1693
234 Ga0207661_10315574 3300025944 Bacteria 1404
235 Ga0207661_10588926 3300025944 Bacteria 1020
236 Ga0207679_10238558 3300025945 Bacteria 1539
237 Ga0207667_10000079 3300025949 Bacteria 163341
238 Ga0207667_10003680 3300025949 Bacteria 18901
239 Ga0207667_10005832 3300025949 Bacteria 15009
240 Ga0207667_10009348 3300025949 Bacteria 11558
241 Ga0207640_10092734 3300025981 Unclassified 2096
242 Ga0207640_10096451 3300025981 Unclassified 2062
243 Ga0207658_10021309 3300025986 Bacteria 4497
244 Ga0207677_10000782 3300026023 Bacteria 18219
245 Ga0207677_10464554 3300026023 Unclassified 1087
246 Ga0207703_10262902 3300026035 Bacteria 1560
247 Ga0207639_10000098 3300026041 Bacteria 73865
248 Ga0207639_10008813 3300026041 Bacteria 6934
249 Ga0207639_10020371 3300026041 Unclassified 4747
250 Ga0207702_10004419 3300026078 Bacteria 12499
251 Ga0207702_10006259 3300026078 Bacteria 10286
252 Ga0207702_10010752 3300026078 Bacteria 7640
253 Ga0207702_10012110 3300026078 Bacteria 7175
254 Ga0207702_10737243 3300026078 Bacteria 972
255 Ga0207676_10006239 3300026095 Bacteria 8415
256 Ga0207674_10001977 3300026116 Bacteria 25960
257 Ga0207674_10007021 3300026116 Bacteria 13168
258 Ga0207674_10142319 3300026116 Bacteria 2358
259 Ga0207683_10001884 3300026121 Bacteria 18560
260 Ga0207698_10000025 3300026142 Bacteria 122764
261 Ga0207698_10000241 3300026142 Bacteria 33787
262 Ga0207698_10024992 3300026142 Bacteria 4200
263 Ga0268266_10015493 3300028379 Bacteria 6541
264 Ga0268266_10277108 3300028379 Bacteria 1558
265 Ga0268264_10002705 3300028381 Bacteria 15468
266 Ga0268264_10562224 3300028381 Bacteria 1120
267 Ga0265336_10002225 3300028666 Bacteria 8158
268 Ga0265336_10012390 3300028666 Unclassified 2871
269 Ga0265338_10003758 3300028800 Bacteria 21091
270 Ga0265338_10013845 3300028800 Bacteria 9061
271 Ga0265338_10169479 3300028800 Unclassified 1676
272 Ga0265330_10000381 3300031235 Bacteria 30845
273 Ga0265330_10002070 3300031235 Bacteria 11096
274 Ga0265330_10002243 3300031235 Bacteria 10649
275 Ga0265330_10005779 3300031235 Bacteria 6141
276 Ga0265328_10005092 3300031239 Bacteria 5659
277 Ga0265328_10010267 3300031239 Bacteria 3776
278 Ga0265328_10021634 3300031239 Unclassified 2452
279 Ga0265320_10034541 3300031240 Bacteria 2571
280 Ga0265325_10000274 3300031241 Bacteria 36669
281 Ga0265325_10003141 3300031241 Bacteria 10892
282 Ga0265325_10014693 3300031241 Bacteria 4418
283 Ga0265325_10017925 3300031241 Bacteria 3932
284 Ga0265325_10098674 3300031241 Bacteria 1432
285 Ga0265329_10063859 3300031242 Bacteria 1165
286 Ga0265340_10007126 3300031247 Bacteria 6093
287 Ga0265340_10037394 3300031247 Bacteria 2405
288 Ga0265340_10059846 3300031247 Unclassified 1826
289 Ga0265340_10066953 3300031247 Bacteria 1708
290 Ga0265339_10000119 3300031249 Bacteria 64829
291 Ga0265339_10000552 3300031249 Bacteria 29264
292 Ga0265339_10002502 3300031249 Bacteria 13128
293 Ga0265339_10007976 3300031249 Bacteria 6792
294 Ga0265339_10020353 3300031249 Bacteria 3877
295 Ga0265339_10096475 3300031249 Bacteria 1543
296 Ga0265339_10160306 3300031249 Bacteria 1132
297 Ga0265339_10192883 3300031249 Bacteria 1009
298 Ga0265331_10031962 3300031250 Bacteria 2612
299 Ga0265316_10000110 3300031344 Bacteria 87898
300 Ga0265316_10001682 3300031344 Bacteria 23511
301 Ga0265316_10003751 3300031344 Bacteria 15274
302 Ga0265316_10011557 3300031344 Bacteria 7951
303 Ga0265316_10015709 3300031344 Bacteria 6606
304 Ga0265316_10021908 3300031344 Bacteria 5402
305 Ga0265316_10035661 3300031344 Bacteria 4029
306 Ga0265316_10063709 3300031344 Unclassified 2858
