F421137

General Info

Members Datasets Scaffolds Average Seq Length
358 202 716 401

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10052310|Ga0075433_100523103
Length 365
Sequence MMLGLLLARAGIEVVVHEKHADFLRDFRGDTIHPSTLEVIAELGLLDEFLKLPHQKVPEIGGQFGELQTRIADFRHLPVRCGYIAMMPQWDFLNFLARQASRYPGFTLKMNSEITSLEGIDAYLIIGADGRHSTVRQLAGLEVEDYGAPMDVLWFRISHRATDPELSMGRFDAGRIFVQLNRGDYWQCAYVIPKGAADEVRSAGLAAFQAGIVRMLPFAADRAGEIRDWEQVKLLTVKVDRLKRWYRDGLLCIGDAAHAMSPVGGVGINLAIQDAVATANILAAPLKNNQLTTADLAKVQRRREWPVRLTQQFQLAAQNRVIARVLRSDQQLEPPLFFKLLSRYAWLRRIPGRLIGMGIRPEHVA

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
51 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
52 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
79 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
80 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
81 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
83 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
84 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
85 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
86 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
87 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
193 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
197 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
200 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
201 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
202 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.12
Nodule 0.56
Rhizoplane 8.66
Rhizosphere 88.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10052310 3300006852 Bacteria 3558
2 Ga0070670_100011737 3300005331 Bacteria 7493
3 Ga0070682_100034720 3300005337 Bacteria 3073
4 Ga0070689_100033814 3300005340 Bacteria 3898
5 Ga0070671_100002116 3300005355 Bacteria 15322
6 Ga0070671_100082491 3300005355 Bacteria 2688
7 Ga0070674_100004824 3300005356 Bacteria 7729
8 Ga0070673_100020017 3300005364 Bacteria 4818
9 Ga0070714_100003739 3300005435 Bacteria 11412
10 Ga0070714_100031585 3300005435 Bacteria 4420
11 Ga0070713_100030914 3300005436 Bacteria 4258
12 Ga0070713_100338445 3300005436 Bacteria 1394
13 Ga0070710_10031831 3300005437 Bacteria 2851
14 Ga0070710_10115504 3300005437 Bacteria 1618
15 Ga0070711_100064106 3300005439 Bacteria 2567
16 Ga0070711_100081108 3300005439 Bacteria 2311
17 Ga0070662_100037896 3300005457 Bacteria 3421
18 Ga0070679_100036217 3300005530 Bacteria 4897
19 Ga0070679_100349237 3300005530 Bacteria 1427
20 Ga0070672_100123496 3300005543 Bacteria 2122
21 Ga0070693_100189933 3300005547 Bacteria 1328
22 Ga0070665_100016213 3300005548 Bacteria 7477
23 Ga0070704_100024962 3300005549 Bacteria 3929
24 Ga0068855_100039621 3300005563 Bacteria 5594
25 Ga0068855_100136331 3300005563 Bacteria 2800
26 Ga0070664_100044654 3300005564 Bacteria 3741
27 Ga0068863_100295923 3300005841 Bacteria 1569
28 Ga0081455_10000051 3300005937 Bacteria 123542
29 Ga0081455_10014056 3300005937 Bacteria 7868
30 Ga0081540_1004401 3300005983 Bacteria 10760
31 Ga0081539_10028035 3300005985 Bacteria 3550
32 Ga0070717_10000385 3300006028 Bacteria 28322
33 Ga0070717_10041376 3300006028 Bacteria 3756
34 Ga0075365_10000538 3300006038 Bacteria 14556
35 Ga0070712_100001871 3300006175 Bacteria 12847
36 Ga0070712_100095443 3300006175 Bacteria 2188
37 Ga0070712_100123146 3300006175 Bacteria 1954
38 Ga0068871_100044003 3300006358 Bacteria 3588
39 Ga0075428_100241696 3300006844 Bacteria 1948
40 Ga0075430_100000223 3300006846 Bacteria 39224
41 Ga0075433_10001101 3300006852 Bacteria 19508
42 Ga0075434_100026234 3300006871 Bacteria 5706
43 Ga0075434_100086401 3300006871 Bacteria 3136
44 Ga0068865_100040135 3300006881 Bacteria 3179
45 Ga0068865_100094094 3300006881 Bacteria 2180
46 Ga0075436_100031175 3300006914 Bacteria 3670
47 Ga0075435_100007578 3300007076 Bacteria 7749
