F421172

General Info

Members Datasets Scaffolds Average Seq Length
358 238 716 67

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_11803356|Ga0105238_118033561
Length 70
Sequence MSKKPGLAKTRKAVSKRFKITGSGKIIRRRQGKRHLLQNKNRKXKRSLGKGVLVHETDMHAILQNMPFDR

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
133 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
134 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
135 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
136 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
141 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
168 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
169 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
170 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
171 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
174 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
175 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
184 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
233 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 2718217752 Candidatus Xiphinematobacter sp. Idaho Grape Isolate Unclassified
238 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.6
Metatranscriptomes 0.84
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.68
Nodule 0
Rhizoplane 7.54
Rhizosphere 87.71
Stem 0
Stem Tuber 0
Unclassified 25.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_11803356 3300009551 Bacteria 644
2 SwRhRL2b_contig_119116 2162886007 Unclassified 852
3 JGI24035J26624_1022333 3300002126 Bacteria 671
4 JGI25406J46586_10006883 3300003203 Bacteria 5218
5 rootH2_10001024 3300003320 Bacteria 25899
6 rootH2_10008477 3300003320 Bacteria 2368
7 rootL2_10040482 3300003322 Bacteria 6317
8 Ga0058861_11246481 3300004800 Bacteria 724
9 Ga0058862_12138894 3300004803 Bacteria 974
10 Ga0065704_10013209 3300005289 Bacteria 1521
11 Ga0065704_10638859 3300005289 Unclassified 588
12 Ga0065712_10000626 3300005290 Bacteria 15083
13 Ga0065712_10160818 3300005290 Unclassified 1304
14 Ga0065715_10015712 3300005293 Bacteria 2953
15 Ga0065707_10003613 3300005295 Bacteria 9316
16 Ga0070676_10081321 3300005328 Bacteria 1966
17 Ga0070676_10423274 3300005328 Unclassified 931
18 Ga0070683_100251443 3300005329 Unclassified 1681
19 Ga0070690_100336728 3300005330 Bacteria 1091
20 Ga0070690_101142275 3300005330 Unclassified 619
21 Ga0070670_100288440 3300005331 Bacteria 1434
22 Ga0068869_100834939 3300005334 Unclassified 794
23 Ga0068868_101850146 3300005338 Bacteria 571
24 Ga0070660_100154104 3300005339 Unclassified 1849
25 Ga0070689_100002634 3300005340 Bacteria 11759
26 Ga0070689_100155276 3300005340 Bacteria 1847
27 Ga0070692_10115856 3300005345 Unclassified 1488
28 Ga0070668_100179642 3300005347 Bacteria 1728
29 Ga0070668_100421516 3300005347 Bacteria 1143
30 Ga0070669_100186837 3300005353 Bacteria 1624
31 Ga0070675_100013878 3300005354 Bacteria 6343
32 Ga0070671_100228003 3300005355 Bacteria 1581
33 Ga0070671_101131416 3300005355 Bacteria 688
34 Ga0070673_100356006 3300005364 Bacteria 1300
35 Ga0070688_100062436 3300005365 Unclassified 2358
36 Ga0070688_100349228 3300005365 Bacteria 1082
37 Ga0070659_100001154 3300005366 Bacteria 19280
38 Ga0070703_10027696 3300005406 Unclassified 1690
39 Ga0070714_100030753 3300005435 Unclassified 4473
40 Ga0070713_100073794 3300005436 Bacteria 2889
41 Ga0070713_100278271 3300005436 Bacteria 1534
42 Ga0070701_10164962 3300005438 Bacteria 1286
43 Ga0070711_100281221 3300005439 Bacteria 1316
44 Ga0070705_100016698 3300005440 Unclassified 3818
45 Ga0070694_100181049 3300005444 Unclassified 1559