307 Ga0265316_10157031 3300031344 Bacteria 1702
308 Ga0265316_10227710 3300031344 Unclassified 1374
309 Ga0265313_10018069 3300031595 Bacteria 3975
310 Ga0265313_10024176 3300031595 Unclassified 3251
311 Ga0265314_10003860 3300031711 Bacteria 14299
312 Ga0265314_10073374 3300031711 Bacteria 2282
313 Ga0265314_10076601 3300031711 Bacteria 2221
314 Ga0265314_10131051 3300031711 Bacteria 1564
315 Ga0265314_10232664 3300031711 Bacteria 1068
316 Ga0265314_10238251 3300031711 Bacteria 1051
317 Ga0265342_10000259 3300031712 Bacteria 59500
318 Ga0265342_10001022 3300031712 Bacteria 27535
319 Ga0265342_10008845 3300031712 Bacteria 7176
320 Ga0265342_10026852 3300031712 Bacteria 3604
321 Ga0265342_10036451 3300031712 Bacteria 3004
322 Ga0265342_10101350 3300031712 Unclassified 1639
323 Ga0265342_10293327 3300031712 Bacteria 858
324 Ga0316583_10042977 3300032133 Unclassified 1597
325 Ga0373955_0203256 3300035172 Bacteria 1180
326 Ga0373924_0159498 3300035410 Unclassified 989
327 Ga0373933_0069898 3300035724 Bacteria 2135
328 Ga0373933_0486920 3300035724 Unclassified 808
329 Ga0373937_0005221 3300036401 Bacteria 11095
330 Ga0373937_0327638 3300036401 Bacteria 1449
331 Ga0466966_0305527 3300044684 Bacteria 956
332 Ga0466961_0176281 3300044693 Bacteria 1328
333 Ga0466963_0000573 3300044694 Bacteria 17417
334 Ga0466967_0077901 3300045976 Bacteria 2985
335 Ga0466967_0249167 3300045976 Bacteria 1696
336 Ga0495580_0071603 3300046472 Unclassified 2422
337 Ga0495652_0189052 3300046529 Bacteria 1573
338 Ga0495665_0097071 3300046531 Unclassified 1547
339 Ga0495645_0014811 3300046543 Bacteria 5540
340 Ga0495623_0264713 3300046679 Bacteria 962
341 Ga0495669_0052766 3300046684 Bacteria 1828
342 Ga0495613_0053229 3300046689 Bacteria 2979
343 Ga0495613_0266767 3300046689 Unclassified 1191
344 Ga0495600_0150596 3300046809 Bacteria 1506
345 Ga0495674_0224420 3300047319 Unclassified 1552
346 Ga0495686_0009283 3300047472 Bacteria 7102
347 Ga0496100_0148092 3300048903 Bacteria 1671
348 Ga0496105_0104112 3300048908 Bacteria 2344
349 Ga0496105_0669404 3300048908 Bacteria 799
350 Ga0496107_0059790 3300048910 Unclassified 2758
351 Ga0496110_0304046 3300048913 Bacteria 1453
352 Ga0496114_0020531 3300048917 Bacteria 5361
353 Ga0496115_0032201 3300048918 Unclassified 4136
354 Ga0496115_0057621 3300048918 Bacteria 3125
355 Ga0496115_0075527 3300048918 Bacteria 2737
356 Ga0496115_0367304 3300048918 Bacteria 1172
357 Ga0500595_009008 3300053119 Bacteria 4053
358 2881635840 2881633906 Bacteria 2972201
359 Ga0157369_10314980
360 rootH2_10101615
361 rootH2_10297605
362 rootH1_10258698
363 Ga0070658_10011219
364 Ga0070658_10108816
365 Ga0070683_100006023
366 Ga0070683_100014078
367 Ga0070683_100028634
368 Ga0070683_100325746
369 Ga0070683_100652796
370 Ga0070690_100135201
371 Ga0070670_100011591
372 Ga0070670_100089146
373 Ga0068869_100603246
374 Ga0070666_10077415
375 Ga0070680_100057277
376 Ga0070680_100220029
377 Ga0068868_100062980
378 Ga0068868_100142049
379 Ga0070660_100002524
380 Ga0070661_100002573
381 Ga0070661_100014913
382 Ga0070671_100001359
383 Ga0070671_100137691
384 Ga0070671_100375870
385 Ga0070673_100097458
386 Ga0070667_100005956
387 Ga0070714_100310515
388 Ga0070714_100793319
389 Ga0070711_100289277
390 Ga0070678_100038151
391 Ga0070662_100020611
392 Ga0070681_10084052
393 Ga0070681_10258278
394 Ga0070679_100009151
395 Ga0070679_100754712
396 Ga0070684_100018000
397 Ga0070684_100024735
398 Ga0070684_100078893
399 Ga0070684_100725410
400 Ga0068853_100000048
401 Ga0068853_100020224
402 Ga0068853_100239836
403 Ga0070672_100013927
404 Ga0070665_100030415