48 Ga0105251_10080880 3300009011 Bacteria 1502
49 Ga0105240_10060012 3300009093 Bacteria 4743
50 Ga0105240_10321701 3300009093 Bacteria 1763
51 Ga0105240_10428451 3300009093 Bacteria 1485
52 Ga0114129_10308469 3300009147 Bacteria 2107
53 Ga0114129_10507479 3300009147 Bacteria 1574
54 Ga0105243_10093176 3300009148 Bacteria 2485
55 Ga0105242_10007772 3300009176 Bacteria 8250
56 Ga0105248_10266149 3300009177 Bacteria 1930
57 Ga0105237_10123362 3300009545 Bacteria 2585
58 Ga0105237_10179978 3300009545 Bacteria 2115
59 Ga0105239_10209084 3300010375 Bacteria 2187
60 Ga0105246_10032103 3300011119 Bacteria 3480
61 Ga0157369_10010225 3300013105 Bacteria 10708
62 Ga0157369_10192993 3300013105 Bacteria 2139
63 Ga0157378_10207208 3300013297 Bacteria 1857
64 Ga0163162_10189319 3300013306 Bacteria 2185
65 Ga0163162_10327610 3300013306 Bacteria 1664
66 Ga0157375_10135939 3300013308 Bacteria 2582
67 Ga0157380_10197230 3300014326 Bacteria 1783
68 Ga0157379_10150758 3300014968 Bacteria 2097
69 Ga0157376_10098449 3300014969 Bacteria 2550
70 Ga0157376_10240690 3300014969 Bacteria 1686
71 Ga0213871_10022944 3300021441 Bacteria 1567
72 Ga0224572_1011921 3300024225 Bacteria 1647
73 Ga0228598_1005804 3300024227 Bacteria 2570
74 Ga0207656_10066212 3300025321 Bacteria 1596
75 Ga0207692_10005907 3300025898 Bacteria 4937
76 Ga0207692_10007419 3300025898 Bacteria 4496
77 Ga0207692_10118493 3300025898 Bacteria 1479
78 Ga0207699_10002879 3300025906 Bacteria 8163
79 Ga0207693_10002373 3300025915 Bacteria 16362
80 Ga0207693_10025982 3300025915 Bacteria 4638
81 Ga0207663_10112244 3300025916 Bacteria 1851
82 Ga0207663_10122609 3300025916 Bacteria 1782
83 Ga0207657_10058371 3300025919 Bacteria 3321
84 Ga0207650_10010124 3300025925 Bacteria 6460
85 Ga0207700_10000284 3300025928 Bacteria 30142
86 Ga0207700_10087936 3300025928 Bacteria 2445
87 Ga0207700_10167622 3300025928 Bacteria 1829
88 Ga0207664_10030789 3300025929 Bacteria 4101
89 Ga0207644_10014485 3300025931 Bacteria 5273
90 Ga0207706_10059233 3300025933 Bacteria 3373
91 Ga0207706_10198570 3300025933 Bacteria 1759
92 Ga0207709_10024349 3300025935 Bacteria 3456
93 Ga0207704_10053463 3300025938 Bacteria 2455
94 Ga0207691_10082351 3300025940 Bacteria 2891
95 Ga0207667_10230408 3300025949 Bacteria 1897
96 Ga0207640_10050082 3300025981 Bacteria 2708
97 Ga0207678_10028842 3300026067 Bacteria 4845
98 Ga0207676_10019697 3300026095 Bacteria 4926
99 Ga0207674_10142330 3300026116 Bacteria 2358
100 Ga0207674_10159544 3300026116 Bacteria 2210
101 Ga0207683_10005445 3300026121 Bacteria 10901
102 Ga0207683_10006289 3300026121 Bacteria 10177
103 Ga0268266_10000220 3300028379 Bacteria 99360
104 Ga0265334_10030398 3300028573 Bacteria 2162
105 Ga0265325_10033307 3300031241 Bacteria 2747
106 Ga0265339_10000158 3300031249 Bacteria 56155
107 Ga0265313_10001895 3300031595 Bacteria 18976
108 Ga0373926_0009218 3300035083 Bacteria 3295
109 Ga0373928_0002874 3300035084 Bacteria 3322
110 Ga0373949_0005810 3300035090 Bacteria 2743
111 Ga0373923_0012064 3300035111 Bacteria 3185
112 Ga0373923_0012975 3300035111 Bacteria 3095
113 Ga0373932_0003139 3300035112 Bacteria 4026
114 Ga0373953_0037289 3300035117 Bacteria 1918
115 Ga0373954_0077679 3300035118 Bacteria 1583
116 Ga0373957_0025986 3300035120 Bacteria 2114
117 Ga0373943_0000184 3300035170 Bacteria 25072
118 Ga0373943_0002870 3300035170 Bacteria 7823
119 Ga0373946_0004385 3300035171 Bacteria 5053
120 Ga0373946_0016371 3300035171 Bacteria 2824
121 Ga0373946_0076227 3300035171 Bacteria 1459
122 Ga0373935_0009270 3300035692 Bacteria 5893
123 Ga0373935_0026957 3300035692 Bacteria 3551
124 Ga0373935_0039787 3300035692 Bacteria 2948
125 Ga0373935_0085260 3300035692 Bacteria 2059
126 Ga0373935_0131921 3300035692 Bacteria 1679
127 Ga0373927_0000712 3300035695 Bacteria 25511