46 Ga0070663_100695011 3300005455 Unclassified 864
47 Ga0070678_101176594 3300005456 Bacteria 710
48 Ga0070662_100022986 3300005457 Unclassified 4278
49 Ga0070662_101608923 3300005457 Unclassified 561
50 Ga0070685_10272468 3300005466 Unclassified 1130
51 Ga0070684_100049498 3300005535 Unclassified 3647
52 Ga0070697_101570970 3300005536 Bacteria 588
53 Ga0068853_101858538 3300005539 Bacteria 584
54 Ga0070672_100968802 3300005543 Bacteria 753
55 Ga0070696_100592399 3300005546 Unclassified 893
56 Ga0070696_101089160 3300005546 Bacteria 671
57 Ga0070665_100461931 3300005548 Bacteria 1280
58 Ga0070665_101742457 3300005548 Bacteria 630
59 Ga0070704_100024717 3300005549 Unclassified 3945
60 Ga0070704_101223420 3300005549 Bacteria 685
61 Ga0070664_100156352 3300005564 Unclassified 2015
62 Ga0070702_100053339 3300005615 Unclassified 2323
63 Ga0070702_100277783 3300005615 Bacteria 1148
64 Ga0068852_100641835 3300005616 Bacteria 1069
65 Ga0068859_100199608 3300005617 Unclassified 2085
66 Ga0068866_10157873 3300005718 Bacteria 1320
67 Ga0068861_100416602 3300005719 Bacteria 1196
68 Ga0068861_100624310 3300005719 Unclassified 992
69 Ga0068863_100016553 3300005841 Bacteria 7075
70 Ga0068858_100118968 3300005842 Unclassified 2470
71 Ga0068858_101536644 3300005842 Unclassified 657
72 Ga0068860_100026862 3300005843 Bacteria 5547
73 Ga0068862_101130742 3300005844 Unclassified 779
74 Ga0081455_10063110 3300005937 Bacteria 3110
75 Ga0081455_10089035 3300005937 Unclassified 2506
76 Ga0081455_10118721 3300005937 Unclassified 2087
77 Ga0081538_10168916 3300005981 Bacteria 958
78 Ga0081540_1004259 3300005983 Bacteria 10981
79 Ga0081539_10000727 3300005985 Bacteria 66016
80 Ga0070717_10008369 3300006028 Bacteria 7726
81 Ga0070717_10335605 3300006028 Bacteria 1349
82 Ga0075363_100618151 3300006048 Bacteria 650
83 Ga0070715_10164780 3300006163 Bacteria 1098
84 Ga0070716_100288004 3300006173 Bacteria 1137
85 Ga0070712_100035293 3300006175 Unclassified 3395
86 Ga0070712_100157956 3300006175 Unclassified 1748
87 Ga0070712_100420708 3300006175 Bacteria 1107
88 Ga0070712_100672929 3300006175 Bacteria 881
89 Ga0070712_100809934 3300006175 Bacteria 804
90 Ga0097621_100173710 3300006237 Bacteria 1859
91 Ga0097621_100277977 3300006237 Bacteria 1473
92 Ga0068871_100228145 3300006358 Bacteria 1615
93 Ga0068871_100464194 3300006358 Bacteria 1137
94 Ga0075428_102311878 3300006844 Bacteria 553
95 Ga0075434_102166854 3300006871 Unclassified 560
96 Ga0068865_100078429 3300006881 Bacteria 2363
97 Ga0097620_100199611 3300006931 Unclassified 2085
98 Ga0075435_100484216 3300007076 Bacteria 1069
99 Ga0075435_100605391 3300007076 Unclassified 950
100 Ga0075435_101045177 3300007076 Bacteria 713
101 Ga0105251_10322958 3300009011 Bacteria 702
102 Ga0105240_11934205 3300009093 Bacteria 613
103 Ga0105245_11461784 3300009098 Bacteria 734
104 Ga0105247_10074897 3300009101 Bacteria 2124
105 Ga0105243_11447691 3300009148 Bacteria 709
106 Ga0105241_10419521 3300009174 Unclassified 1177
107 Ga0105248_10172172 3300009177 Unclassified 2440
108 Ga0105248_12942942 3300009177 Unclassified 543
109 Ga0105237_10453947 3300009545 Unclassified 1288
110 Ga0105238_11779613 3300009551 Bacteria 648
111 Ga0105249_10042139 3300009553 Unclassified 4151
112 Ga0157371_11006397 3300013102 Unclassified 636
113 Ga0157374_10984570 3300013296 Bacteria 862
114 Ga0157378_10023221 3300013297 Bacteria 5458
115 Ga0157378_10064719 3300013297 Unclassified 3272
116 Ga0157378_11088286 3300013297 Bacteria 836
117 Ga0157378_11649950 3300013297 Unclassified 687
118 Ga0163162_10345295 3300013306 Unclassified 1621