405 Ga0070665_100091298
406 Ga0070665_100178099
407 Ga0070665_100432304
408 Ga0070665_100432963
409 Ga0068855_100003334
410 Ga0068855_100004613
411 Ga0068855_100013025
412 Ga0068855_100021681
413 Ga0068855_100027525
414 Ga0068855_100950771
415 Ga0070664_100087434
416 Ga0068857_100022568
417 Ga0068857_100028140
418 Ga0068857_100114638
419 Ga0068854_100071540
420 Ga0068854_100216301
421 Ga0068856_100001672
422 Ga0068856_100002877
423 Ga0068856_100024395
424 Ga0068856_100111064
425 Ga0068856_100130403
426 Ga0068856_100506007
427 Ga0068856_100593285
428 Ga0068852_100000020
429 Ga0068852_100000076
430 Ga0068852_100050663
431 Ga0068852_100185717
432 Ga0068859_101073052
433 Ga0068864_100001563
434 Ga0068851_10015301
435 Ga0068851_10049173
436 Ga0068863_100002640
437 Ga0068858_100001937
438 Ga0068858_100507998
439 Ga0068860_100000881
440 Ga0068862_100186066
441 Ga0070712_100521807
442 Ga0097621_100040565
443 Ga0097621_100143868
444 Ga0097621_100210532
445 Ga0068871_100007389
446 Ga0068871_100012754
447 Ga0068871_100063681
448 Ga0068865_100318256
449 Ga0097620_101073005
450 Ga0105240_10000145
451 Ga0105240_10001837
452 Ga0105240_10006426
453 Ga0105240_10007803
454 Ga0105240_10022639
455 Ga0105240_10080576
456 Ga0105240_10165140
457 Ga0105240_10176090
458 Ga0105240_10253978
459 Ga0105240_10257661
460 Ga0105240_10485656
461 Ga0105245_10012815
462 Ga0105247_10001592
463 Ga0105241_10000021
464 Ga0105241_10001099
465 Ga0105241_10002039
466 Ga0105241_10028226
467 Ga0105241_10044357
468 Ga0105241_10062616
469 Ga0105241_10268910
470 Ga0105248_10000002
471 Ga0105248_10092801
472 Ga0105237_10006704
473 Ga0105237_10040701
474 Ga0105237_10044257
475 Ga0105237_10229337
476 Ga0105238_10000251
477 Ga0105238_10000626
478 Ga0105238_10002554
479 Ga0105238_10009510
480 Ga0105238_10009744
481 Ga0105238_10018622
482 Ga0105238_10044545
483 Ga0105238_10100247
484 Ga0105238_10149559
485 Ga0105249_10186733
486 Ga0105239_10000725
487 Ga0105239_10008997
488 Ga0105239_10238785
489 Ga0105239_10264936
490 Ga0105239_10408134
491 Ga0105239_10742634
492 Ga0105239_11773346
493 Ga0105239_11773347
494 Ga0105246_10041038
495 Ga0105246_10379672
496 Ga0157373_10271730
497 Ga0157371_10018919
498 Ga0157371_10124778
499 Ga0157371_10437278
500 Ga0157370_10000110
501 Ga0157370_10139489
502 Ga0157369_10000162
503 Ga0157369_10000369
504 Ga0157369_10003992
505 Ga0157369_10004534
506 Ga0157369_10009288
507 Ga0157369_10056299
508 Ga0157369_10111592
509 Ga0157369_10270141
510 Ga0157369_10515770
511 Ga0157369_10604110
512 Ga0157369_10882393
513 Ga0157374_10019189
514 Ga0157374_10029438
515 Ga0157374_10033123
516 Ga0157374_10273474
517 Ga0157378_10099841
518 Ga0157378_10102579
519 Ga0157378_10141075
520 Ga0157378_10587658
521 Ga0163162_10596395
522 Ga0163162_10994921
523 Ga0157372_10000653
524 Ga0157372_10000659
525 Ga0157372_10071118
526 Ga0157372_10080407
527 Ga0157372_10156994
528 Ga0157372_10200718
529 Ga0157375_10009984
530 Ga0157375_10017429
531 Ga0163163_10000249
532 Ga0157379_10002268
533 Ga0157379_10083849
534 Ga0157379_10114653
535 Ga0157376_10023893
536 Ga0157376_10038564
537 Ga0157376_10137971
538 Ga0207697_10025963
539 Ga0207656_10004491
540 Ga0207656_10012893
541 Ga0207656_10045568
542 Ga0207710_10001603
543 Ga0207680_10091947
544 Ga0207705_10003726
545 Ga0207654_10000053
546 Ga0207654_10000548
547 Ga0207654_10009436
548 Ga0207654_10067595
549 Ga0207707_10006696
550 Ga0207695_10000035
551 Ga0207695_10000047
552 Ga0207695_10000162
553 Ga0207695_10001900
554 Ga0207695_10015343
555 Ga0207695_10025680
556 Ga0207695_10026662
557 Ga0207695_10120884
558 Ga0207695_10354573