128 Ga0373927_0031018 3300035695 Bacteria 3486
129 Ga0373927_0047690 3300035695 Bacteria 2771
130 Ga0373927_0105920 3300035695 Bacteria 1831
131 Ga0373933_0003951 3300035724 Bacteria 8186
132 Ga0373933_0004132 3300035724 Bacteria 7999
133 Ga0373933_0020271 3300035724 Bacteria 3768
134 Ga0373947_0000331 3300035725 Bacteria 26712
135 Ga0373947_0006927 3300035725 Bacteria 6570
136 Ga0373947_0099407 3300035725 Bacteria 1826
137 Ga0373937_0023712 3300036401 Bacteria 5529
138 Ga0373937_0043173 3300036401 Bacteria 4114
139 Ga0373937_0045202 3300036401 Bacteria 4023
140 Ga0373937_0105489 3300036401 Bacteria 2618
141 Ga0373925_0001352 3300037068 Bacteria 21385
142 Ga0373925_0008905 3300037068 Bacteria 7312
143 Ga0373925_0034030 3300037068 Bacteria 3756
144 Ga0373925_0068985 3300037068 Bacteria 2670
145 Ga0395899_0002903 3300037312 Bacteria 13771
146 Ga0395899_0017565 3300037312 Bacteria 5450
147 Ga0395899_0112236 3300037312 Bacteria 1958
148 Ga0395900_0005679 3300037418 Bacteria 13045
149 Ga0395900_0067254 3300037418 Bacteria 3681
150 Ga0395900_0302249 3300037418 Bacteria 1586
151 Ga0395898_0022295 3300037466 Bacteria 6414
152 Ga0395898_0028072 3300037466 Bacteria 5643
153 Ga0395898_0125370 3300037466 Bacteria 2460
154 Ga0436364_0329235 3300037853 Bacteria 2150
155 Ga0395901_0000593 3300038443 Bacteria 42246
156 Ga0395901_0042418 3300038443 Bacteria 4716
157 Ga0395901_0092167 3300038443 Bacteria 3172
158 Ga0436365_0672206 3300039437 Bacteria 3442
159 Ga0436365_0869726 3300039437 Bacteria 3826
160 Ga0436360_0241413 3300039438 Bacteria 8494
161 Ga0436360_0250591 3300039438 Bacteria 2518
162 Ga0436360_0473545 3300039438 Bacteria 2055
163 Ga0436360_1072544 3300039438 Bacteria 2342
164 Ga0436361_0725007 3300039447 Bacteria 1573
165 Ga0436362_0087740 3300039453 Bacteria 2150
166 Ga0436362_0205743 3300039453 Bacteria 2662
167 Ga0436362_1233855 3300039453 Bacteria 2020
168 Ga0466963_0041333 3300044694 Bacteria 3024
169 Ga0466957_0053461 3300044842 Bacteria 2462
170 Ga0466959_0030060 3300045049 Bacteria 4023
171 Ga0466958_0037821 3300045836 Bacteria 2893
172 Ga0466958_0062038 3300045836 Bacteria 2278
173 Ga0495592_0036966 3300046454 Bacteria 3676
174 Ga0495592_0071788 3300046454 Bacteria 2520
175 Ga0495592_0140365 3300046454 Bacteria 1681
176 Ga0495603_0041659 3300046455 Bacteria 2745
177 Ga0495629_0000303 3300046459 Bacteria 42242
178 Ga0495629_0032160 3300046459 Bacteria 3715
179 Ga0495629_0035541 3300046459 Bacteria 3521
180 Ga0495629_0113093 3300046459 Bacteria 1892
181 Ga0495629_0113402 3300046459 Bacteria 1889
182 Ga0495641_0008164 3300046461 Bacteria 6427
183 Ga0495651_0041746 3300046462 Bacteria 3562
184 Ga0495653_0025067 3300046463 Bacteria 4798
185 Ga0495653_0039162 3300046463 Bacteria 3715
186 Ga0495653_0048905 3300046463 Bacteria 3261
187 Ga0495580_0010324 3300046472 Bacteria 7281
188 Ga0495582_0005665 3300046473 Bacteria 6954
189 Ga0495582_0011971 3300046473 Bacteria 4779
190 Ga0495639_0002326 3300046475 Bacteria 8307
191 Ga0495662_0001048 3300046476 Bacteria 13573
192 Ga0495662_0014480 3300046476 Bacteria 3834
193 Ga0495662_0043937 3300046476 Bacteria 2157
194 Ga0495664_0000079 3300046477 Bacteria 47364
195 Ga0495664_0059362 3300046477 Bacteria 2277
196 Ga0495584_0036861 3300046491 Bacteria 2470
197 Ga0495584_0037336 3300046491 Bacteria 2455
198 Ga0495585_0010529 3300046492 Bacteria 5501
199 Ga0495594_0068466 3300046499 Bacteria 1971
200 Ga0495607_0037808 3300046501 Bacteria 2896
201 Ga0495608_0000442 3300046511 Bacteria 28963
202 Ga0495608_0003938 3300046511 Bacteria 10676
203 Ga0495608_0041399 3300046511 Bacteria 3083
204 Ga0495618_0002796 3300046514 Bacteria 11066
205 Ga0495618_0005332 3300046514 Bacteria 7846
206 Ga0495618_0033821 3300046514 Bacteria 3205
207 Ga0495618_0074314 3300046514 Bacteria 2164
208 Ga0495628_0021729 3300046516 Bacteria 5273