119 Ga0163162_10546004 3300013306 Bacteria 1287
120 Ga0163162_10922474 3300013306 Bacteria 986
121 Ga0163162_11204869 3300013306 Bacteria 859
122 Ga0157372_11516926 3300013307 Bacteria 772
123 Ga0157375_10002759 3300013308 Bacteria 15191
124 Ga0157375_10356766 3300013308 Bacteria 1628
125 Ga0157375_10418209 3300013308 Bacteria 1506
126 Ga0157375_12727150 3300013308 Unclassified 591
127 Ga0163163_10203615 3300014325 Unclassified 2028
128 Ga0163163_11183433 3300014325 Bacteria 827
129 Ga0163163_11391536 3300014325 Bacteria 763
130 Ga0157377_10056455 3300014745 Unclassified 2230
131 Ga0157379_10003796 3300014968 Bacteria 12869
132 Ga0157376_10591155 3300014969 Bacteria 1104
133 Ga0157376_11520441 3300014969 Bacteria 703
134 Ga0157376_12535435 3300014969 Unclassified 552
135 Ga0182007_10277613 3300015262 Unclassified 609
136 Ga0163161_10116020 3300017792 Bacteria 2007
137 Ga0163161_11645293 3300017792 Bacteria 567
138 Ga0213876_10051980 3300021384 Unclassified 2166
139 Ga0207673_1062687 3300025290 Bacteria 530
140 Ga0207697_10000749 3300025315 Bacteria 18385
141 Ga0207653_10027475 3300025885 Unclassified 1827
142 Ga0207692_10142581 3300025898 Bacteria 1364
143 Ga0207642_10753901 3300025899 Bacteria 616
144 Ga0207710_10706206 3300025900 Unclassified 529
145 Ga0207688_10488481 3300025901 Bacteria 770
146 Ga0207647_10663096 3300025904 Bacteria 571
147 Ga0207685_10326473 3300025905 Unclassified 767
148 Ga0207654_11099131 3300025911 Bacteria 579
149 Ga0207693_10050089 3300025915 Unclassified 3280
150 Ga0207693_10063904 3300025915 Bacteria 2884
151 Ga0207693_10282106 3300025915 Bacteria 1302
152 Ga0207663_10132634 3300025916 Bacteria 1724
153 Ga0207657_10061798 3300025919 Unclassified 3210
154 Ga0207694_10976632 3300025924 Bacteria 716
155 Ga0207650_10726459 3300025925 Bacteria 840
156 Ga0207659_10034033 3300025926 Unclassified 3511
157 Ga0207700_10029293 3300025928 Bacteria 3883
158 Ga0207690_10016085 3300025932 Unclassified 4547
159 Ga0207706_10036596 3300025933 Unclassified 4360
160 Ga0207706_10386185 3300025933 Bacteria 1215
161 Ga0207709_10891976 3300025935 Bacteria 722
162 Ga0207704_10052750 3300025938 Bacteria 2467
163 Ga0207665_10087773 3300025939 Unclassified 2150
164 Ga0207665_10522228 3300025939 Unclassified 919
165 Ga0207679_11710802 3300025945 Bacteria 575
166 Ga0207667_10856360 3300025949 Bacteria 903
167 Ga0207651_10701910 3300025960 Bacteria 891
168 Ga0207668_11771465 3300025972 Unclassified 557
169 Ga0207658_10548104 3300025986 Bacteria 1035
170 Ga0207677_10153045 3300026023 Bacteria 1782
171 Ga0207703_10029366 3300026035 Unclassified 4338
172 Ga0207703_11258152 3300026035 Bacteria 711
173 Ga0207678_10615768 3300026067 Unclassified 952
174 Ga0207708_10025715 3300026075 Unclassified 4455
175 Ga0207641_10019247 3300026088 Bacteria 5602
176 Ga0207676_11036899 3300026095 Unclassified 809
177 Ga0207675_100373029 3300026118 Bacteria 1402
178 Ga0207675_101256337 3300026118 Unclassified 761
179 Ga0207698_10653015 3300026142 Bacteria 1042
180 Ga0268266_10405118 3300028379 Bacteria 1290
181 Ga0268264_10006406 3300028381 Bacteria 9914
182 Ga0265337_1005866 3300028556 Bacteria 4810
183 Ga0265319_1000046 3300028563 Bacteria 101716
184 Ga0265319_1001086 3300028563 Bacteria 16899
185 Ga0265319_1003290 3300028563 Bacteria 8497
186 Ga0265319_1010007 3300028563 Bacteria 3984
187 Ga0265319_1023264 3300028563 Bacteria 2246
188 Ga0265319_1041892 3300028563 Bacteria 1542
189 Ga0265319_1081400 3300028563 Bacteria 1028
190 Ga0265334_10007532 3300028573 Bacteria 4665
191 Ga0265334_10258031 3300028573 Bacteria 599