559 Ga0207695_10518474
560 Ga0207671_10000155
561 Ga0207671_10001417
562 Ga0207671_10347141
563 Ga0207657_10006135
564 Ga0207649_10001760
565 Ga0207649_10053494
566 Ga0207649_10147821
567 Ga0207649_10179449
568 Ga0207652_10004080
569 Ga0207652_10539283
570 Ga0207694_10000142
571 Ga0207694_10000146
572 Ga0207694_10012878
573 Ga0207694_10023202
574 Ga0207694_10166292
575 Ga0207694_10209256
576 Ga0207650_10011790
577 Ga0207687_10023548
578 Ga0207687_10062807
579 Ga0207664_10497293
580 Ga0207664_10646504
581 Ga0207644_10008731
582 Ga0207644_10066621
583 Ga0207706_10058014
584 Ga0207704_10550916
585 Ga0207691_10010952
586 Ga0207711_10000052
587 Ga0207711_10445732
588 Ga0207689_10141656
589 Ga0207661_10002167
590 Ga0207661_10007197
591 Ga0207661_10215761
592 Ga0207661_10315574
593 Ga0207661_10588926
594 Ga0207679_10238558
595 Ga0207667_10000079
596 Ga0207667_10003680
597 Ga0207667_10005832
598 Ga0207667_10009348
599 Ga0207640_10092734
600 Ga0207640_10096451
601 Ga0207658_10021309
602 Ga0207677_10000782
603 Ga0207677_10464554
604 Ga0207703_10262902
605 Ga0207639_10000098
606 Ga0207639_10008813
607 Ga0207639_10020371
608 Ga0207702_10004419
609 Ga0207702_10006259
610 Ga0207702_10010752
611 Ga0207702_10012110
612 Ga0207702_10737243
613 Ga0207676_10006239
614 Ga0207674_10001977
615 Ga0207674_10007021
616 Ga0207674_10142319
617 Ga0207683_10001884
618 Ga0207698_10000025
619 Ga0207698_10000241
620 Ga0207698_10024992
621 Ga0268266_10015493
622 Ga0268266_10277108
623 Ga0268264_10002705
624 Ga0268264_10562224
625 Ga0265336_10002225
626 Ga0265336_10012390
627 Ga0265338_10003758
628 Ga0265338_10013845
629 Ga0265338_10169479
630 Ga0265330_10000381
631 Ga0265330_10002070
632 Ga0265330_10002243
633 Ga0265330_10005779
634 Ga0265328_10005092
635 Ga0265328_10010267
636 Ga0265328_10021634
637 Ga0265320_10034541
638 Ga0265325_10000274
639 Ga0265325_10003141
640 Ga0265325_10014693
641 Ga0265325_10017925
642 Ga0265325_10098674
643 Ga0265329_10063859
644 Ga0265340_10007126
645 Ga0265340_10037394
646 Ga0265340_10059846
647 Ga0265340_10066953
648 Ga0265339_10000119
649 Ga0265339_10000552
650 Ga0265339_10002502
651 Ga0265339_10007976
652 Ga0265339_10020353
653 Ga0265339_10096475
654 Ga0265339_10160306
655 Ga0265339_10192883
656 Ga0265331_10031962
657 Ga0265316_10000110
658 Ga0265316_10001682
659 Ga0265316_10003751
660 Ga0265316_10011557
661 Ga0265316_10015709
662 Ga0265316_10021908
663 Ga0265316_10035661
664 Ga0265316_10063709
665 Ga0265316_10157031
666 Ga0265316_10227710
667 Ga0265313_10018069
668 Ga0265313_10024176
669 Ga0265314_10003860
670 Ga0265314_10073374
671 Ga0265314_10076601
672 Ga0265314_10131051
673 Ga0265314_10232664
674 Ga0265314_10238251
675 Ga0265342_10000259
676 Ga0265342_10001022
677 Ga0265342_10008845
678 Ga0265342_10026852
679 Ga0265342_10036451
680 Ga0265342_10101350
681 Ga0265342_10293327
682 Ga0316583_10042977
683 Ga0373955_0203256
684 Ga0373924_0159498
685 Ga0373933_0069898
686 Ga0373933_0486920
687 Ga0373937_0005221
688 Ga0373937_0327638
689 Ga0466966_0305527
690 Ga0466961_0176281
691 Ga0466963_0000573
692 Ga0466967_0077901
693 Ga0466967_0249167
694 Ga0495580_0071603
695 Ga0495652_0189052
696 Ga0495665_0097071
697 Ga0495645_0014811
698 Ga0495623_0264713
699 Ga0495669_0052766
700 Ga0495613_0053229
701 Ga0495613_0266767
702 Ga0495600_0150596
703 Ga0495674_0224420
704 Ga0495686_0009283
705 Ga0496100_0148092
706 Ga0496105_0104112
707 Ga0496105_0669404
708 Ga0496107_0059790
709 Ga0496110_0304046
710 Ga0496114_0020531
711 Ga0496115_0032201
712 Ga0496115_0057621
713 Ga0496115_0075527
714 Ga0496115_0367304
715 Ga0500595_009008
716 2881635840