209 Ga0495628_0042125 3300046516 Bacteria 3643
210 Ga0495628_0189636 3300046516 Bacteria 1552
211 Ga0495630_0008686 3300046517 Bacteria 7294
212 Ga0495630_0038439 3300046517 Bacteria 3579
213 Ga0495630_0038986 3300046517 Bacteria 3553
214 Ga0495630_0104979 3300046517 Bacteria 2139
215 Ga0495630_0120266 3300046517 Bacteria 1992
216 Ga0495663_0025226 3300046525 Bacteria 1732
217 Ga0495652_0038380 3300046529 Bacteria 4150
218 Ga0495652_0041266 3300046529 Bacteria 3984
219 Ga0495652_0045755 3300046529 Bacteria 3760
220 Ga0495652_0061580 3300046529 Bacteria 3167
221 Ga0495652_0095426 3300046529 Bacteria 2423
222 Ga0495654_0000296 3300046530 Bacteria 44716
223 Ga0495665_0036035 3300046531 Bacteria 2641
224 Ga0495665_0090503 3300046531 Bacteria 1607
225 Ga0495640_0002027 3300046533 Bacteria 16170
226 Ga0495640_0017172 3300046533 Bacteria 5399
227 Ga0495586_0027248 3300046535 Bacteria 3058
228 Ga0495587_0001204 3300046536 Bacteria 17140
229 Ga0495587_0033881 3300046536 Bacteria 3081
230 Ga0495609_0040755 3300046538 Bacteria 2089
231 Ga0495645_0005308 3300046543 Bacteria 8826
232 Ga0495633_0014271 3300046558 Bacteria 4160
233 Ga0495667_0020838 3300046559 Bacteria 4424
234 Ga0495667_0070720 3300046559 Bacteria 2276
235 Ga0495656_0005315 3300046615 Bacteria 4438
236 Ga0495634_0006505 3300046642 Bacteria 8874
237 Ga0495634_0014511 3300046642 Bacteria 5680
238 Ga0495634_0019227 3300046642 Bacteria 4855
239 Ga0495635_0001052 3300046663 Bacteria 18284
240 Ga0495635_0148575 3300046663 Bacteria 1595
241 Ga0495659_0001893 3300046664 Bacteria 6895
242 Ga0495661_0051060 3300046665 Bacteria 2499
243 Ga0495588_0010016 3300046674 Bacteria 4394
244 Ga0495599_0011451 3300046678 Bacteria 5450
245 Ga0495599_0213375 3300046678 Bacteria 1183
246 Ga0495623_0007321 3300046679 Bacteria 7160
247 Ga0495646_0022971 3300046680 Bacteria 3928
248 Ga0495646_0084153 3300046680 Bacteria 1847
249 Ga0495658_0000088 3300046683 Bacteria 46937
250 Ga0495658_0001511 3300046683 Bacteria 12193
251 Ga0495613_0007734 3300046689 Bacteria 7996
252 Ga0495613_0038710 3300046689 Bacteria 3534
253 Ga0495624_0001735 3300046690 Bacteria 16666
254 Ga0495624_0004407 3300046690 Bacteria 10302
255 Ga0495670_0033211 3300046691 Bacteria 2567
256 Ga0495600_0001790 3300046809 Bacteria 12009
257 Ga0495581_0014717 3300047315 Bacteria 4539
258 Ga0495581_0027635 3300047315 Bacteria 3290
259 Ga0495604_0009254 3300047317 Bacteria 7798
260 Ga0495604_0018038 3300047317 Bacteria 5648
261 Ga0495604_0135342 3300047317 Bacteria 1766
262 Ga0495674_0011292 3300047319 Bacteria 8431
263 Ga0495676_0212963 3300047321 Bacteria 1336
264 Ga0495680_0023322 3300047322 Bacteria 5147
265 Ga0495680_0049774 3300047322 Bacteria 3280
266 Ga0495680_0077363 3300047322 Bacteria 2520
267 Ga0495680_0103320 3300047322 Bacteria 2121
268 Ga0495675_0004795 3300047444 Bacteria 8218
269 Ga0495684_0002246 3300047471 Bacteria 15469
270 Ga0495684_0026304 3300047471 Bacteria 4471
271 Ga0495684_0034577 3300047471 Bacteria 3877
272 Ga0495684_0056982 3300047471 Bacteria 2978
273 Ga0495593_0002505 3300047673 Bacteria 11045
274 Ga0495593_0006793 3300047673 Bacteria 6696
275 Ga0495593_0014338 3300047673 Bacteria 4506
276 Ga0495602_0006262 3300048088 Bacteria 12483
277 Ga0495614_0004847 3300048089 Bacteria 6073
278 Ga0496100_0049333 3300048903 Bacteria 2721
279 Ga0496101_0061788 3300048904 Bacteria 2721
280 Ga0496101_0154616 3300048904 Bacteria 1756
281 Ga0496102_0101623 3300048905 Bacteria 2671
282 Ga0496102_0133796 3300048905 Bacteria 2322
283 Ga0496104_0020862 3300048907 Bacteria 6008
284 Ga0496104_0049719 3300048907 Bacteria 3954
285 Ga0496105_0058153 3300048908 Bacteria 3191
286 Ga0496105_0089404 3300048908 Bacteria 2544
287 Ga0496106_0019724 3300048909 Bacteria 5000
288 Ga0496107_0184894 3300048910 Bacteria 1548