192 Ga0265318_10000075 3300028577 Bacteria 94310
193 Ga0265318_10001192 3300028577 Bacteria 15934
194 Ga0265322_10015098 3300028654 Bacteria 2233
195 Ga0265322_10033096 3300028654 Bacteria 1474
196 Ga0265338_10245735 3300028800 Bacteria 1323
197 Ga0265330_10215880 3300031235 Bacteria 810
198 Ga0265332_10046549 3300031238 Bacteria 1867
199 Ga0265328_10134280 3300031239 Bacteria 927
200 Ga0265320_10000543 3300031240 Bacteria 29128
201 Ga0265320_10001241 3300031240 Bacteria 18734
202 Ga0265320_10001398 3300031240 Bacteria 17538
203 Ga0265320_10002901 3300031240 Bacteria 11757
204 Ga0265320_10010619 3300031240 Bacteria 5467
205 Ga0265320_10015884 3300031240 Bacteria 4239
206 Ga0265320_10051033 3300031240 Bacteria 2009
207 Ga0265320_10122139 3300031240 Bacteria 1187
208 Ga0265320_10307930 3300031240 Bacteria 700
209 Ga0265325_10093590 3300031241 Bacteria 1479
210 Ga0265325_10162254 3300031241 Bacteria 1051
211 Ga0265329_10156489 3300031242 Bacteria 739
212 Ga0265339_10142773 3300031249 Bacteria 1217
213 Ga0265339_10282540 3300031249 Bacteria 795
214 Ga0265331_10060189 3300031250 Bacteria 1794
215 Ga0265331_10070705 3300031250 Bacteria 1633
216 Ga0265327_10000088 3300031251 Bacteria 198019
217 Ga0265327_10013100 3300031251 Bacteria 5531
218 Ga0265316_10022325 3300031344 Bacteria 5338
219 Ga0265316_10134920 3300031344 Bacteria 1857
220 Ga0265316_10179213 3300031344 Bacteria 1578
221 Ga0265316_10421575 3300031344 Bacteria 959
222 Ga0265313_10000174 3300031595 Bacteria 68230
223 Ga0265313_10003599 3300031595 Bacteria 12454
224 Ga0265313_10004935 3300031595 Bacteria 9989
225 Ga0265313_10008045 3300031595 Bacteria 7064
226 Ga0265313_10029672 3300031595 Bacteria 2826
227 Ga0265313_10045847 3300031595 Bacteria 2126
228 Ga0265313_10269155 3300031595 Unclassified 691
229 Ga0307508_10000031 3300031616 Bacteria 163301
230 Ga0265314_10001615 3300031711 Bacteria 24736
231 Ga0265314_10002099 3300031711 Bacteria 20977
232 Ga0265314_10195658 3300031711 Bacteria 1199
233 Ga0265314_10458707 3300031711 Bacteria 677
234 Ga0265342_10006926 3300031712 Bacteria 8378
235 Ga0265342_10100780 3300031712 Bacteria 1645
236 Ga0265342_10282335 3300031712 Bacteria 878
237 Ga0373959_0161069 3300034820 Bacteria 573
238 Ga0373923_0146596 3300035111 Bacteria 1070
239 Ga0373953_0500354 3300035117 Bacteria 539
240 Ga0373956_0306164 3300035119 Unclassified 757
241 Ga0373956_0429136 3300035119 Unclassified 631
242 Ga0373960_0198596 3300035121 Bacteria 708
243 Ga0373955_0356550 3300035172 Bacteria 886
244 Ga0373942_0016554 3300035207 Bacteria 1809
245 Ga0373931_0159015 3300035691 Bacteria 1323
246 Ga0373931_0689917 3300035691 Bacteria 674
247 Ga0373935_0273391 3300035692 Bacteria 1188
248 Ga0373933_0785431 3300035724 Bacteria 627
249 Ga0373947_0846845 3300035725 Unclassified 624
250 Ga0373937_0231173 3300036401 Bacteria 1742
251 Ga0373937_0474091 3300036401 Bacteria 1189
252 Ga0395905_1151800 3300037471 Unclassified 679
253 Ga0436365_1835944 3300039437 Bacteria 17341
254 Ga0436363_1569325 3300039450 Bacteria 528
255 Ga0439465_0208532 3300041413 Bacteria 714
256 Ga0451797_0478907 3300041453 Bacteria 783
257 Ga0451795_1535445 3300041456 Bacteria 615
258 Ga0451800_1539113 3300041459 Bacteria 662
259 Ga0451849_0326598 3300041505 Bacteria 695
260 Ga0451853_3270778 3300041512 Bacteria 569
261 Ga0439445_0003694 3300042004 Bacteria 3434
262 Ga0439445_0008637 3300042004 Bacteria 2386
263 Ga0439445_0159561 3300042004 Bacteria 658
264 Ga0450915_013387 3300042119 Bacteria 600
265 Ga0439446_0072115 3300042156 Bacteria 1058
266 Ga0451577_0002636 3300042876 Bacteria 21012