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00677

Lum_binding

Lumazine binding domain

3

86

0.93

PF00677

Lum_binding

Lumazine binding domain

99

211

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.9231 1 84
3a3g-assembly2.cif.gz_B crystal structure of lump complexed with 6,7-dimethyl-8-(1'-d-ribityl) lumazine 0.9033 1 194
3a3b-assembly1.cif.gz_B crystal structure of lump complexed with flavin mononucleotide 0.9017 1 194
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.8986 1 205
3ddy-assembly1.cif.gz_A structure of lumazine protein, an optical transponder of luminescent bacteria 0.8963 1 194
ID Description Score Start End Superfamily
af_Q2FXG0_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9364 1 84 2.40.30.20
af_P9WK35_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9306 1 84 2.40.30.20
4fxuC02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9215 101 202 2.40.30.20
af_Q9SKU8_64_151_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9132 1 84 2.40.30.20
1i8dC02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9123 130 207 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A529XQM0-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9265 100 210 GO:0004746
GO:0009231
AF-A0A354BML0-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9232 1 84 GO:0004746
GO:0009231
AF-M0D3J9-F1-model_v4 Riboflavin synthase subunit alpha (EC 2.5.1.9) 0.9226 96 210 GO:0004746
GO:0009231
AF-A0A1Q7V5T4-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9165 1 203 GO:0004746
GO:0009231
AF-A0A7C3TKP0-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9161 2 200 GO:0004746
GO:0009231

Map