289 Ga0496107_0224853 3300048910 Bacteria 1396
290 Ga0496108_0088864 3300048911 Bacteria 2625
291 Ga0496108_0148004 3300048911 Bacteria 2025
292 Ga0496110_0026380 3300048913 Bacteria 4971
293 Ga0496111_0010918 3300048914 Bacteria 6110
294 Ga0496112_0088968 3300048915 Bacteria 3055
295 Ga0496112_0106659 3300048915 Bacteria 2771
296 Ga0496112_0154353 3300048915 Bacteria 2263
297 Ga0496113_0012222 3300048916 Bacteria 5763
298 Ga0496113_0153192 3300048916 Bacteria 1819
299 Ga0496114_0001005 3300048917 Bacteria 21149
300 Ga0496114_0147889 3300048917 Bacteria 2037
301 Ga0496114_0153765 3300048917 Bacteria 1997
302 Ga0496114_0180913 3300048917 Bacteria 1841
303 Ga0496115_0031311 3300048918 Bacteria 4191
304 Ga0496115_0043414 3300048918 Bacteria 3586
305 Ga0496115_0083644 3300048918 Bacteria 2601
306 Ga0496115_0091392 3300048918 Bacteria 2488
307 Ga0496115_0106172 3300048918 Bacteria 2305
308 Ga0496122_0017400 3300048925 Bacteria 6725
309 Ga0501034_0012574 3300049571 Bacteria 8737
310 Ga0501034_0051529 3300049571 Bacteria 4150
311 Ga0501034_0103552 3300049571 Bacteria 2840
312 Ga0501037_0090613 3300049573 Bacteria 2212
313 Ga0501039_0214154 3300049575 Bacteria 1515
314 Ga0501048_0116386 3300049582 Bacteria 1889
315 Ga0501070_0069487 3300049586 Bacteria 2916
316 Ga0501072_0184372 3300049588 Bacteria 1665
317 Ga0501073_0030258 3300049589 Bacteria 3866
318 Ga0501076_0060163 3300049592 Bacteria 3021
319 Ga0501081_0123771 3300049743 Bacteria 1844
320 Ga0501083_0032530 3300049744 Bacteria 3576
321 Ga0501083_0051884 3300049744 Bacteria 2757
322 Ga0501083_0181500 3300049744 Bacteria 1374
323 Ga0501044_0224553 3300049823 Bacteria 1828
324 nmdc:mga0yw44_220469_c1 3300050492 Bacteria 1257
325 nmdc:mga0qj67_52_c1 3300050509 Bacteria 84067
326 nmdc:mga0n895_122270_c1 3300050512 Bacteria 2625
327 nmdc:mga0n895_410140_c1 3300050512 Bacteria 1370
328 nmdc:mga0n895_58426_c1 3300050512 Bacteria 3803
329 nmdc:mga0rr50_38617_c1 3300050513 Bacteria 3457
330 Ga0495601_0001115 3300053077 Bacteria 14726
331 Ga0495601_0005155 3300053077 Bacteria 7594
332 Ga0495601_0007076 3300053077 Bacteria 6573
333 Ga0495601_0026059 3300053077 Bacteria 3607
334 Ga0495601_0030435 3300053077 Bacteria 3352
335 Ga0495601_0046922 3300053077 Bacteria 2719
336 Ga0495601_0118022 3300053077 Bacteria 1721
337 Ga0495612_0000075 3300053078 Bacteria 45362
338 Ga0495612_0002211 3300053078 Bacteria 8003
339 Ga0495612_0002895 3300053078 Bacteria 7114
340 Ga0495655_0002094 3300053083 Bacteria 3131
341 Ga0495595_0004594 3300053084 Bacteria 5551
342 Ga0495595_0005258 3300053084 Bacteria 5230
343 Ga0495595_0008502 3300053084 Bacteria 4215
344 Ga0495595_0015978 3300053084 Bacteria 3205
345 Ga0495619_0000241 3300053085 Bacteria 39686
346 Ga0495619_0001336 3300053085 Bacteria 16151
347 Ga0495619_0001601 3300053085 Bacteria 14879
348 Ga0495619_0002025 3300053085 Bacteria 13470
349 Ga0495619_0060884 3300053085 Bacteria 2510
350 Ga0495619_0079732 3300053085 Bacteria 2202
351 Ga0495619_0086121 3300053085 Bacteria 2123
352 Ga0500618_000222 3300053125 Bacteria 44764
353 Ga0500636_0001436 3300053177 Bacteria 12966
354 Ga0501082_0000013 3300060353 Bacteria 119623
355 2599720221 2599185236 Bacteria 6875203
356 2841916148 2841911363 Bacteria 6173697
357 2841921183 2841917233 Bacteria 6173500
358 8056878137 8056875544 Bacteria 4355797
359 Ga0075433_10052310
360 Ga0070670_100011737
361 Ga0070682_100034720
362 Ga0070689_100033814
363 Ga0070671_100002116
364 Ga0070671_100082491
365 Ga0070674_100004824
366 Ga0070673_100020017
367 Ga0070714_100003739
368 Ga0070714_100031585
369 Ga0070713_100030914
370 Ga0070713_100338445
371 Ga0070710_10031831
372 Ga0070710_10115504
373 Ga0070711_100064106
374 Ga0070711_100081108
375 Ga0070662_100037896
376 Ga0070679_100036217
377 Ga0070679_100349237
378 Ga0070672_100123496