267 Ga0451577_0095927 3300042876 Bacteria 2648
268 Ga0451577_0146088 3300042876 Bacteria 2126
269 Ga0451577_0286917 3300042876 Bacteria 1491
270 Ga0451577_0452863 3300042876 Bacteria 1165
271 Ga0466961_0392025 3300044693 Bacteria 843
272 Ga0453684_0031309 3300044712 Bacteria 7482
273 Ga0453684_0069921 3300044712 Bacteria 4449
274 Ga0453684_0277013 3300044712 Bacteria 1914
275 Ga0451576_0004441 3300045051 Bacteria 18215
276 Ga0451576_0107051 3300045051 Bacteria 2909
277 Ga0451576_0136516 3300045051 Bacteria 2558
278 Ga0451576_0142809 3300045051 Bacteria 2496
279 Ga0451576_0374957 3300045051 Unclassified 1491
280 Ga0451576_0738549 3300045051 Bacteria 1034
281 Ga0451576_0738888 3300045051 Bacteria 1034
282 Ga0451576_1557481 3300045051 Bacteria 686
283 Ga0451576_1974812 3300045051 Unclassified 601
284 Ga0466967_0064077 3300045976 Bacteria 3268
285 Ga0495592_0613084 3300046454 Bacteria 663
286 Ga0495629_1035463 3300046459 Bacteria 533
287 Ga0495605_0136760 3300046474 Bacteria 1102
288 Ga0495607_0289798 3300046501 Unclassified 774
289 Ga0495628_0448620 3300046516 Bacteria 937
290 Ga0495642_0039549 3300046528 Bacteria 1914
291 Ga0495640_0116537 3300046533 Unclassified 1740
292 Ga0495598_0085222 3300046537 Bacteria 1021
293 Ga0495667_0547638 3300046559 Bacteria 723
294 Ga0495611_0270625 3300046648 Bacteria 786
295 Ga0495635_1001637 3300046663 Unclassified 532
296 Ga0495669_0184442 3300046684 Bacteria 995
297 Ga0495636_0101451 3300047318 Unclassified 1259
298 Ga0495674_0283165 3300047319 Bacteria 1358
299 Ga0495675_0843898 3300047444 Bacteria 505
300 Ga0495686_0366011 3300047472 Bacteria 781
301 Ga0495626_0248217 3300048091 Unclassified 715
302 Ga0496100_1461922 3300048903 Bacteria 540
303 Ga0496101_0041001 3300048904 Unclassified 3299
304 Ga0496101_0503239 3300048904 Bacteria 957
305 Ga0496102_0052897 3300048905 Bacteria 3701
306 Ga0496102_1380084 3300048905 Unclassified 624
307 Ga0496102_1861394 3300048905 Unclassified 519
308 Ga0496103_0463960 3300048906 Bacteria 812
309 Ga0496103_0472393 3300048906 Bacteria 804
310 Ga0496104_0227069 3300048907 Bacteria 1779
311 Ga0496105_0067315 3300048908 Bacteria 2957
312 Ga0496105_1197384 3300048908 Unclassified 559
313 Ga0496106_0165595 3300048909 Unclassified 1750
314 Ga0496107_0387716 3300048910 Bacteria 1039
315 Ga0496108_0002475 3300048911 Bacteria 14788
316 Ga0496109_0002007 3300048912 Bacteria 16881
317 Ga0496109_1290972 3300048912 Bacteria 666
318 Ga0496110_1737838 3300048913 Unclassified 534
319 Ga0496111_1307521 3300048914 Unclassified 511
320 Ga0496112_0039437 3300048915 Bacteria 4616
321 Ga0496113_0017817 3300048916 Bacteria 4937
322 Ga0496114_0017959 3300048917 Bacteria 5716
323 Ga0496114_0496985 3300048917 Unclassified 1079
324 Ga0496115_0001716 3300048918 Bacteria 15716
325 Ga0496115_0454112 3300048918 Bacteria 1035
326 Ga0501032_0002109 3300049569 Bacteria 15695
327 Ga0501032_0353907 3300049569 Bacteria 946
328 Ga0501033_0000009 3300049570 Bacteria 272351
329 Ga0501034_0328613 3300049571 Bacteria 1461
330 Ga0501036_0640457 3300049572 Bacteria 880
331 Ga0501038_0000555 3300049574 Bacteria 32977
332 Ga0501039_0733260 3300049575 Bacteria 772
333 Ga0501043_0353416 3300049579 Bacteria 1116
334 Ga0501043_1030465 3300049579 Bacteria 584
335 Ga0501046_0014396 3300049580 Bacteria 6677
336 Ga0501046_0363836 3300049580 Bacteria 1048
337 Ga0501047_0020244 3300049581 Bacteria 6389
338 Ga0501047_0177366 3300049581 Bacteria 1998
339 Ga0501047_0822310 3300049581 Bacteria 743
340 Ga0501067_0023744 3300049583 Bacteria 3399
341 Ga0501070_0192447 3300049586 Bacteria 1676
342 Ga0501080_0003963 3300049742 Bacteria 13109
343 Ga0501080_1165541 3300049742 Unclassified 664
344 Ga0501035_0807186 3300049822 Bacteria 749
345 Ga0501035_1396127 3300049822 Bacteria 537
346 Ga0501044_0766537 3300049823 Bacteria 846
347 nmdc:mga03n38_689002_c1 3300050490 Unclassified 588
348 nmdc:mga0n895_1770021_c1 3300050512 Unclassified 579
349 nmdc:mga0rr50_587701_c1 3300050513 Unclassified 949
350 nmdc:mga0rr50_718073_c1 3300050513 Bacteria 853
351 Ga0495601_0634026 3300053077 Bacteria 684
352 Ga0500556_0109227 3300053104 Bacteria 1071
353 Ga0500593_156729 3300053117 Bacteria 875
354 Ga0500568_0004512 3300053139 Bacteria 7418
355 Ga0500616_0018547 3300053153 Bacteria 3932
356 Ga0587080_070325 3300059503 Bacteria 699
357 2718715882 2718217752 Bacteria 915884
358 2787509240 2786546548 Bacteria 4745694
359 Ga0105238_11803356
360 SwRhRL2b_contig_119116
361 JGI24035J26624_1022333
362 JGI25406J46586_10006883
363 rootH2_10001024
364 rootH2_10008477
365 rootL2_10040482
366 Ga0058861_11246481
367 Ga0058862_12138894
368 Ga0065704_10013209
369 Ga0065704_10638859
370 Ga0065712_10000626
371 Ga0065712_10160818
372 Ga0065715_10015712
373 Ga0065707_10003613
374 Ga0070676_10081321
375 Ga0070676_10423274
376 Ga0070683_100251443
377 Ga0070690_100336728
378 Ga0070690_101142275
379 Ga0070670_100288440
380 Ga0068869_100834939
381 Ga0068868_101850146
382 Ga0070660_100154104
383 Ga0070689_100002634
384 Ga0070689_100155276
385 Ga0070692_10115856
386 Ga0070668_100179642
387 Ga0070668_100421516
388 Ga0070669_100186837
389 Ga0070675_100013878
390 Ga0070671_100228003
391 Ga0070671_101131416
392 Ga0070673_100356006
393 Ga0070688_100062436
394 Ga0070688_100349228
395 Ga0070659_100001154
396 Ga0070703_10027696
397 Ga0070714_100030753
398 Ga0070713_100073794
399 Ga0070713_100278271
400 Ga0070701_10164962
401 Ga0070711_100281221
402 Ga0070705_100016698
403 Ga0070694_100181049
404 Ga0070663_100695011
405 Ga0070678_101176594
406 Ga0070662_100022986
407 Ga0070662_101608923
408 Ga0070685_10272468
409 Ga0070684_100049498
410 Ga0070697_101570970
411 Ga0068853_101858538
412 Ga0070672_100968802
413 Ga0070696_100592399
414 Ga0070696_101089160
415 Ga0070665_100461931
416 Ga0070665_101742457
417 Ga0070704_100024717
418 Ga0070704_101223420
419 Ga0070664_100156352
420 Ga0070702_100053339
421 Ga0070702_100277783
422 Ga0068852_100641835
423 Ga0068859_100199608
424 Ga0068866_10157873
425 Ga0068861_100416602
426 Ga0068861_100624310
427 Ga0068863_100016553
428 Ga0068858_100118968
429 Ga0068858_101536644
430 Ga0068860_100026862
431 Ga0068862_101130742
432 Ga0081455_10063110
433 Ga0081455_10089035
434 Ga0081455_10118721
435 Ga0081538_10168916
436 Ga0081540_1004259
437 Ga0081539_10000727
438 Ga0070717_10008369
439 Ga0070717_10335605
440 Ga0075363_100618151
441 Ga0070715_10164780
442 Ga0070716_100288004
443 Ga0070712_100035293
444 Ga0070712_100157956
445 Ga0070712_100420708
446 Ga0070712_100672929
447 Ga0070712_100809934
448 Ga0097621_100173710
449 Ga0097621_100277977
450 Ga0068871_100228145
451 Ga0068871_100464194
452 Ga0075428_102311878
453 Ga0075434_102166854
454 Ga0068865_100078429
455 Ga0097620_100199611
456 Ga0075435_100484216
457 Ga0075435_100605391
458 Ga0075435_101045177
459 Ga0105251_10322958
460 Ga0105240_11934205
461 Ga0105245_11461784
462 Ga0105247_10074897
463 Ga0105243_11447691
464 Ga0105241_10419521
465 Ga0105248_10172172
466 Ga0105248_12942942
467 Ga0105237_10453947
468 Ga0105238_11779613
469 Ga0105249_10042139
470 Ga0157371_11006397
471 Ga0157374_10984570
472 Ga0157378_10023221
473 Ga0157378_10064719
474 Ga0157378_11088286
475 Ga0157378_11649950
476 Ga0163162_10345295
477 Ga0163162_10546004