379 Ga0070693_100189933
380 Ga0070665_100016213
381 Ga0070704_100024962
382 Ga0068855_100039621
383 Ga0068855_100136331
384 Ga0070664_100044654
385 Ga0068863_100295923
386 Ga0081455_10000051
387 Ga0081455_10014056
388 Ga0081540_1004401
389 Ga0081539_10028035
390 Ga0070717_10000385
391 Ga0070717_10041376
392 Ga0075365_10000538
393 Ga0070712_100001871
394 Ga0070712_100095443
395 Ga0070712_100123146
396 Ga0068871_100044003
397 Ga0075428_100241696
398 Ga0075430_100000223
399 Ga0075433_10001101
400 Ga0075434_100026234
401 Ga0075434_100086401
402 Ga0068865_100040135
403 Ga0068865_100094094
404 Ga0075436_100031175
405 Ga0075435_100007578
406 Ga0105251_10080880
407 Ga0105240_10060012
408 Ga0105240_10321701
409 Ga0105240_10428451
410 Ga0114129_10308469
411 Ga0114129_10507479
412 Ga0105243_10093176
413 Ga0105242_10007772
414 Ga0105248_10266149
415 Ga0105237_10123362
416 Ga0105237_10179978
417 Ga0105239_10209084
418 Ga0105246_10032103
419 Ga0157369_10010225
420 Ga0157369_10192993
421 Ga0157378_10207208
422 Ga0163162_10189319
423 Ga0163162_10327610
424 Ga0157375_10135939
425 Ga0157380_10197230
426 Ga0157379_10150758
427 Ga0157376_10098449
428 Ga0157376_10240690
429 Ga0213871_10022944
430 Ga0224572_1011921
431 Ga0228598_1005804
432 Ga0207656_10066212
433 Ga0207692_10005907
434 Ga0207692_10007419
435 Ga0207692_10118493
436 Ga0207699_10002879
437 Ga0207693_10002373
438 Ga0207693_10025982
439 Ga0207663_10112244
440 Ga0207663_10122609
441 Ga0207657_10058371
442 Ga0207650_10010124
443 Ga0207700_10000284
444 Ga0207700_10087936
445 Ga0207700_10167622
446 Ga0207664_10030789
447 Ga0207644_10014485
448 Ga0207706_10059233
449 Ga0207706_10198570
450 Ga0207709_10024349
451 Ga0207704_10053463
452 Ga0207691_10082351
453 Ga0207667_10230408
454 Ga0207640_10050082
455 Ga0207678_10028842
456 Ga0207676_10019697
457 Ga0207674_10142330
458 Ga0207674_10159544
459 Ga0207683_10005445
460 Ga0207683_10006289
461 Ga0268266_10000220
462 Ga0265334_10030398
463 Ga0265325_10033307
464 Ga0265339_10000158
465 Ga0265313_10001895
466 Ga0373926_0009218
467 Ga0373928_0002874
468 Ga0373949_0005810
469 Ga0373923_0012064
470 Ga0373923_0012975
471 Ga0373932_0003139
472 Ga0373953_0037289
473 Ga0373954_0077679
474 Ga0373957_0025986
475 Ga0373943_0000184
476 Ga0373943_0002870
477 Ga0373946_0004385
478 Ga0373946_0016371
479 Ga0373946_0076227
480 Ga0373935_0009270
481 Ga0373935_0026957
482 Ga0373935_0039787
483 Ga0373935_0085260
484 Ga0373935_0131921
485 Ga0373927_0000712
486 Ga0373927_0031018
487 Ga0373927_0047690
488 Ga0373927_0105920
489 Ga0373933_0003951
490 Ga0373933_0004132
491 Ga0373933_0020271
492 Ga0373947_0000331
493 Ga0373947_0006927
494 Ga0373947_0099407
495 Ga0373937_0023712
496 Ga0373937_0043173
497 Ga0373937_0045202
498 Ga0373937_0105489
499 Ga0373925_0001352
500 Ga0373925_0008905
501 Ga0373925_0034030
502 Ga0373925_0068985
503 Ga0395899_0002903
504 Ga0395899_0017565
505 Ga0395899_0112236
506 Ga0395900_0005679
507 Ga0395900_0067254
508 Ga0395900_0302249
509 Ga0395898_0022295
510 Ga0395898_0028072
511 Ga0395898_0125370
512 Ga0436364_0329235
513 Ga0395901_0000593
514 Ga0395901_0042418
515 Ga0395901_0092167
516 Ga0436365_0672206
517 Ga0436365_0869726
518 Ga0436360_0241413
519 Ga0436360_0250591
520 Ga0436360_0473545
521 Ga0436360_1072544
522 Ga0436361_0725007
523 Ga0436362_0087740
524 Ga0436362_0205743
525 Ga0436362_1233855
526 Ga0466963_0041333
527 Ga0466957_0053461
528 Ga0466959_0030060
529 Ga0466958_0037821
530 Ga0466958_0062038
531 Ga0495592_0036966
532 Ga0495592_0071788
533 Ga0495592_0140365
534 Ga0495603_0041659
535 Ga0495629_0000303
536 Ga0495629_0032160
537 Ga0495629_0035541
538 Ga0495629_0113093
539 Ga0495629_0113402
540 Ga0495641_0008164
541 Ga0495651_0041746
542 Ga0495653_0025067
543 Ga0495653_0039162
544 Ga0495653_0048905
545 Ga0495580_0010324
546 Ga0495582_0005665