478 Ga0163162_10922474
479 Ga0163162_11204869
480 Ga0157372_11516926
481 Ga0157375_10002759
482 Ga0157375_10356766
483 Ga0157375_10418209
484 Ga0157375_12727150
485 Ga0163163_10203615
486 Ga0163163_11183433
487 Ga0163163_11391536
488 Ga0157377_10056455
489 Ga0157379_10003796
490 Ga0157376_10591155
491 Ga0157376_11520441
492 Ga0157376_12535435
493 Ga0182007_10277613
494 Ga0163161_10116020
495 Ga0163161_11645293
496 Ga0213876_10051980
497 Ga0207673_1062687
498 Ga0207697_10000749
499 Ga0207653_10027475
500 Ga0207692_10142581
501 Ga0207642_10753901
502 Ga0207710_10706206
503 Ga0207688_10488481
504 Ga0207647_10663096
505 Ga0207685_10326473
506 Ga0207654_11099131
507 Ga0207693_10050089
508 Ga0207693_10063904
509 Ga0207693_10282106
510 Ga0207663_10132634
511 Ga0207657_10061798
512 Ga0207694_10976632
513 Ga0207650_10726459
514 Ga0207659_10034033
515 Ga0207700_10029293
516 Ga0207690_10016085
517 Ga0207706_10036596
518 Ga0207706_10386185
519 Ga0207709_10891976
520 Ga0207704_10052750
521 Ga0207665_10087773
522 Ga0207665_10522228
523 Ga0207679_11710802
524 Ga0207667_10856360
525 Ga0207651_10701910
526 Ga0207668_11771465
527 Ga0207658_10548104
528 Ga0207677_10153045
529 Ga0207703_10029366
530 Ga0207703_11258152
531 Ga0207678_10615768
532 Ga0207708_10025715
533 Ga0207641_10019247
534 Ga0207676_11036899
535 Ga0207675_100373029
536 Ga0207675_101256337
537 Ga0207698_10653015
538 Ga0268266_10405118
539 Ga0268264_10006406
540 Ga0265337_1005866
541 Ga0265319_1000046
542 Ga0265319_1001086
543 Ga0265319_1003290
544 Ga0265319_1010007
545 Ga0265319_1023264
546 Ga0265319_1041892
547 Ga0265319_1081400
548 Ga0265334_10007532
549 Ga0265334_10258031
550 Ga0265318_10000075
551 Ga0265318_10001192
552 Ga0265322_10015098
553 Ga0265322_10033096
554 Ga0265338_10245735
555 Ga0265330_10215880
556 Ga0265332_10046549
557 Ga0265328_10134280
558 Ga0265320_10000543
559 Ga0265320_10001241
560 Ga0265320_10001398
561 Ga0265320_10002901
562 Ga0265320_10010619
563 Ga0265320_10015884
564 Ga0265320_10051033
565 Ga0265320_10122139
566 Ga0265320_10307930
567 Ga0265325_10093590
568 Ga0265325_10162254
569 Ga0265329_10156489
570 Ga0265339_10142773
571 Ga0265339_10282540
572 Ga0265331_10060189
573 Ga0265331_10070705
574 Ga0265327_10000088
575 Ga0265327_10013100
576 Ga0265316_10022325
577 Ga0265316_10134920
578 Ga0265316_10179213
579 Ga0265316_10421575
580 Ga0265313_10000174
581 Ga0265313_10003599
582 Ga0265313_10004935
583 Ga0265313_10008045
584 Ga0265313_10029672
585 Ga0265313_10045847
586 Ga0265313_10269155
587 Ga0307508_10000031
588 Ga0265314_10001615
589 Ga0265314_10002099
590 Ga0265314_10195658
591 Ga0265314_10458707
592 Ga0265342_10006926
593 Ga0265342_10100780
594 Ga0265342_10282335
595 Ga0373959_0161069
596 Ga0373923_0146596
597 Ga0373953_0500354
598 Ga0373956_0306164
599 Ga0373956_0429136
600 Ga0373960_0198596
601 Ga0373955_0356550
602 Ga0373942_0016554
603 Ga0373931_0159015
604 Ga0373931_0689917
605 Ga0373935_0273391
606 Ga0373933_0785431
607 Ga0373947_0846845
608 Ga0373937_0231173
609 Ga0373937_0474091
610 Ga0395905_1151800
611 Ga0436365_1835944
612 Ga0436363_1569325
613 Ga0439465_0208532
614 Ga0451797_0478907
615 Ga0451795_1535445
616 Ga0451800_1539113
617 Ga0451849_0326598
618 Ga0451853_3270778
619 Ga0439445_0003694
620 Ga0439445_0008637
621 Ga0439445_0159561
622 Ga0450915_013387
623 Ga0439446_0072115
624 Ga0451577_0002636
625 Ga0451577_0095927
626 Ga0451577_0146088
627 Ga0451577_0286917
628 Ga0451577_0452863
629 Ga0466961_0392025
630 Ga0453684_0031309
631 Ga0453684_0069921
632 Ga0453684_0277013
633 Ga0451576_0004441
634 Ga0451576_0107051