547 Ga0495582_0011971
548 Ga0495639_0002326
549 Ga0495662_0001048
550 Ga0495662_0014480
551 Ga0495662_0043937
552 Ga0495664_0000079
553 Ga0495664_0059362
554 Ga0495584_0036861
555 Ga0495584_0037336
556 Ga0495585_0010529
557 Ga0495594_0068466
558 Ga0495607_0037808
559 Ga0495608_0000442
560 Ga0495608_0003938
561 Ga0495608_0041399
562 Ga0495618_0002796
563 Ga0495618_0005332
564 Ga0495618_0033821
565 Ga0495618_0074314
566 Ga0495628_0021729
567 Ga0495628_0042125
568 Ga0495628_0189636
569 Ga0495630_0008686
570 Ga0495630_0038439
571 Ga0495630_0038986
572 Ga0495630_0104979
573 Ga0495630_0120266
574 Ga0495663_0025226
575 Ga0495652_0038380
576 Ga0495652_0041266
577 Ga0495652_0045755
578 Ga0495652_0061580
579 Ga0495652_0095426
580 Ga0495654_0000296
581 Ga0495665_0036035
582 Ga0495665_0090503
583 Ga0495640_0002027
584 Ga0495640_0017172
585 Ga0495586_0027248
586 Ga0495587_0001204
587 Ga0495587_0033881
588 Ga0495609_0040755
589 Ga0495645_0005308
590 Ga0495633_0014271
591 Ga0495667_0020838
592 Ga0495667_0070720
593 Ga0495656_0005315
594 Ga0495634_0006505
595 Ga0495634_0014511
596 Ga0495634_0019227
597 Ga0495635_0001052
598 Ga0495635_0148575
599 Ga0495659_0001893
600 Ga0495661_0051060
601 Ga0495588_0010016
602 Ga0495599_0011451
603 Ga0495599_0213375
604 Ga0495623_0007321
605 Ga0495646_0022971
606 Ga0495646_0084153
607 Ga0495658_0000088
608 Ga0495658_0001511
609 Ga0495613_0007734
610 Ga0495613_0038710
611 Ga0495624_0001735
612 Ga0495624_0004407
613 Ga0495670_0033211
614 Ga0495600_0001790
615 Ga0495581_0014717
616 Ga0495581_0027635
617 Ga0495604_0009254
618 Ga0495604_0018038
619 Ga0495604_0135342
620 Ga0495674_0011292
621 Ga0495676_0212963
622 Ga0495680_0023322
623 Ga0495680_0049774
624 Ga0495680_0077363
625 Ga0495680_0103320
626 Ga0495675_0004795
627 Ga0495684_0002246
628 Ga0495684_0026304
629 Ga0495684_0034577
630 Ga0495684_0056982
631 Ga0495593_0002505
632 Ga0495593_0006793
633 Ga0495593_0014338
634 Ga0495602_0006262
635 Ga0495614_0004847
636 Ga0496100_0049333
637 Ga0496101_0061788
638 Ga0496101_0154616
639 Ga0496102_0101623
640 Ga0496102_0133796
641 Ga0496104_0020862
642 Ga0496104_0049719
643 Ga0496105_0058153
644 Ga0496105_0089404
645 Ga0496106_0019724
646 Ga0496107_0184894
647 Ga0496107_0224853
648 Ga0496108_0088864
649 Ga0496108_0148004
650 Ga0496110_0026380
651 Ga0496111_0010918
652 Ga0496112_0088968
653 Ga0496112_0106659
654 Ga0496112_0154353
655 Ga0496113_0012222
656 Ga0496113_0153192
657 Ga0496114_0001005
658 Ga0496114_0147889
659 Ga0496114_0153765
660 Ga0496114_0180913
661 Ga0496115_0031311
662 Ga0496115_0043414
663 Ga0496115_0083644
664 Ga0496115_0091392
665 Ga0496115_0106172
666 Ga0496122_0017400
667 Ga0501034_0012574
668 Ga0501034_0051529
669 Ga0501034_0103552
670 Ga0501037_0090613
671 Ga0501039_0214154
672 Ga0501048_0116386
673 Ga0501070_0069487
674 Ga0501072_0184372
675 Ga0501073_0030258
676 Ga0501076_0060163
677 Ga0501081_0123771
678 Ga0501083_0032530
679 Ga0501083_0051884
680 Ga0501083_0181500
681 Ga0501044_0224553
682 nmdc:mga0yw44_220469_c1
683 nmdc:mga0qj67_52_c1
684 nmdc:mga0n895_122270_c1
685 nmdc:mga0n895_410140_c1
686 nmdc:mga0n895_58426_c1
687 nmdc:mga0rr50_38617_c1
688 Ga0495601_0001115
689 Ga0495601_0005155
690 Ga0495601_0007076
691 Ga0495601_0026059
692 Ga0495601_0030435
693 Ga0495601_0046922
694 Ga0495601_0118022
695 Ga0495612_0000075
696 Ga0495612_0002211
697 Ga0495612_0002895
698 Ga0495655_0002094
699 Ga0495595_0004594
700 Ga0495595_0005258
701 Ga0495595_0008502
702 Ga0495595_0015978
703 Ga0495619_0000241
704 Ga0495619_0001336
705 Ga0495619_0001601
706 Ga0495619_0002025
707 Ga0495619_0060884
708 Ga0495619_0079732
709 Ga0495619_0086121
710 Ga0500618_000222
711 Ga0500636_0001436
712 Ga0501082_0000013
713 2599720221
714 2841916148
715 2841921183
716 8056878137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01494