635 Ga0451576_0136516
636 Ga0451576_0142809
637 Ga0451576_0374957
638 Ga0451576_0738549
639 Ga0451576_0738888
640 Ga0451576_1557481
641 Ga0451576_1974812
642 Ga0466967_0064077
643 Ga0495592_0613084
644 Ga0495629_1035463
645 Ga0495605_0136760
646 Ga0495607_0289798
647 Ga0495628_0448620
648 Ga0495642_0039549
649 Ga0495640_0116537
650 Ga0495598_0085222
651 Ga0495667_0547638
652 Ga0495611_0270625
653 Ga0495635_1001637
654 Ga0495669_0184442
655 Ga0495636_0101451
656 Ga0495674_0283165
657 Ga0495675_0843898
658 Ga0495686_0366011
659 Ga0495626_0248217
660 Ga0496100_1461922
661 Ga0496101_0041001
662 Ga0496101_0503239
663 Ga0496102_0052897
664 Ga0496102_1380084
665 Ga0496102_1861394
666 Ga0496103_0463960
667 Ga0496103_0472393
668 Ga0496104_0227069
669 Ga0496105_0067315
670 Ga0496105_1197384
671 Ga0496106_0165595
672 Ga0496107_0387716
673 Ga0496108_0002475
674 Ga0496109_0002007
675 Ga0496109_1290972
676 Ga0496110_1737838
677 Ga0496111_1307521
678 Ga0496112_0039437
679 Ga0496113_0017817
680 Ga0496114_0017959
681 Ga0496114_0496985
682 Ga0496115_0001716
683 Ga0496115_0454112
684 Ga0501032_0002109
685 Ga0501032_0353907
686 Ga0501033_0000009
687 Ga0501034_0328613
688 Ga0501036_0640457
689 Ga0501038_0000555
690 Ga0501039_0733260
691 Ga0501043_0353416
692 Ga0501043_1030465
693 Ga0501046_0014396
694 Ga0501046_0363836
695 Ga0501047_0020244
696 Ga0501047_0177366
697 Ga0501047_0822310
698 Ga0501067_0023744
699 Ga0501070_0192447
700 Ga0501080_0003963
701 Ga0501080_1165541
702 Ga0501035_0807186
703 Ga0501035_1396127
704 Ga0501044_0766537
705 nmdc:mga03n38_689002_c1
706 nmdc:mga0n895_1770021_c1
707 nmdc:mga0rr50_587701_c1
708 nmdc:mga0rr50_718073_c1
709 Ga0495601_0634026
710 Ga0500556_0109227
711 Ga0500593_156729
712 Ga0500568_0004512
713 Ga0500616_0018547
714 Ga0587080_070325
715 2718715882
716 2787509240

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01632

Ribosomal_L35p

Ribosomal protein L35

8

66

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5min-assembly1.cif.gz_A apo form of the soluble pqq-dependent glucose dehydrogenase from acinetobacter calcoaceticus 0.894 18 30
1cru-assembly1.cif.gz_A soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine 0.7403 17 32
1cru-assembly1.cif.gz_B soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine 0.7369 17 32
4v9l-assembly1.cif.gz_B8 70s ribosome translocation intermediate fa-3.6a containing elongation factor efg/fusidic acid/gdp, mrna, and trna bound in the pe*/e state. 0.704 9 65
8cvm-assembly1.cif.gz_2 cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.7038 9 66
ID Description Score Start End Superfamily
1qbiA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9033 18 30 2.120.10.30
af_P41998_44_306_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7324 17 33 3.30.420.40
af_Q54HV6_253_480_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.7131 16 31 3.30.470.30
1r77A00 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.6781 18 30 2.30.30.40
1vw4Z00 Few Secondary Structures;Irregular;Factor Xa Inhibitor; 0.6705 9 69 4.10.410.60
ID Description Score Start End GO Terms
AF-A0A1R3HF44-F1-model_v4 50S ribosomal protein L35 0.7517 9 68 GO:0003735
GO:0005840
GO:0006412
GO:0031080
GO:1990904
AF-A0A554LRS0-F1-model_v4 50S ribosomal protein L35 0.7427 9 66
AF-A0A2M7Q9I0-F1-model_v4 50S ribosomal protein L35 0.7416 9 67 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3D0YQX9-F1-model_v4 50S ribosomal protein L35 0.7382 9 67 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A061GQR7-F1-model_v4 50S ribosomal protein L35 0.7327 9 65 GO:0003735
GO:0006412
GO:0015934

Map