FAD_binding_3

FAD binding domain

118

311

0.94

PF01494

FAD_binding_3

FAD binding domain

1

119

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3itj-assembly2.cif.gz_C crystal structure of saccharomyces cerevisiae thioredoxin reductase 1 (trr1) 0.8689 104 139
6sw2-assembly1.cif.gz_A crystal structure of p. aeruginosa pqsl in complex with 2-aminobenzoylacetate 0.8426 2 345
6sw1-assembly1.cif.gz_A crystal structure of p. aeruginosa pqsl: r41y, i43r, g45r, c105g mutant 0.8413 2 345
2x3n-assembly1.cif.gz_A crystal structure of pqsl, a probable fad-dependent monooxygenase from pseudomonas aeruginosa 0.8368 2 345
5utx-assembly1.cif.gz_B crystal structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 - apo form 0.8348 108 139
ID Description Score Start End Superfamily
af_O65936_274_405_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9641 211 340 3.50.50.60
af_O65936_46_234_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9465 3 164 3.50.50.60
af_O65936_274_405_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9429 211 340 3.50.50.60
4ykgA03 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8685 94 139 3.50.50.60
2x3nA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8591 2 345 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2V7FU06-F1-model_v4 FAD-binding domain-containing protein 0.9827 2 382 GO:0016491
GO:0071949
AF-A0A0Q9HSD3-F1-model_v4 FAD-binding domain-containing protein 0.982 1 387 GO:0016491
GO:0071949
AF-A0A370I8C1-F1-model_v4 2-polyprenyl-6-methoxyphenol hydroxylase-like FAD-dependent oxidoreductase 0.9777 1 384 GO:0016491
GO:0071949
AF-A0A0Q9HSD3-F1-model_v4 FAD-binding domain-containing protein 0.9721 1 387 GO:0016491
GO:0071949
AF-A0A166KPL1-F1-model_v4 Monooxygenase 0.9695 4 382 GO:0004497
GO:0071949

Map